F327258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 216 | 134 | 216 | 479 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10027351|Ga0070692_100273512 |
| Length | 529 |
| Sequence | VGHQFPLRSARGLGLQLTFANRSRQGADGFDLTFAPQLRINREQQLSIENLINSRLRAIAVVILVWAVIYLPALGSIAIKGEEGRRILPAVRMLETGNYIVPQVGSNPYYRKPPLVNWLVAASFKLFGVRNEWTARLPSALSVLAVAIAFVTVARASLGPRGSIIAAMIWLTNIGIIEKGRLIEIEALYVSLCGLAIILWLSFFLQKKSPWLIWLPASVFLGLGLLAKGPLHLIFFYGIVIAVLAYWKDWRVLVHPAHFVGLVVMVGIAAAWAIPFLRSTTSHVAIDKWSGQYTGRLKGIDFKFSDWIQNIPRGLIYFLPWVLLFPFARFSRLHEHSEQRLARALSWGIAVPVLALNLVPGAIPRYSMPAIVAESWLLGMICAGNAFQWPRGWMKDERVWARVMAAFVVLGLVIGAIGYPVTAIVLKNRQQVKTAAAEINALVPTNETLYAVNPDYQPVFFYVKSPVQYVSHVKNLPPNVRYFLVRNKNETEALIARDWAPLRARPIARVRDYSKREMVLFKVAPADED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 102 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 119 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 120 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 121 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 122 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 125 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 126 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 127 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 128 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 129 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.93 |
| Nodule | 0 |
| Rhizoplane | 7.87 |
| Rhizosphere | 88.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000007 | 3300000545 | Bacteria | 43751 |
| 2 | JGI24035J26624_1000834 | 3300002126 | Bacteria | 2914 |
| 3 | JGI25406J46586_10000020 | 3300003203 | Bacteria | 86123 |
| 4 | rootL2_10058241 | 3300003322 | Bacteria | 12815 |
| 5 | Ga0065712_10012578 | 3300005290 | Unclassified | 2850 |
| 6 | Ga0065712_10097634 | 3300005290 | Bacteria | 2143 |
| 7 | Ga0065715_10000762 | 3300005293 | Bacteria | 12324 |
| 8 | Ga0065715_10000982 | 3300005293 | Bacteria | 10601 |
| 9 | Ga0065715_10089220 | 3300005293 | Bacteria | 12350 |
| 10 | Ga0065715_10100179 | 3300005293 | Unclassified | 3319 |
| 11 | Ga0065715_10155493 | 3300005293 | Unclassified | 1682 |
| 12 | Ga0070676_10018485 | 3300005328 | Bacteria | 3864 |
| 13 | Ga0070690_100065920 | 3300005330 | Bacteria | 2342 |
| 14 | Ga0070670_100073967 | 3300005331 | Bacteria | 2927 |
| 15 | Ga0068869_100017030 | 3300005334 | Unclassified | 4916 |
| 16 | Ga0068868_100044277 | 3300005338 | Bacteria | 3480 |
| 17 | Ga0070660_100054924 | 3300005339 | Bacteria | 3077 |
| 18 | Ga0070689_100014752 | 3300005340 | Bacteria | 5684 |
| 19 | Ga0070689_100018989 | 3300005340 | Bacteria | 5076 |
| 20 | Ga0070687_100018982 | 3300005343 | Bacteria | 3192 |
| 21 | Ga0070687_100029196 | 3300005343 | Bacteria | 2683 |
| 22 | Ga0070661_100025384 | 3300005344 | Bacteria | 4258 |
| 23 | Ga0070692_10027351 | 3300005345 | Bacteria | 2826 |
| 24 | Ga0070668_100006655 | 3300005347 | Bacteria | 8569 |
| 25 | Ga0070668_100039531 | 3300005347 | Bacteria | 3607 |
| 26 | Ga0070669_100004081 | 3300005353 | Bacteria | 10575 |
| 27 | Ga0070669_100040571 | 3300005353 | Unclassified | 3383 |
| 28 | Ga0070669_100157796 | 3300005353 | Bacteria | 1761 |
| 29 | Ga0070675_100001583 | 3300005354 | Bacteria | 16801 |
| 30 | Ga0070675_100006473 | 3300005354 | Bacteria | 8993 |
| 31 | Ga0070675_100017661 | 3300005354 | Bacteria | 5673 |
| 32 | Ga0070675_100027645 | 3300005354 | Bacteria | 4559 |
| 33 | Ga0070674_100075951 | 3300005356 | Bacteria | 2388 |
| 34 | Ga0070673_100021136 | 3300005364 | Bacteria | 4710 |
| 35 | Ga0070688_100025086 | 3300005365 | Bacteria | 3526 |
| 36 | Ga0070688_100035476 | 3300005365 | Unclassified | 3030 |
| 37 | Ga0070688_100121018 | 3300005365 | Bacteria | 1753 |
| 38 | Ga0070659_100003742 | 3300005366 | Bacteria | 10851 |
| 39 | Ga0070667_100072629 | 3300005367 | Bacteria | 2932 |
| 40 | Ga0070714_100028987 | 3300005435 | Bacteria | 4598 |
| 41 | Ga0070714_100034231 | 3300005435 | Bacteria | 4253 |
| 42 | Ga0070713_100045503 | 3300005436 | Unclassified | 3597 |
| 43 | Ga0070710_10026705 | 3300005437 | Bacteria | 3071 |
