F327281

General Info

Members Datasets Scaffolds Average Seq Length
216 157 432 292

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100000686|Ga0070688_10000068613
Length 315
Sequence MRRRSRPPKALRLAVRAGGLAALGAAVTVPFLRKRKNIPAPVTVAALAAGPLALAVLQPRTKRRDVALFALQMWAFTIAHELPYDDPERLRARLRSRYPIVADRAIGGGRLPNAFLQRAAARLPRVRLVNQVLTWAHWLWFMEPYIALAVILLRHPERFPRAGRQMAAVFDIGCAVYFAVPTAPPWWAAEQGLTSGEEVRRIMVEVGEDTWGSAWPKMYDALGGNPWAAMPSLHFATSVTAALALAEAGKVEGVLGWTYAGTLGFALVYLGEHYVTDLIAGAALVAAVRRGELLAEPLIRGVNAGLQRLERIASS

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 13.43
Rhizosphere 81.48
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100000686 3300005365 Bacteria 16820
2 JGI24746J21847_1000849 3300001977 Bacteria 4732
3 JGI25404J52841_10015011 3300003659 Bacteria 1682
4 Ga0070658_10070935 3300005327 Bacteria 2853
5 Ga0070683_100006417 3300005329 Bacteria 9863
6 Ga0070683_100054472 3300005329 Bacteria 3708
7 Ga0070670_100058745 3300005331 Bacteria 3302
8 Ga0070682_100000026 3300005337 Bacteria 191388
9 Ga0068868_100000694 3300005338 Bacteria 22626
10 Ga0068868_100041028 3300005338 Bacteria 3605
11 Ga0070661_100000004 3300005344 Bacteria 243876
12 Ga0070668_100019643 3300005347 Bacteria 5087
13 Ga0070675_100000050 3300005354 Bacteria 72016
14 Ga0070688_100000010 3300005365 Bacteria 84103
15 Ga0070688_100019397 3300005365 Bacteria 3939
16 Ga0070659_100003678 3300005366 Bacteria 10933
17 Ga0070713_100000503 3300005436 Bacteria 24991
18 Ga0070713_100085392 3300005436 Bacteria 2704
19 Ga0070711_100234697 3300005439 Bacteria 1431
20 Ga0070678_100007037 3300005456 Bacteria 6650
21 Ga0070685_10000010 3300005466 Bacteria 146946
22 Ga0070685_10001080 3300005466 Bacteria 14623
23 Ga0070684_100108271 3300005535 Bacteria 2490
24 Ga0068853_100052420 3300005539 Bacteria 3515
25 Ga0070672_100000031 3300005543 Bacteria 62241
26 Ga0070665_100002868 3300005548 Bacteria 18629
27 Ga0070665_100169521 3300005548 Bacteria 2185
28 Ga0070704_100010089 3300005549 Bacteria 5742
29 Ga0068855_100178310 3300005563 Unclassified 2403
30 Ga0068854_100000082 3300005578 Bacteria 68340
31 Ga0068856_100000136 3300005614 Bacteria 74026
32 Ga0070702_100083703 3300005615 Bacteria 1917
33 Ga0068852_100000994 3300005616 Bacteria 18720
34 Ga0068864_100000090 3300005618 Bacteria 96213
35 Ga0068866_10004817 3300005718 Bacteria 5540
36 Ga0068861_100267619 3300005719 Bacteria 1466
37 Ga0068851_10001071 3300005834 Bacteria 11849
38 Ga0068863_100008832 3300005841 Bacteria 9842
39 Ga0068863_100069236 3300005841 Bacteria 3337
40 Ga0068858_100000046 3300005842 Bacteria 127519
41 Ga0068860_100104071 3300005843 Bacteria 2710
42 Ga0081455_10074196 3300005937 Bacteria 2810
43 Ga0081540_1000557 3300005983 Bacteria 36162
44 Ga0075433_10000337 3300006852 Bacteria 29062
45 Ga0075433_10013191 3300006852 Bacteria 6708
46 Ga0068865_100001495 3300006881 Bacteria 13634
47 Ga0105245_10000117 3300009098 Bacteria 76863