| 44 | Ga0070705_100005709 | 3300005440 | Bacteria | 6077 |
| 45 | Ga0070708_100090599 | 3300005445 | Bacteria | 2784 |
| 46 | Ga0070708_100092227 | 3300005445 | Bacteria | 2759 |
| 47 | Ga0070681_10016646 | 3300005458 | Bacteria | 7339 |
| 48 | Ga0070706_100000012 | 3300005467 | Bacteria | 195040 |
| 49 | Ga0070706_100034432 | 3300005467 | Bacteria | 4679 |
| 50 | Ga0070706_100037566 | 3300005467 | Bacteria | 4473 |
| 51 | Ga0070706_100039827 | 3300005467 | Unclassified | 4337 |
| 52 | Ga0070706_100092831 | 3300005467 | Bacteria | 2800 |
| 53 | Ga0070706_100102422 | 3300005467 | Unclassified | 2662 |
| 54 | Ga0070707_100002304 | 3300005468 | Bacteria | 18243 |
| 55 | Ga0070707_100009888 | 3300005468 | Bacteria | 8878 |
| 56 | Ga0070707_100022855 | 3300005468 | Bacteria | 5912 |
| 57 | Ga0070707_100044240 | 3300005468 | Unclassified | 4262 |
| 58 | Ga0070707_100082020 | 3300005468 | Bacteria | 3114 |
| 59 | Ga0070698_100000413 | 3300005471 | Bacteria | 45525 |
| 60 | Ga0070698_100250890 | 3300005471 | Unclassified | 1702 |
| 61 | Ga0070698_100257786 | 3300005471 | Unclassified | 1676 |
| 62 | Ga0070699_100119026 | 3300005518 | Bacteria | 2322 |
| 63 | Ga0070679_100012779 | 3300005530 | Bacteria | 8033 |
| 64 | Ga0070684_100001230 | 3300005535 | Bacteria | 18389 |
| 65 | Ga0070697_100000877 | 3300005536 | Bacteria | 22621 |
| 66 | Ga0070697_100002803 | 3300005536 | Bacteria | 13427 |
| 67 | Ga0070697_100011039 | 3300005536 | Bacteria | 7058 |
| 68 | Ga0070697_100013419 | 3300005536 | Bacteria | 6426 |
| 69 | Ga0070697_100015168 | 3300005536 | Bacteria | 6051 |
| 70 | Ga0070697_100025936 | 3300005536 | Unclassified | 4675 |
| 71 | Ga0070697_100052690 | 3300005536 | Bacteria | 3306 |
| 72 | Ga0070697_100101489 | 3300005536 | Bacteria | 2390 |
| 73 | Ga0070697_100159215 | 3300005536 | Bacteria | 1907 |
| 74 | Ga0070686_100040139 | 3300005544 | Bacteria | 2919 |
| 75 | Ga0070695_100132076 | 3300005545 | Unclassified | 1722 |
| 76 | Ga0070704_100088572 | 3300005549 | Bacteria | 2300 |
| 77 | Ga0070664_100079260 | 3300005564 | Bacteria | 2827 |
| 78 | Ga0070664_100090156 | 3300005564 | Unclassified | 2653 |
| 79 | Ga0068856_100012502 | 3300005614 | Bacteria | 8219 |
| 80 | Ga0068861_100203989 | 3300005719 | Unclassified | 1661 |
| 81 | Ga0068863_100036246 | 3300005841 | Bacteria | 4699 |
| 82 | Ga0068860_100096599 | 3300005843 | Unclassified | 2816 |
| 83 | Ga0068862_100036518 | 3300005844 | Bacteria | 4165 |
| 84 | Ga0081455_10000547 | 3300005937 | Bacteria | 48774 |
| 85 | Ga0081455_10011367 | 3300005937 | Bacteria | 8948 |
| 86 | Ga0081455_10011991 | 3300005937 | Bacteria | 8675 |
| 87 | Ga0081455_10133117 | 3300005937 | Bacteria | 1941 |
| 88 | Ga0081540_1000016 | 3300005983 | Bacteria | 165370 |
| 89 | Ga0081539_10000052 | 3300005985 | Bacteria | 268240 |
| 90 | Ga0081539_10005712 | 3300005985 | Bacteria | 12453 |
| 91 | Ga0081539_10072898 | 3300005985 | Bacteria | 1834 |
| 92 | Ga0070717_10011302 | 3300006028 | Bacteria | 6775 |
| 93 | Ga0070717_10015078 | 3300006028 | Bacteria | 5959 |
| 94 | Ga0070712_100005686 | 3300006175 | Bacteria | 7710 |
| 95 | Ga0070712_100064104 | 3300006175 | Bacteria | 2605 |
| 96 | Ga0070712_100097844 | 3300006175 | Bacteria | 2163 |
| 97 | Ga0068865_100016346 | 3300006881 | Unclassified | 4747 |
| 98 | Ga0105245_10126848 | 3300009098 | Bacteria | 2390 |
| 99 | Ga0114129_10005519 | 3300009147 | Bacteria | 17888 |
| 100 | Ga0114129_10388886 | 3300009147 | Unclassified | 1840 |
| 101 | Ga0105243_10021771 | 3300009148 | Unclassified | 4868 |
| 102 | Ga0105242_10087159 | 3300009176 | Unclassified | 2621 |
| 103 | Ga0105249_10054488 | 3300009553 | Unclassified | 3657 |
| 104 | Ga0099796_10010993 | 3300010159 | Bacteria | 2510 |
| 105 | Ga0105239_10093380 | 3300010375 | Bacteria | 3322 |
| 106 | Ga0157374_10000124 | 3300013296 | Bacteria | 70277 |
| 107 | Ga0157374_10092005 | 3300013296 | Bacteria | 2893 |
| 108 | Ga0157374_10104911 | 3300013296 | Bacteria | 2714 |
| 109 | Ga0157374_10139578 | 3300013296 | Bacteria | 2352 |