48 Ga0105245_10006841 3300009098 Bacteria 10002
49 Ga0105247_10000131 3300009101 Bacteria 72578
50 Ga0105247_10396418 3300009101 Unclassified 982
51 Ga0114129_10330150 3300009147 Bacteria 2025
52 Ga0105243_10010381 3300009148 Bacteria 7071
53 Ga0105242_10000063 3300009176 Bacteria 74721
54 Ga0105242_10000428 3300009176 Bacteria 33565
55 Ga0105242_10045721 3300009176 Unclassified 3549
56 Ga0105248_10000037 3300009177 Bacteria 180751
57 Ga0105238_10000033 3300009551 Bacteria 172981
58 Ga0105239_10062202 3300010375 Bacteria 4097
59 Ga0157369_10001730 3300013105 Bacteria 26528
60 Ga0157378_10018349 3300013297 Bacteria 6144
61 Ga0157378_10024520 3300013297 Bacteria 5309
62 Ga0157372_10000146 3300013307 Bacteria 77952
63 Ga0157375_10000492 3300013308 Bacteria 35821
64 Ga0157375_10544961 3300013308 Bacteria 1322
65 Ga0157380_10000007 3300014326 Bacteria 157634
66 Ga0157380_10001343 3300014326 Bacteria 16023
67 Ga0157379_10134713 3300014968 Bacteria 2225
68 Ga0163161_10010899 3300017792 Bacteria 6303
69 Ga0207656_10001283 3300025321 Bacteria 8251
70 Ga0207705_10022613 3300025909 Bacteria 4485
71 Ga0207663_10060013 3300025916 Bacteria 2409
72 Ga0207649_10000003 3300025920 Bacteria 388908
73 Ga0207694_10000012 3300025924 Bacteria 411218
74 Ga0207650_10036428 3300025925 Bacteria 3580
75 Ga0207659_10000055 3300025926 Bacteria 74252
76 Ga0207687_10000070 3300025927 Bacteria 77432
77 Ga0207687_10006279 3300025927 Bacteria 7862
78 Ga0207700_10000003 3300025928 Bacteria 500797
79 Ga0207686_10000124 3300025934 Bacteria 62335
80 Ga0207686_10000395 3300025934 Bacteria 30349
81 Ga0207686_10150573 3300025934 Unclassified 1619
82 Ga0207709_10037201 3300025935 Bacteria 2890
83 Ga0207704_10000104 3300025938 Bacteria 46614
84 Ga0207691_10000178 3300025940 Bacteria 60110
85 Ga0207711_10000011 3300025941 Bacteria 518817
86 Ga0207689_10067843 3300025942 Bacteria 2931
87 Ga0207661_10002281 3300025944 Bacteria 13216
88 Ga0207668_10006557 3300025972 Bacteria 6879
89 Ga0207640_10000054 3300025981 Bacteria 95136
90 Ga0207677_10001111 3300026023 Bacteria 14662
91 Ga0207677_10022725 3300026023 Bacteria 3860
92 Ga0207703_10000042 3300026035 Bacteria 161459
93 Ga0207639_10025042 3300026041 Bacteria 4325
94 Ga0207702_10000105 3300026078 Bacteria 97835
95 Ga0207641_10006453 3300026088 Bacteria 9884
96 Ga0207641_10055624 3300026088 Bacteria 3360
97 Ga0207676_10000016 3300026095 Bacteria 311561
98 Ga0207683_10034311 3300026121 Bacteria 4409
99 Ga0207698_10000015 3300026142 Bacteria 207368
100 Ga0268266_10000526 3300028379 Bacteria 53404
101 Ga0268264_10078001 3300028381 Unclassified 2823
102 Ga0307410_10027601 3300031852 Bacteria 3590
103 Ga0373934_0099626 3300035086 Bacteria 1175
104 Ga0395905_0063113 3300037471 Bacteria 3466
105 Ga0395901_0046010 3300038443 Bacteria 4531
106 Ga0466963_0000233 3300044694 Bacteria 24036
107 Ga0466963_0023498 3300044694 Bacteria 3916
108 Ga0466963_0049696 3300044694 Bacteria 2774
109 Ga0466957_0001286 3300044842 Bacteria 13090
110 Ga0466967_0000002 3300045976 Bacteria 219994
111 Ga0466967_0101657 3300045976 Bacteria 2628
112 Ga0495592_0000024 3300046454 Bacteria 136661
113 Ga0495603_0000102 3300046455 Bacteria 40074
114 Ga0495629_0010841 3300046459 Bacteria 6627
115 Ga0495629_0013713 3300046459 Bacteria 5849
116 Ga0495653_0262740 3300046463 Unclassified 1140
117 Ga0495662_0039478 3300046476 Bacteria 2280
118 Ga0495606_0000017 3300046507 Bacteria 284549
119 Ga0495608_0000013 3300046511 Bacteria 228481
120 Ga0495608_0000661 3300046511 Bacteria 23772
121 Ga0495618_0000267 3300046514 Bacteria 37924
122 Ga0495618_0252000 3300046514 Bacteria 1107
123 Ga0495620_0000041 3300046515 Bacteria 112605
124 Ga0495628_0003421 3300046516 Bacteria 14207
125 Ga0495628_0043072 3300046516 Bacteria 3598
126 Ga0495628_0154404 3300046516 Bacteria 1747
127 Ga0495630_0000032 3300046517 Bacteria 134425
128 Ga0495630_0057924 3300046517 Bacteria 2904
129 Ga0495644_0002837 3300046523 Bacteria 6867
130 Ga0495652_0000018 3300046529 Bacteria 201634
131 Ga0495652_0039107 3300046529 Bacteria 4103
132 Ga0495587_0000272 3300046536 Bacteria 36939
133 Ga0495587_0081443 3300046536 Bacteria 1876
134 Ga0495598_0002543 3300046537 Bacteria 3771
135 Ga0495667_0053729 3300046559 Bacteria 2652
136 Ga0495656_0002561 3300046615 Bacteria 6058
137 Ga0495635_0000005 3300046663 Bacteria 302178
138 Ga0495588_0000073 3300046674 Bacteria 219005
139 Ga0495657_0000003 3300046675 Bacteria 279680
140 Ga0495647_0002758 3300046681 Bacteria 5574
141 Ga0495658_0002091 3300046683 Bacteria 10135
142 Ga0495624_0000691 3300046690 Bacteria 26457
143 Ga0495600_0060884 3300046809 Bacteria 2465
144 Ga0495600_0148189 3300046809 Bacteria 1520
145 Ga0495604_0000100 3300047317 Bacteria 72995
146 Ga0495674_0000039 3300047319 Bacteria 97645
147 Ga0495672_0147720 3300047320 Bacteria 1222
148 Ga0495676_0007903 3300047321 Bacteria 9752
149 Ga0495676_0028720 3300047321 Bacteria 4746
150 Ga0495680_0000007 3300047322 Bacteria 152053
151 Ga0495680_0199975 3300047322 Bacteria 1434
152 Ga0495680_0260943 3300047322 Bacteria 1225
153 Ga0495675_0000002 3300047444 Bacteria 216469
154 Ga0495685_080425 3300047447 Unclassified 1085
155 Ga0495684_0225581 3300047471 Archaea 1372
156 Ga0495593_0028546 3300047673 Bacteria 3064
157 Ga0495593_0163151 3300047673 Bacteria 1125
158 Ga0495602_0006995 3300048088 Bacteria 11843
159 Ga0496102_0000749 3300048905 Bacteria 31723
160 Ga0496102_0109702 3300048905 Bacteria 2572
161 Ga0496103_0000481 3300048906 Bacteria 33518
162 Ga0496103_0033064 3300048906 Bacteria 3159
163 Ga0496103_0063036 3300048906 Bacteria 2308
164 Ga0496104_0000010 3300048907 Bacteria 475255
165 Ga0496104_0000579 3300048907 Bacteria 31244
166 Ga0496104_0159551 3300048907 Bacteria 2163
167 Ga0496105_0000005 3300048908 Bacteria 475797
168 Ga0496105_0000051 3300048908 Bacteria 90365