| 110 | Ga0157378_10013648 | 3300013297 | Bacteria | 7104 |
| 111 | Ga0157378_10023356 | 3300013297 | Bacteria | 5442 |
| 112 | Ga0157378_10219404 | 3300013297 | Bacteria | 1807 |
| 113 | Ga0163162_10032556 | 3300013306 | Bacteria | 5179 |
| 114 | Ga0163162_10165197 | 3300013306 | Bacteria | 2337 |
| 115 | Ga0157372_10045387 | 3300013307 | Unclassified | 4874 |
| 116 | Ga0157372_10089930 | 3300013307 | Bacteria | 3489 |
| 117 | Ga0157375_10021927 | 3300013308 | Bacteria | 5870 |
| 118 | Ga0157375_10081515 | 3300013308 | Unclassified | 3276 |
| 119 | Ga0157375_10227194 | 3300013308 | Viruses | 2025 |
| 120 | Ga0163163_10177686 | 3300014325 | Bacteria | 2176 |
| 121 | Ga0163163_10227263 | 3300014325 | Bacteria | 1915 |
| 122 | Ga0157379_10049426 | 3300014968 | Bacteria | 3755 |
| 123 | Ga0157376_10002533 | 3300014969 | Bacteria | 12385 |
| 124 | Ga0163161_10038913 | 3300017792 | Unclassified | 3412 |
| 125 | Ga0213876_10000668 | 3300021384 | Bacteria | 24442 |
| 126 | Ga0209050_1002578 | 3300025298 | Bacteria | 15071 |
| 127 | Ga0207697_10000910 | 3300025315 | Bacteria | 16718 |
| 128 | Ga0207697_10000987 | 3300025315 | Bacteria | 15911 |
| 129 | Ga0207697_10003031 | 3300025315 | Bacteria | 8444 |
| 130 | Ga0207697_10032121 | 3300025315 | Unclassified | 2148 |
| 131 | Ga0207653_10001847 | 3300025885 | Bacteria | 6763 |
| 132 | Ga0207647_10040818 | 3300025904 | Bacteria | 2920 |
| 133 | Ga0207645_10002727 | 3300025907 | Bacteria | 13752 |
| 134 | Ga0207645_10005412 | 3300025907 | Bacteria | 9258 |
| 135 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 136 | Ga0207684_10005208 | 3300025910 | Bacteria | 12086 |
| 137 | Ga0207684_10007109 | 3300025910 | Bacteria | 10117 |
| 138 | Ga0207684_10012557 | 3300025910 | Bacteria | 7362 |
| 139 | Ga0207684_10030663 | 3300025910 | Bacteria | 4576 |
| 140 | Ga0207684_10030932 | 3300025910 | Bacteria | 4556 |
| 141 | Ga0207693_10044279 | 3300025915 | Unclassified | 3498 |
| 142 | Ga0207693_10065230 | 3300025915 | Bacteria | 2852 |
| 143 | Ga0207693_10094098 | 3300025915 | Bacteria | 2349 |
| 144 | Ga0207660_10115376 | 3300025917 | Bacteria | 2027 |
| 145 | Ga0207662_10003888 | 3300025918 | Bacteria | 7776 |
| 146 | Ga0207646_10000734 | 3300025922 | Bacteria | 42601 |
| 147 | Ga0207646_10007409 | 3300025922 | Bacteria | 11154 |
| 148 | Ga0207646_10014461 | 3300025922 | Bacteria | 7495 |
| 149 | Ga0207646_10016773 | 3300025922 | Bacteria | 6871 |
| 150 | Ga0207646_10083867 | 3300025922 | Bacteria | 2850 |
| 151 | Ga0207646_10100955 | 3300025922 | Unclassified | 2587 |
| 152 | Ga0207659_10026138 | 3300025926 | Bacteria | 3935 |
| 153 | Ga0207659_10036746 | 3300025926 | Bacteria | 3396 |
| 154 | Ga0207700_10061719 | 3300025928 | Unclassified | 2844 |
| 155 | Ga0207644_10073640 | 3300025931 | Unclassified | 2505 |
| 156 | Ga0207690_10001063 | 3300025932 | Bacteria | 17575 |
| 157 | Ga0207706_10006989 | 3300025933 | Bacteria | 10429 |
| 158 | Ga0207670_10005418 | 3300025936 | Bacteria | 6999 |
| 159 | Ga0207669_10010164 | 3300025937 | Unclassified | 4519 |
| 160 | Ga0207665_10017640 | 3300025939 | Unclassified | 4690 |
| 161 | Ga0207691_10004768 | 3300025940 | Bacteria | 13115 |
| 162 | Ga0207689_10041940 | 3300025942 | Bacteria | 3787 |
| 163 | Ga0207661_10014059 | 3300025944 | Bacteria | 5856 |
| 164 | Ga0207661_10049724 | 3300025944 | Bacteria | 3338 |
| 165 | Ga0207651_10078646 | 3300025960 | Bacteria | 2366 |
| 166 | Ga0207668_10013787 | 3300025972 | Bacteria | 4988 |
| 167 | Ga0207668_10035266 | 3300025972 | Unclassified | 3328 |
| 168 | Ga0207658_10172639 | 3300025986 | Unclassified | 1782 |
| 169 | Ga0207677_10030586 | 3300026023 | Bacteria | 3439 |
| 170 | Ga0207677_10074153 | 3300026023 | Bacteria | 2413 |
| 171 | Ga0207641_10098013 | 3300026088 | Bacteria | 2577 |
| 172 | Ga0207683_10058711 | 3300026121 | Unclassified | 3378 |
| 173 | Ga0209974_10034193 | 3300027876 | Bacteria | 1688 |
| 174 | Ga0268266_10044746 | 3300028379 | Bacteria | 3784 |
| 175 | Ga0307513_10024479 | 3300031456 | Bacteria | 7025 |