169 Ga0496106_0085219 3300048909 Bacteria 2433
170 Ga0496108_0000005 3300048911 Bacteria 535059
171 Ga0496108_0014805 3300048911 Bacteria 6364
172 Ga0496108_0022092 3300048911 Bacteria 5231
173 Ga0496109_0000002 3300048912 Bacteria 443393
174 Ga0496109_0000221 3300048912 Bacteria 56054
175 Ga0496109_0000378 3300048912 Bacteria 40469
176 Ga0496109_0205864 3300048912 Bacteria 1850
177 Ga0496110_0000052 3300048913 Bacteria 58549
178 Ga0496110_0037084 3300048913 Bacteria 4236
179 Ga0496111_0000121 3300048914 Bacteria 33902
180 Ga0496111_0010830 3300048914 Bacteria 6131
181 Ga0496111_0017569 3300048914 Bacteria 4945
182 Ga0496112_0012664 3300048915 Bacteria 7755
183 Ga0496113_0000005 3300048916 Bacteria 105956
184 Ga0496113_0024909 3300048916 Bacteria 4260
185 Ga0496113_0073661 3300048916 Bacteria 2602
186 Ga0496114_0000003 3300048917 Bacteria 630981
187 Ga0496115_0000827 3300048918 Bacteria 22678
188 Ga0496116_0001008 3300048919 Bacteria 34374
189 Ga0496117_0006601 3300048920 Bacteria 11660
190 Ga0496118_0001859 3300048921 Bacteria 30197
191 Ga0496119_0004936 3300048922 Bacteria 13043
192 Ga0496120_0062907 3300048923 Bacteria 2066
193 Ga0496121_0022580 3300048924 Bacteria 6097
194 Ga0496125_0023046 3300048928 Bacteria 5762
195 Ga0496126_0064227 3300048929 Bacteria 3289
196 Ga0501042_0218757 3300049578 Bacteria 1374
197 Ga0501070_0013883 3300049586 Bacteria 6783
198 Ga0501076_0072613 3300049592 Bacteria 2754
199 Ga0501079_0311480 3300049741 Bacteria 1232
200 Ga0501081_0252722 3300049743 Unclassified 1287
201 nmdc:mga05p37_502418_c1 3300050507 Bacteria 1391
202 nmdc:mga0a205_16247_c1 3300050515 Bacteria 6970
203 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
204 Ga0495601_0043715 3300053077 Bacteria 2814
205 Ga0495612_0000155 3300053078 Bacteria 28711
206 Ga0495655_0000005 3300053083 Bacteria 257472
207 Ga0495655_0001296 3300053083 Bacteria 3853
208 Ga0495595_0000007 3300053084 Bacteria 228504
209 Ga0495595_0000378 3300053084 Bacteria 16864
210 Ga0495619_0000026 3300053085 Bacteria 167387
211 Ga0495619_0000088 3300053085 Bacteria 69615
212 Ga0495619_0214793 3300053085 Bacteria 1332
213 Ga0500566_0001830 3300053094 Bacteria 12505
214 Ga0500566_0050962 3300053094 Unclassified 2369
215 Ga0500628_000013 3300053129 Bacteria 106419
216 Ga0530510_0185234 3300061734 Bacteria 1545
217 Ga0070688_100000686
218 JGI24746J21847_1000849
219 JGI25404J52841_10015011
220 Ga0070658_10070935
221 Ga0070683_100006417
222 Ga0070683_100054472
223 Ga0070670_100058745
224 Ga0070682_100000026
225 Ga0068868_100000694
226 Ga0068868_100041028
227 Ga0070661_100000004
228 Ga0070668_100019643
229 Ga0070675_100000050
230 Ga0070688_100000010
231 Ga0070688_100019397
232 Ga0070659_100003678
233 Ga0070713_100000503
234 Ga0070713_100085392
235 Ga0070711_100234697
236 Ga0070678_100007037
237 Ga0070685_10000010
238 Ga0070685_10001080
239 Ga0070684_100108271
240 Ga0068853_100052420