| 176 | Ga0373943_0021280 | 3300035170 | Bacteria | 2994 |
| 177 | Ga0373955_0004170 | 3300035172 | Bacteria | 6378 |
| 178 | Ga0373947_0004396 | 3300035725 | Bacteria | 8265 |
| 179 | Ga0373947_0019043 | 3300035725 | Unclassified | 3956 |
| 180 | Ga0373947_0021991 | 3300035725 | Bacteria | 3696 |
| 181 | Ga0395900_0009306 | 3300037418 | Bacteria | 10071 |
| 182 | Ga0395905_0015247 | 3300037471 | Bacteria | 7307 |
| 183 | Ga0436364_0310882 | 3300037853 | Bacteria | 2845 |
| 184 | Ga0395901_0016205 | 3300038443 | Bacteria | 7592 |
| 185 | Ga0436365_1432120 | 3300039437 | Bacteria | 33957 |
| 186 | Ga0439460_0010993 | 3300042461 | Bacteria | 2329 |
| 187 | Ga0466967_0070380 | 3300045976 | Bacteria | 3130 |
| 188 | Ga0495594_0097542 | 3300046499 | Bacteria | 1652 |
| 189 | Ga0495630_0092545 | 3300046517 | Unclassified | 2285 |
| 190 | Ga0495586_0017718 | 3300046535 | Bacteria | 3789 |
| 191 | Ga0495667_0021966 | 3300046559 | Bacteria | 4302 |
| 192 | Ga0495669_0019465 | 3300046684 | Bacteria | 2930 |
| 193 | Ga0495613_0057212 | 3300046689 | Bacteria | 2863 |
| 194 | Ga0495674_0111945 | 3300047319 | Unclassified | 2313 |
| 195 | Ga0496101_0010586 | 3300048904 | Bacteria | 6092 |
| 196 | Ga0496102_0003433 | 3300048905 | Bacteria | 13430 |
| 197 | Ga0496102_0032957 | 3300048905 | Bacteria | 4656 |
| 198 | Ga0496102_0160114 | 3300048905 | Bacteria | 2117 |
| 199 | Ga0496103_0012818 | 3300048906 | Bacteria | 4972 |
| 200 | Ga0496104_0097690 | 3300048907 | Unclassified | 2811 |
| 201 | Ga0496104_0110852 | 3300048907 | Archaea | 2631 |
| 202 | Ga0496107_0001614 | 3300048910 | Bacteria | 14042 |
| 203 | Ga0496108_0081625 | 3300048911 | Unclassified | 2740 |
| 204 | Ga0496109_0012179 | 3300048912 | Bacteria | 7420 |
| 205 | Ga0496109_0248212 | 3300048912 | Unclassified | 1676 |
| 206 | Ga0496110_0106027 | 3300048913 | Unclassified | 2522 |
| 207 | Ga0496111_0049647 | 3300048914 | Unclassified | 3026 |
| 208 | Ga0496112_0038290 | 3300048915 | Bacteria | 4682 |
| 209 | Ga0496113_0112540 | 3300048916 | Bacteria | 2120 |
| 210 | Ga0496114_0019884 | 3300048917 | Bacteria | 5445 |
| 211 | Ga0496115_0015642 | 3300048918 | Bacteria | 5759 |
| 212 | nmdc:mga05p37_3657_c1 | 3300050507 | Bacteria | 17976 |
| 213 | nmdc:mga0n895_141842_c1 | 3300050512 | Unclassified | 2431 |
| 214 | Ga0495601_0029334 | 3300053077 | Unclassified | 3411 |
| 215 | Ga0495612_0020230 | 3300053078 | Unclassified | 2668 |
| 216 | Ga0500616_0002569 | 3300053153 | Bacteria | 14952 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048916 | Ga0496113_0112540 | Ga0496113_0112540_28_1308 | 404 |
| 2 | 3300005293 | Ga0065715_10155493 | Ga0065715_101554931 | 415 |
| 3 | 3300025926 | Ga0207659_10036746 | Ga0207659_100367462 | 415 |
| 4 | 3300025944 | Ga0207661_10049724 | Ga0207661_100497242 | 415 |
| 5 | 3300026088 | Ga0207641_10098013 | Ga0207641_100980132 | 415 |
| 6 | 3300046499 | Ga0495594_0097542 | Ga0495594_0097542_307_1620 | 415 |
| 7 | 3300048905 | Ga0496102_0160114 | Ga0496102_0160114_72_1385 | 415 |
| 8 | 3300050512 | nmdc:mga0n895_141842_c1 | nmdc:mga0n895_141842_c1_27_1340 | 415 |
| 9 | 3300025922 | Ga0207646_10014461 | Ga0207646_100144615 | 416 |
| 10 | 3300035725 | Ga0373947_0004396 | Ga0373947_0004396_4984_6438 | 423 |
| 11 | 3300006175 | Ga0070712_100097844 | Ga0070712_1000978442 | 424 |
| 12 | 3300009176 | Ga0105242_10087159 | Ga0105242_100871592 | 424 |
| 13 | 3300005467 | Ga0070706_100039827 | Ga0070706_1000398272 | 427 |
| 14 | 3300037853 | Ga0436364_0310882 | Ga0436364_0310882_412_1947 | 428 |
| 15 | 3300005293 | Ga0065715_10000982 | Ga0065715_100009823 | 432 |
| 16 | 3300013297 | Ga0157378_10219404 | Ga0157378_102194041 | 432 |
| 17 | 3300053153 | Ga0500616_0002569 | Ga0500616_0002569_5320_6699 | 437 |
| 18 | 3300003322 | rootL2_10058241 | rootL2_100582416 | 439 |
| 19 | 3300039437 | Ga0436365_1432120 | Ga0436365_1432120_19701_21233 | 439 |
| 20 | 3300005290 | Ga0065712_10012578 | Ga0065712_100125782 | 440 |
| 21 | 3300005365 | Ga0070688_100121018 | Ga0070688_1001210181 | 440 |
| 22 | 3300013296 | Ga0157374_10000124 | Ga0157374_1000012450 | 440 |
| 23 | 3300014325 | Ga0163163_10227263 | Ga0163163_102272631 | 440 |
| 24 | 3300042461 | Ga0439460_0010993 | Ga0439460_0010993_316_1704 | 440 |
| 25 | 3300046684 | Ga0495669_0019465 | Ga0495669_0019465_1429_2817 | 440 |
| 26 | 3300048912 | Ga0496109_0012179 | Ga0496109_0012179_2655_4043 | 440 |
| 27 | 3300048914 | Ga0496111_0049647 | Ga0496111_0049647_979_2367 | 440 |
| 28 | 3300048915 | Ga0496112_0038290 | Ga0496112_0038290_2868_4256 | 440 |
| 29 | 3300035170 | Ga0373943_0021280 | Ga0373943_0021280_1538_2926 | 441 |
| 30 | 3300025298 | Ga0209050_1002578 | Ga0209050_100257811 | 442 |
| 31 | 3300048912 | Ga0496109_0248212 | Ga0496109_0248212_17_1411 | 442 |
| 32 | 3300021384 | Ga0213876_10000668 | Ga0213876_1000066821 | 444 |
| 33 | 3300028379 | Ga0268266_10044746 | Ga0268266_100447462 | 444 |
| 34 | 3300005331 | Ga0070670_100073967 | Ga0070670_1000739672 | 446 |
| 35 | 3300005564 | Ga0070664_100079260 | Ga0070664_1000792602 | 446 |
| 36 | 3300005937 | Ga0081455_10011367 | Ga0081455_100113672 | 446 |
| 37 | 3300025944 | Ga0207661_10014059 | Ga0207661_100140592 | 446 |
| 38 | 3300005365 | Ga0070688_100035476 | Ga0070688_1000354762 | 447 |
| 39 | 3300026121 | Ga0207683_10058711 | Ga0207683_100587111 | 447 |
| 40 | 3300048906 | Ga0496103_0012818 | Ga0496103_0012818_2230_3723 | 447 |
| 41 | 3300005985 | Ga0081539_10072898 | Ga0081539_100728982 | 448 |
| 42 | 3300005937 | Ga0081455_10000547 | Ga0081455_1000054732 | 449 |
| 43 | 3300009147 | Ga0114129_10005519 | Ga0114129_100055197 | 449 |
| 44 | 3300035172 | Ga0373955_0004170 | Ga0373955_0004170_2544_3959 | 449 |
| 45 | 3300046559 | Ga0495667_0021966 | Ga0495667_0021966_1491_2906 | 449 |
| 46 | 3300050507 | nmdc:mga05p37_3657_c1 | nmdc:mga05p37_3657_c1_6851_8263 | 449 |
| 47 | 3300005290 | Ga0065712_10097634 | Ga0065712_100976341 | 450 |
| 48 | 3300005293 | Ga0065715_10000762 | Ga0065715_100007622 | 450 |
| 49 | 3300005330 | Ga0070690_100065920 | Ga0070690_1000659202 | 450 |
| 50 | 3300005347 | Ga0070668_100006655 | Ga0070668_1000066551 | 450 |
| 51 | 3300005353 | Ga0070669_100040571 | Ga0070669_1000405712 | 450 |
| 52 | 3300005354 | Ga0070675_100017661 | Ga0070675_1000176614 | 450 |
| 53 | 3300006175 | Ga0070712_100064104 | Ga0070712_1000641041 | 450 |
| 54 | 3300006881 | Ga0068865_100016346 | Ga0068865_1000163463 | 450 |
| 55 | 3300013306 | Ga0163162_10165197 | Ga0163162_101651972 | 450 |
| 56 | 3300017792 | Ga0163161_10038913 | Ga0163161_100389132 | 450 |
| 57 | 3300025315 | Ga0207697_10000987 | Ga0207697_1000098712 | 450 |
| 58 | 3300025907 | Ga0207645_10002727 | Ga0207645_1000272714 | 450 |
| 59 | 3300025926 | Ga0207659_10026138 | Ga0207659_100261382 | 450 |
| 60 | 3300025933 | Ga0207706_10006989 | Ga0207706_100069897 | 450 |
| 61 | 3300025937 | Ga0207669_10010164 | Ga0207669_100101643 | 450 |
| 62 | 3300025940 | Ga0207691_10004768 | Ga0207691_100047689 | 450 |
| 63 | 3300025972 | Ga0207668_10013787 | Ga0207668_100137872 | 450 |
| 64 | 3300026023 | Ga0207677_10074153 | Ga0207677_100741532 | 450 |
| 65 | 3300048904 | Ga0496101_0010586 | Ga0496101_0010586_2876_4369 | 450 |
| 66 | 3300048905 | Ga0496102_0003433 | Ga0496102_0003433_3000_4493 | 450 |
| 67 | 3300048907 | Ga0496104_0110852 | Ga0496104_0110852_1086_2579 | 450 |
| 68 | 3300048910 | Ga0496107_0001614 | Ga0496107_0001614_10570_12063 | 450 |
| 69 | 3300003203 | JGI25406J46586_10000020 | JGI25406J46586_1000002031 | 451 |
| 70 | 3300005536 | Ga0070697_100000877 | Ga0070697_1000008779 | 451 |
| 71 | 3300005985 | Ga0081539_10000052 | Ga0081539_1000005244 | 451 |
| 72 | 3300037418 | Ga0395900_0009306 | Ga0395900_0009306_7223_8641 | 451 |
| 73 | 3300037471 | Ga0395905_0015247 | Ga0395905_0015247_106_1524 | 451 |
| 74 | 3300038443 | Ga0395901_0016205 | Ga0395901_0016205_5569_6987 | 451 |
| 75 | 3300005354 | Ga0070675_100027645 | Ga0070675_1000276454 | 452 |
| 76 | 3300005364 | Ga0070673_100021136 | Ga0070673_1000211364 | 452 |
| 77 | 3300005536 | Ga0070697_100011039 | Ga0070697_1000110395 | 452 |