241 Ga0070672_100000031
242 Ga0070665_100002868
243 Ga0070665_100169521
244 Ga0070704_100010089
245 Ga0068855_100178310
246 Ga0068854_100000082
247 Ga0068856_100000136
248 Ga0070702_100083703
249 Ga0068852_100000994
250 Ga0068864_100000090
251 Ga0068866_10004817
252 Ga0068861_100267619
253 Ga0068851_10001071
254 Ga0068863_100008832
255 Ga0068863_100069236
256 Ga0068858_100000046
257 Ga0068860_100104071
258 Ga0081455_10074196
259 Ga0081540_1000557
260 Ga0075433_10000337
261 Ga0075433_10013191
262 Ga0068865_100001495
263 Ga0105245_10000117
264 Ga0105245_10006841
265 Ga0105247_10000131
266 Ga0105247_10396418
267 Ga0114129_10330150
268 Ga0105243_10010381
269 Ga0105242_10000063
270 Ga0105242_10000428
271 Ga0105242_10045721
272 Ga0105248_10000037
273 Ga0105238_10000033
274 Ga0105239_10062202
275 Ga0157369_10001730
276 Ga0157378_10018349
277 Ga0157378_10024520
278 Ga0157372_10000146
279 Ga0157375_10000492
280 Ga0157375_10544961
281 Ga0157380_10000007
282 Ga0157380_10001343
283 Ga0157379_10134713
284 Ga0163161_10010899
285 Ga0207656_10001283
286 Ga0207705_10022613
287 Ga0207663_10060013
288 Ga0207649_10000003
289 Ga0207694_10000012
290 Ga0207650_10036428
291 Ga0207659_10000055
292 Ga0207687_10000070
293 Ga0207687_10006279
294 Ga0207700_10000003
295 Ga0207686_10000124
296 Ga0207686_10000395
297 Ga0207686_10150573
298 Ga0207709_10037201
299 Ga0207704_10000104
300 Ga0207691_10000178
301 Ga0207711_10000011
302 Ga0207689_10067843
303 Ga0207661_10002281
304 Ga0207668_10006557
305 Ga0207640_10000054
306 Ga0207677_10001111
307 Ga0207677_10022725
308 Ga0207703_10000042
309 Ga0207639_10025042
310 Ga0207702_10000105
311 Ga0207641_10006453
312 Ga0207641_10055624
313 Ga0207676_10000016
314 Ga0207683_10034311
315 Ga0207698_10000015
316 Ga0268266_10000526
317 Ga0268264_10078001
318 Ga0307410_10027601
319 Ga0373934_0099626
320 Ga0395905_0063113
321 Ga0395901_0046010
322 Ga0466963_0000233
323 Ga0466963_0023498
324 Ga0466963_0049696
325 Ga0466957_0001286
326 Ga0466967_0000002
327 Ga0466967_0101657
328 Ga0495592_0000024
329 Ga0495603_0000102
330 Ga0495629_0010841
331 Ga0495629_0013713
332 Ga0495653_0262740
333 Ga0495662_0039478
334 Ga0495606_0000017
335 Ga0495608_0000013
336 Ga0495608_0000661
337 Ga0495618_0000267
338 Ga0495618_0252000
339 Ga0495620_0000041
340 Ga0495628_0003421
341 Ga0495628_0043072
342 Ga0495628_0154404
343 Ga0495630_0000032
344 Ga0495630_0057924
345 Ga0495644_0002837
346 Ga0495652_0000018
347 Ga0495652_0039107
348 Ga0495587_0000272
349 Ga0495587_0081443
350 Ga0495598_0002543
351 Ga0495667_0053729
352 Ga0495656_0002561
353 Ga0495635_0000005
354 Ga0495588_0000073
355 Ga0495657_0000003
356 Ga0495647_0002758
357 Ga0495658_0002091
358 Ga0495624_0000691
359 Ga0495600_0060884
360 Ga0495600_0148189
361 Ga0495604_0000100
362 Ga0495674_0000039
363 Ga0495672_0147720
364 Ga0495676_0007903
365 Ga0495676_0028720
366 Ga0495680_0000007
367 Ga0495680_0199975