| 78 | 3300013296 | Ga0157374_10104911 | Ga0157374_101049111 | 452 |
| 79 | 3300013307 | Ga0157372_10089930 | Ga0157372_100899304 | 452 |
| 80 | 3300013308 | Ga0157375_10081515 | Ga0157375_100815152 | 452 |
| 81 | 3300025315 | Ga0207697_10003031 | Ga0207697_100030313 | 452 |
| 82 | 3300025931 | Ga0207644_10073640 | Ga0207644_100736402 | 452 |
| 83 | 3300025960 | Ga0207651_10078646 | Ga0207651_100786462 | 452 |
| 84 | 3300005435 | Ga0070714_100028987 | Ga0070714_1000289873 | 453 |
| 85 | 3300005437 | Ga0070710_10026705 | Ga0070710_100267052 | 453 |
| 86 | 3300005445 | Ga0070708_100090599 | Ga0070708_1000905991 | 453 |
| 87 | 3300005468 | Ga0070707_100044240 | Ga0070707_1000442403 | 453 |
| 88 | 3300005536 | Ga0070697_100013419 | Ga0070697_1000134194 | 453 |
| 89 | 3300005536 | Ga0070697_100025936 | Ga0070697_1000259362 | 453 |
| 90 | 3300005536 | Ga0070697_100052690 | Ga0070697_1000526901 | 453 |
| 91 | 3300005985 | Ga0081539_10005712 | Ga0081539_100057122 | 453 |
| 92 | 3300025922 | Ga0207646_10100955 | Ga0207646_101009552 | 453 |
| 93 | 3300025939 | Ga0207665_10017640 | Ga0207665_100176401 | 453 |
| 94 | 3300005467 | Ga0070706_100092831 | Ga0070706_1000928313 | 454 |
| 95 | 3300005467 | Ga0070706_100102422 | Ga0070706_1001024223 | 454 |
| 96 | 3300005471 | Ga0070698_100000413 | Ga0070698_10000041316 | 454 |
| 97 | 3300005536 | Ga0070697_100159215 | Ga0070697_1001592152 | 454 |
| 98 | 3300005983 | Ga0081540_1000016 | Ga0081540_1000016119 | 454 |
| 99 | 3300006175 | Ga0070712_100005686 | Ga0070712_1000056865 | 454 |
| 100 | 3300025910 | Ga0207684_10012557 | Ga0207684_100125573 | 454 |
| 101 | 3300025922 | Ga0207646_10083867 | Ga0207646_100838673 | 454 |
| 102 | 3300005435 | Ga0070714_100034231 | Ga0070714_1000342312 | 455 |
| 103 | 3300005436 | Ga0070713_100045503 | Ga0070713_1000455032 | 455 |
| 104 | 3300005937 | Ga0081455_10011991 | Ga0081455_100119913 | 455 |
| 105 | 3300006028 | Ga0070717_10011302 | Ga0070717_100113023 | 455 |
| 106 | 3300014325 | Ga0163163_10177686 | Ga0163163_101776862 | 455 |
| 107 | 3300025915 | Ga0207693_10044279 | Ga0207693_100442793 | 455 |
| 108 | 3300025915 | Ga0207693_10065230 | Ga0207693_100652303 | 455 |
| 109 | 3300025928 | Ga0207700_10061719 | Ga0207700_100617192 | 455 |
| 110 | 3300027876 | Ga0209974_10034193 | Ga0209974_100341931 | 455 |
| 111 | 3300048905 | Ga0496102_0032957 | Ga0496102_0032957_2126_3577 | 455 |
| 112 | 3300048907 | Ga0496104_0097690 | Ga0496104_0097690_1155_2606 | 455 |
| 113 | 3300048917 | Ga0496114_0019884 | Ga0496114_0019884_755_2206 | 455 |
| 114 | 3300048918 | Ga0496115_0015642 | Ga0496115_0015642_1278_2729 | 455 |
| 115 | 3300002126 | JGI24035J26624_1000834 | JGI24035J26624_10008342 | 456 |
| 116 | 3300005293 | Ga0065715_10089220 | Ga0065715_100892207 | 456 |
| 117 | 3300005339 | Ga0070660_100054924 | Ga0070660_1000549241 | 456 |
| 118 | 3300005340 | Ga0070689_100018989 | Ga0070689_1000189893 | 456 |
| 119 | 3300005343 | Ga0070687_100029196 | Ga0070687_1000291962 | 456 |
| 120 | 3300005344 | Ga0070661_100025384 | Ga0070661_1000253843 | 456 |
| 121 | 3300005345 | Ga0070692_10027351 | Ga0070692_100273512 | 456 |
| 122 | 3300005354 | Ga0070675_100001583 | Ga0070675_10000158311 | 456 |
| 123 | 3300005356 | Ga0070674_100075951 | Ga0070674_1000759511 | 456 |
| 124 | 3300005365 | Ga0070688_100025086 | Ga0070688_1000250861 | 456 |
| 125 | 3300005366 | Ga0070659_100003742 | Ga0070659_1000037424 | 456 |
| 126 | 3300005458 | Ga0070681_10016646 | Ga0070681_100166462 | 456 |
| 127 | 3300005530 | Ga0070679_100012779 | Ga0070679_1000127794 | 456 |
| 128 | 3300005535 | Ga0070684_100001230 | Ga0070684_1000012303 | 456 |
| 129 | 3300005544 | Ga0070686_100040139 | Ga0070686_1000401392 | 456 |
| 130 | 3300005564 | Ga0070664_100090156 | Ga0070664_1000901563 | 456 |
| 131 | 3300005614 | Ga0068856_100012502 | Ga0068856_1000125024 | 456 |
| 132 | 3300005841 | Ga0068863_100036246 | Ga0068863_1000362462 | 456 |
| 133 | 3300009147 | Ga0114129_10388886 | Ga0114129_103888861 | 456 |
| 134 | 3300010159 | Ga0099796_10010993 | Ga0099796_100109933 | 456 |
| 135 | 3300013296 | Ga0157374_10139578 | Ga0157374_101395781 | 456 |
| 136 | 3300013308 | Ga0157375_10021927 | Ga0157375_100219272 | 456 |
| 137 | 3300014968 | Ga0157379_10049426 | Ga0157379_100494261 | 456 |
| 138 | 3300014969 | Ga0157376_10002533 | Ga0157376_1000253312 | 456 |
| 139 | 3300025315 | Ga0207697_10032121 | Ga0207697_100321212 | 456 |
| 140 | 3300025885 | Ga0207653_10001847 | Ga0207653_100018474 | 456 |
| 141 | 3300025904 | Ga0207647_10040818 | Ga0207647_100408182 | 456 |
| 142 | 3300025915 | Ga0207693_10094098 | Ga0207693_100940983 | 456 |
| 143 | 3300025917 | Ga0207660_10115376 | Ga0207660_101153761 | 456 |
| 144 | 3300025932 | Ga0207690_10001063 | Ga0207690_100010637 | 456 |
| 145 | 3300025936 | Ga0207670_10005418 | Ga0207670_100054183 | 456 |
| 146 | 3300035725 | Ga0373947_0021991 | Ga0373947_0021991_1488_2984 | 456 |
| 147 | 3300045976 | Ga0466967_0070380 | Ga0466967_0070380_1390_2922 | 456 |
| 148 | 3300046517 | Ga0495630_0092545 | Ga0495630_0092545_375_1871 | 456 |
| 149 | 3300046535 | Ga0495586_0017718 | Ga0495586_0017718_762_2258 | 456 |
| 150 | 3300046689 | Ga0495613_0057212 | Ga0495613_0057212_493_1989 | 456 |
| 151 | 3300047319 | Ga0495674_0111945 | Ga0495674_0111945_158_1654 | 456 |
| 152 | 3300048911 | Ga0496108_0081625 | Ga0496108_0081625_1220_2716 | 456 |
| 153 | 3300053077 | Ga0495601_0029334 | Ga0495601_0029334_583_2079 | 456 |
| 154 | 3300053078 | Ga0495612_0020230 | Ga0495612_0020230_795_2291 | 456 |
| 155 | 3300005293 | Ga0065715_10100179 | Ga0065715_101001792 | 457 |
| 156 | 3300005440 | Ga0070705_100005709 | Ga0070705_1000057093 | 457 |
| 157 | 3300005445 | Ga0070708_100092227 | Ga0070708_1000922271 | 457 |
| 158 | 3300005468 | Ga0070707_100082020 | Ga0070707_1000820202 | 457 |
| 159 | 3300005518 | Ga0070699_100119026 | Ga0070699_1001190262 | 457 |
| 160 | 3300025910 | Ga0207684_10005208 | Ga0207684_100052084 | 457 |
| 161 | 3300025910 | Ga0207684_10007109 | Ga0207684_100071096 | 457 |
| 162 | 3300048913 | Ga0496110_0106027 | Ga0496110_0106027_363_1874 | 457 |
| 163 | 3300005536 | Ga0070697_100101489 | Ga0070697_1001014892 | 458 |
| 164 | 3300005467 | Ga0070706_100034432 | Ga0070706_1000344323 | 459 |
| 165 | 3300005467 | Ga0070706_100037566 | Ga0070706_1000375663 | 459 |
| 166 | 3300005468 | Ga0070707_100022855 | Ga0070707_1000228553 | 459 |
| 167 | 3300005937 | Ga0081455_10133117 | Ga0081455_101331171 | 459 |
| 168 | 3300025910 | Ga0207684_10030663 | Ga0207684_100306632 | 459 |
| 169 | 3300025910 | Ga0207684_10030932 | Ga0207684_100309323 | 459 |
| 170 | 3300025922 | Ga0207646_10016773 | Ga0207646_100167733 | 459 |
| 171 | 3300035725 | Ga0373947_0019043 | Ga0373947_0019043_592_2085 | 459 |
| 172 | 3300005467 | Ga0070706_100000012 | Ga0070706_10000001271 | 460 |
| 173 | 3300005468 | Ga0070707_100002304 | Ga0070707_1000023043 | 460 |
| 174 | 3300005468 | Ga0070707_100009888 | Ga0070707_1000098885 | 460 |
| 175 | 3300005471 | Ga0070698_100250890 | Ga0070698_1002508901 | 460 |
| 176 | 3300005471 | Ga0070698_100257786 | Ga0070698_1002577861 | 460 |
| 177 | 3300005536 | Ga0070697_100002803 | Ga0070697_1000028034 | 460 |
| 178 | 3300005536 | Ga0070697_100015168 | Ga0070697_1000151685 | 460 |
| 179 | 3300006028 | Ga0070717_10015078 | Ga0070717_100150782 | 460 |
| 180 | 3300013297 | Ga0157378_10013648 | Ga0157378_100136485 | 460 |
| 181 | 3300025910 | Ga0207684_10000028 | Ga0207684_10000028198 | 460 |
| 182 | 3300025922 | Ga0207646_10000734 | Ga0207646_100007348 | 460 |
| 183 | 3300025922 | Ga0207646_10007409 | Ga0207646_100074093 | 460 |
| 184 | 3300005545 | Ga0070695_100132076 | Ga0070695_1001320762 | 462 |
| 185 | 3300005328 | Ga0070676_10018485 | Ga0070676_100184852 | 463 |
| 186 | 3300005334 | Ga0068869_100017030 | Ga0068869_1000170302 | 463 |
| 187 | 3300005338 | Ga0068868_100044277 | Ga0068868_1000442773 | 463 |
| 188 | 3300005340 | Ga0070689_100014752 | Ga0070689_1000147524 | 463 |
| 189 | 3300005343 | Ga0070687_100018982 | Ga0070687_1000189822 | 463 |
| 190 | 3300005347 | Ga0070668_100039531 | Ga0070668_1000395312 | 463 |