368 Ga0495680_0260943
369 Ga0495675_0000002
370 Ga0495685_080425
371 Ga0495684_0225581
372 Ga0495593_0028546
373 Ga0495593_0163151
374 Ga0495602_0006995
375 Ga0496102_0000749
376 Ga0496102_0109702
377 Ga0496103_0000481
378 Ga0496103_0033064
379 Ga0496103_0063036
380 Ga0496104_0000010
381 Ga0496104_0000579
382 Ga0496104_0159551
383 Ga0496105_0000005
384 Ga0496105_0000051
385 Ga0496106_0085219
386 Ga0496108_0000005
387 Ga0496108_0014805
388 Ga0496108_0022092
389 Ga0496109_0000002
390 Ga0496109_0000221
391 Ga0496109_0000378
392 Ga0496109_0205864
393 Ga0496110_0000052
394 Ga0496110_0037084
395 Ga0496111_0000121
396 Ga0496111_0010830
397 Ga0496111_0017569
398 Ga0496112_0012664
399 Ga0496113_0000005
400 Ga0496113_0024909
401 Ga0496113_0073661
402 Ga0496114_0000003
403 Ga0496115_0000827
404 Ga0496116_0001008
405 Ga0496117_0006601
406 Ga0496118_0001859
407 Ga0496119_0004936
408 Ga0496120_0062907
409 Ga0496121_0022580
410 Ga0496125_0023046
411 Ga0496126_0064227
412 Ga0501042_0218757
413 Ga0501070_0013883
414 Ga0501076_0072613
415 Ga0501079_0311480
416 Ga0501081_0252722
417 nmdc:mga05p37_502418_c1
418 nmdc:mga0a205_16247_c1
419 nmdc:mga0a205_4_c1
420 Ga0495601_0043715
421 Ga0495612_0000155
422 Ga0495655_0000005
423 Ga0495655_0001296
424 Ga0495595_0000007
425 Ga0495595_0000378
426 Ga0495619_0000026
427 Ga0495619_0000088
428 Ga0495619_0214793
429 Ga0500566_0001830
430 Ga0500566_0050962
431 Ga0500628_000013
432 Ga0530510_0185234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14378

PAP2_3

PAP2 superfamily

101

289

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7571 101 275
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.6923 101 275
7f18-assembly3.cif.gz_C crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) 0.5556 190 300
7f17-assembly3.cif.gz_C crystal structure of acid phosphatase 0.545 78 300
7f17-assembly3.cif.gz_C crystal structure of acid phosphatase 0.5129 78 300
ID Description Score Start End Superfamily
af_P38954_1_527_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.783 117 233 1.20.144.10
af_P76093_1_298_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7621 119 275 1.20.144.10
af_A0A1D8PEJ5_1_514_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7288 104 291 1.20.144.10
af_Q4D544_53_235_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.664 102 289 1.20.144.10
af_Q4D544_53_235_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6398 102 289 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A838V0M6-F1-model_v4 Phosphatase PAP2 family protein 0.9794 2 302 GO:0016020
AF-A0A838V0M6-F1-model_v4 Phosphatase PAP2 family protein 0.973 2 302 GO:0016020
AF-A0A534GUS6-F1-model_v4 Phosphoesterase 0.9493 128 295 GO:0016020
AF-A0A538KAL5-F1-model_v4 Inositol phosphorylceramide synthase 0.9455 4 302 GO:0006676
GO:0016020
GO:0030148
AF-A0A7W0H327-F1-model_v4 Inositol phosphorylceramide synthase 0.9455 2 296 GO:0016020

Map