| 191 | 3300005353 | Ga0070669_100004081 | Ga0070669_1000040813 | 463 |
| 192 | 3300005354 | Ga0070675_100006473 | Ga0070675_1000064738 | 463 |
| 193 | 3300005367 | Ga0070667_100072629 | Ga0070667_1000726293 | 463 |
| 194 | 3300005549 | Ga0070704_100088572 | Ga0070704_1000885721 | 463 |
| 195 | 3300005719 | Ga0068861_100203989 | Ga0068861_1002039891 | 463 |
| 196 | 3300005843 | Ga0068860_100096599 | Ga0068860_1000965992 | 463 |
| 197 | 3300005844 | Ga0068862_100036518 | Ga0068862_1000365182 | 463 |
| 198 | 3300009148 | Ga0105243_10021771 | Ga0105243_100217713 | 463 |
| 199 | 3300009553 | Ga0105249_10054488 | Ga0105249_100544882 | 463 |
| 200 | 3300010375 | Ga0105239_10093380 | Ga0105239_100933802 | 463 |
| 201 | 3300013296 | Ga0157374_10092005 | Ga0157374_100920053 | 463 |
| 202 | 3300013297 | Ga0157378_10023356 | Ga0157378_100233564 | 463 |
| 203 | 3300013306 | Ga0163162_10032556 | Ga0163162_100325564 | 463 |
| 204 | 3300013307 | Ga0157372_10045387 | Ga0157372_100453874 | 463 |
| 205 | 3300025315 | Ga0207697_10000910 | Ga0207697_1000091010 | 463 |
| 206 | 3300025907 | Ga0207645_10005412 | Ga0207645_100054122 | 463 |
| 207 | 3300025918 | Ga0207662_10003888 | Ga0207662_100038882 | 463 |
| 208 | 3300025942 | Ga0207689_10041940 | Ga0207689_100419403 | 463 |
| 209 | 3300025972 | Ga0207668_10035266 | Ga0207668_100352662 | 463 |
| 210 | 3300025986 | Ga0207658_10172639 | Ga0207658_101726392 | 463 |
| 211 | 3300026023 | Ga0207677_10030586 | Ga0207677_100305862 | 463 |
| 212 | 3300005353 | Ga0070669_100157796 | Ga0070669_1001577961 | 464 |
| 213 | 3300013308 | Ga0157375_10227194 | Ga0157375_102271942 | 464 |
| 214 | 3300031456 | Ga0307513_10024479 | Ga0307513_100244793 | 464 |
| 215 | 3300009098 | Ga0105245_10126848 | Ga0105245_101268481 | 468 |
| 216 | 3300000545 | CNXas_1000007 | CNXas_100000715 | 507 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iz4-assembly1.cif.gz_B | modified e. coli tmrna in the resume state with the trna-like domain in the ribosomal p site interacting with the smpb | 0.735 | 481 | 506 |
| 4rww-assembly1.cif.gz_A | crystal structure of l. monocytogenes psta in complex with cyclic-di-amp | 0.6625 | 461 | 507 |
| 6p25-assembly1.cif.gz_A | structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor and a peptide acceptor | 0.658 | 39 | 271 |
| 1wjx-assembly1.cif.gz_A | crystal sturucture of tt0801 from thermus thermophilus | 0.6099 | 467 | 506 |
| 7bx8-assembly1.cif.gz_B | "mycobacterium smegmatis arabinosyltransferase complex embb2-acpm2 in symmetric ""resting state""" | 0.5953 | 24 | 377 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2czjC00 | Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B | 0.5506 | 468 | 506 | 2.40.280.10 |
| af_Q4CXJ5_292_479_3.30.70.1230 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.5395 | 462 | 506 | 3.30.70.1230 |
| af_P0AFV2_139_215_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.5298 | 461 | 502 | 3.30.70.260 |
| 1d5rA01 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.5089 | 411 | 456 | 3.90.190.10 |
| af_A4HRF2_233_382_3.10.310.20 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;DHHA2 domain | 0.5025 | 458 | 506 | 3.10.310.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1CTL7-F1-model_v4 | Glycosyltransferase family 39 protein | 0.9603 | 44 | 166 |
GO:0005886
GO:0009103 GO:0010041 GO:0016763 |
| AF-A0A7W1CTL7-F1-model_v4 | Glycosyltransferase family 39 protein | 0.9528 | 44 | 166 |
GO:0005886
GO:0009103 GO:0010041 GO:0016763 |
| AF-A0A2V6FGZ6-F1-model_v4 | Glycosyltransferase RgtA/B/C/D-like domain-containing protein | 0.9522 | 39 | 294 |
GO:0005886
GO:0009103 GO:0010041 GO:0016763 |
| AF-A0A2V6FGZ6-F1-model_v4 | Glycosyltransferase RgtA/B/C/D-like domain-containing protein | 0.9379 | 39 | 294 |
GO:0005886
GO:0009103 GO:0010041 GO:0016763 |
| AF-A0A2V5PNK7-F1-model_v4 | Glycosyltransferase RgtA/B/C/D-like domain-containing protein | 0.9325 | 41 | 316 |
GO:0005886
GO:0009103 GO:0010041 GO:0016763 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar