F327375

General Info

Members Datasets Scaffolds Average Seq Length
216 146 432 508

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100001112|Ga0070665_1000011128
Length 541
Sequence MGGALATALLSPTGSMGIFELTITLLLVGGVLALWADRLGVPYPALLALAGAALTFIPGTPQVMLDPRLALALFVSPVLLDAAFDASPRDLRRYLRPVSNLAVLAVGFTVIVVAVVARHFVPGMSWAVAIALGAIVAPPDTSXXXXVLRRVRPPHTLVVVLQGESLFNDASALLIYRFAVAAATTGTLAGWSIAPMFLLTCGGGVIAGILLARFYIWATAKIKDIPVSVLLQFIGTFAVWLIADNLGLSAILTVIAYAMTLARRVPGRVDARHRISSYAVWEVAVFVLNVLAFVLIGLQLRGIATRLRDSDWHTYLICAGAVCLTVILSRLVWVAFYTMVARCRMQYFGGKDSVVRMPTYGGTLIVAWCGMRGIVTLAAALALPDGSPETAFPYRDLIILCAFCVVLATLVVQGMTLRPLLTWVGLKDDGTVDREIQLARIETARAALRVLEGHEARPAVSELKRAYEARIRLSEEPQDDKAHDHGDAHLGELQQRAVAAQRAALMDLRERSIIGDDAFHAAEEEIDLLELAGDERIRPDD

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 2643221736 Bosea sp. Root483D1 Isolate Unclassified
144 2818991467 Bosea vestrisii 3192 Isolate Unclassified
145 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
146 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.28
Nodule 0
Rhizoplane 5.56
Rhizosphere 68.06
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100001112 3300005548 Bacteria 33158
2 JGI25151J46595_10000036 3300003187 Bacteria 188770
3 JGI25151J46595_10000209 3300003187 Bacteria 71715
4 JGI25151J46595_10000244 3300003187 Bacteria 63724
5 JGI25406J46586_10000163 3300003203 Bacteria 29456
6 JGI25153J46596_10000017 3300003215 Bacteria 274325
7 rootH1_10227421 3300003323 Bacteria 1892
8 Ga0055526_1000922 3300003771 Bacteria 21824
9 Ga0055526_1000977 3300003771 Bacteria 21071
10 Ga0055526_1002202 3300003771 Bacteria 13348
11 Ga0055537_1002622 3300003773 Bacteria 5881
12 Ga0055524_1000014 3300003775 Bacteria 259417
13 Ga0055531_10006003 3300003794 Bacteria 6972
14 Ga0068869_100022652 3300005334 Bacteria 4332
15 Ga0070666_10093210 3300005335 Bacteria 2071
16 Ga0070680_100055086 3300005336 Bacteria 3249
17 Ga0068868_100000340 3300005338 Bacteria 31566
18 Ga0068868_100064734 3300005338 Bacteria 2903
19 Ga0068868_100172259 3300005338 Bacteria 1792
20 Ga0070668_100185890 3300005347 Bacteria 1699
21 Ga0070671_100000215 3300005355 Bacteria 38650
22 Ga0070671_100185002 3300005355 Unclassified 1765
23 Ga0070667_100002678 3300005367 Bacteria 15410
24 Ga0070694_100042115 3300005444 Bacteria 3049
25 Ga0070708_100025798 3300005445 Bacteria 5026
26 Ga0070681_10001220 3300005458 Bacteria 22384
27 Ga0070681_10020270 3300005458 Bacteria 6665
28 Ga0070706_100000923 3300005467 Bacteria 32144
29 Ga0070679_100031638 3300005530 Bacteria 5229
30 Ga0070679_100096487 3300005530 Bacteria 2944
31 Ga0070686_100085819 3300005544 Bacteria 2095
32 Ga0070696_100025525 3300005546 Bacteria 4018
33 Ga0070665_100006614 3300005548 Bacteria 11779
34 Ga0070665_100008902 3300005548 Bacteria 10165
35 Ga0070665_100038783 3300005548 Bacteria 4789
36 Ga0070665_100081529 3300005548 Bacteria 3241
37 Ga0068855_100000604 3300005563 Bacteria 44010
38 Ga0068855_100017842 3300005563 Bacteria 8530
39 Ga0068856_100096535 3300005614 Bacteria 2944
40 Ga0068852_100000059 3300005616 Bacteria 75116
41 Ga0068859_100014428 3300005617 Bacteria 7928
42 Ga0068859_100126298 3300005617 Bacteria 2627
43 Ga0068863_100003800 3300005841 Bacteria 14927
44 Ga0068863_100007491 3300005841 Bacteria 10676
45 Ga0068863_100021987 3300005841 Bacteria 6088
46 Ga0068858_100000357 3300005842 Bacteria 48180
47 Ga0068858_100002399 3300005842 Bacteria 18946
48 Ga0068860_100004082 3300005843 Bacteria 14984
49 Ga0068860_100018739 3300005843 Bacteria 6726
50 Ga0068862_100012811 3300005844 Bacteria 6938
51 Ga0081539_10000072 3300005985 Bacteria 232726
52 Ga0081539_10000412 3300005985 Bacteria 91177
53 Ga0070717_10000088 3300006028 Bacteria 72135
54 Ga0097621_100018460 3300006237 Bacteria 5329
55 Ga0075431_100134486 3300006847 Bacteria 2549
56 Ga0075429_100013284 3300006880 Bacteria 7142
57 Ga0097620_100014429 3300006931 Bacteria 7928
58 Ga0097620_100126306 3300006931 Bacteria 2627
59 Ga0105240_10001059 3300009093 Bacteria 48690
60 Ga0105240_10007419 3300009093 Bacteria 15931
61 Ga0105240_10020911 3300009093 Bacteria 8714
62 Ga0105240_10027517 3300009093 Bacteria 7442
63 Ga0105240_10061690 3300009093 Bacteria 4671
64 Ga0105245_10124671 3300009098 Bacteria 2410
65 Ga0105247_10001331 3300009101 Bacteria 18029
66 Ga0114129_10106223 3300009147 Bacteria 3879
67 Ga0105248_10036336 3300009177 Bacteria 5508
68 Ga0105248_10077051 3300009177 Bacteria 3748
69 Ga0105237_10005097 3300009545 Bacteria 14914
70 Ga0105237_10080687 3300009545 Bacteria 3243
71 Ga0105238_10047125 3300009551 Bacteria 4347
72 Ga0105238_10136754 3300009551 Bacteria 2428
73 Ga0105249_10010754 3300009553 Bacteria 8040
74 Ga0105249_10049076 3300009553 Bacteria 3849
75 Ga0105249_10179142 3300009553 Unclassified 2061
76 Ga0105239_10004042 3300010375 Bacteria 17740
77 Ga0105239_10242908 3300010375 Bacteria 2021
78 Ga0157369_10015584 3300013105 Bacteria 8565
79 Ga0171462_1016 3300013250 Bacteria 164601
80 Ga0157372_10270474 3300013307 Bacteria 1974
81 Ga0163163_10042644 3300014325 Bacteria 4445
82 Ga0157379_10001280 3300014968 Bacteria 20454
83 Ga0207425_1000022 3300025245 Bacteria 355305
84 Ga0209565_1000100 3300025263 Bacteria 130380
85 Ga0209675_1002452 3300025291 Bacteria 9530
86 Ga0209676_1004869 3300025292 Bacteria 7264
87 Ga0209025_1000017 3300025294 Bacteria 768983
88 Ga0209025_1001912 3300025294 Bacteria 24208
89 Ga0209025_1017681 3300025294 Bacteria 4097
90 Ga0209564_1000023 3300025295 Bacteria 555102
91 Ga0209564_1000082 3300025295 Bacteria 261494
92 Ga0209564_1000793 3300025295 Bacteria 43536
93 Ga0209564_1009392 3300025295 Bacteria 4665
94 Ga0209758_1000004 3300025297 Bacteria 1375322
95 Ga0209758_1000602 3300025297 Bacteria 55848
96 Ga0209758_1019153 3300025297 Bacteria 3316
97 Ga0209050_1000001 3300025298 Bacteria 3563507
98 Ga0209256_1000033 3300025299 Bacteria 393924
99 Ga0209256_1000470 3300025299 Bacteria 60553
100 Ga0209051_1000303 3300025303 Bacteria 77630
101 Ga0209051_1005720 3300025303 Bacteria 7180
102 Ga0209257_1005031 3300025304 Bacteria 9623
103 Ga0207710_10000134 3300025900 Bacteria 87269
104 Ga0207684_10043007 3300025910 Bacteria 3829
105 Ga0207707_10006031 3300025912 Bacteria 10601
106 Ga0207695_10026056 3300025913 Bacteria 6532
107 Ga0207695_10028775 3300025913 Bacteria 6152
108 Ga0207695_10060198 3300025913 Bacteria 3932
109 Ga0207695_10062936 3300025913 Bacteria 3827
110 Ga0207671_10026256 3300025914 Bacteria 4367
111 Ga0207660_10005910 3300025917 Bacteria 7949
112 Ga0207660_10036212 3300025917 Bacteria 3430
113 Ga0207652_10072786 3300025921 Bacteria 2989
114 Ga0207694_10156312 3300025924 Unclassified 1839
115 Ga0207644_10012211 3300025931 Bacteria 5700
116 Ga0207644_10050899 3300025931 Unclassified 2971
117 Ga0207711_10012485 3300025941 Bacteria 7058
118 Ga0207661_10056830 3300025944 Bacteria 3143
119 Ga0207667_10005615 3300025949 Bacteria 15304
120 Ga0207667_10050565 3300025949 Bacteria 4385
121 Ga0207658_10005284 3300025986 Bacteria 8880
122 Ga0207677_10000002 3300026023 Bacteria 478921
123 Ga0207703_10000393 3300026035 Bacteria 46974
124 Ga0207703_10002175 3300026035 Bacteria 17201
125 Ga0207702_10014360 3300026078 Bacteria 6576
126 Ga0207641_10000312 3300026088 Bacteria 60630
127 Ga0207641_10001649 3300026088 Bacteria 21779
128 Ga0207641_10027751 3300026088 Bacteria 4677
129 Ga0207641_10110368 3300026088 Bacteria 2437
130 Ga0207675_100045116 3300026118 Bacteria 4118
131 Ga0207683_10083431 3300026121 Bacteria 2840
132 Ga0207698_10000099 3300026142 Bacteria 55109
133 Ga0268266_10001116 3300028379 Bacteria 33517
134 Ga0268266_10005127 3300028379 Bacteria 12349
135 Ga0268266_10015336 3300028379 Bacteria 6576
136 Ga0268265_10008505 3300028380 Bacteria 6938
137 Ga0268264_10000796 3300028381 Bacteria 34150
138 Ga0268264_10086207 3300028381 Bacteria 2697
139 Ga0307511_10000205 3300030521 Bacteria 59754
140 Ga0265331_10022508 3300031250 Bacteria 3215
141 Ga0307513_10014811 3300031456 Bacteria 9486
142 Ga0307509_10000167 3300031507 Bacteria 103177
143 Ga0307510_10000009 3300033180 Bacteria 409702
144 Ga0307510_10025964 3300033180 Bacteria 6746
145 Ga0307510_10044063 3300033180 Bacteria 4838
146 Ga0307510_10054078 3300033180 Bacteria 4212
147 Ga0373936_0002654 3300035113 Bacteria 6686
148 Ga0373935_0026184 3300035692 Bacteria 3598
149 Ga0373947_0013507 3300035725 Bacteria 4678
150 Ga0436365_1032783 3300039437 Bacteria 14967
151 Ga0466969_0002822 3300044656 Bacteria 9287
152 Ga0466969_0010444 3300044656 Bacteria 4922
153 Ga0466972_0013607 3300044658 Bacteria 4082
154 Ga0466982_0000008 3300044672 Bacteria 240089
155 Ga0466966_0000285 3300044684 Bacteria 33126
156 Ga0466966_0011729 3300044684 Bacteria 5810
157 Ga0466966_0053298 3300044684 Bacteria 2566
158 Ga0466961_0003796 3300044693 Bacteria 9447
159 Ga0466963_0000894 3300044694 Bacteria 15194
160 Ga0466971_0000494 3300044719 Bacteria 15499
161 Ga0466971_0033352 3300044719 Bacteria 2307
162 Ga0466970_0003711 3300044765 Bacteria 7463
163 Ga0466970_0008076 3300044765 Bacteria 5285
164 Ga0466960_0054836 3300044901 Bacteria 1937
165 Ga0466959_0000935 3300045049 Bacteria 17325
166 Ga0466959_0003691 3300045049 Bacteria 10101
167 Ga0466959_0132523 3300045049 Bacteria 1766
168 Ga0451576_0239800 3300045051 Bacteria 1894
169 Ga0466958_0039645 3300045836 Bacteria 2831
170 Ga0466967_0019324 3300045976 Bacteria 5475
171 Ga0495610_0021360 3300046512 Bacteria 3562
172 Ga0495620_0000835 3300046515 Bacteria 19043
173 Ga0495643_0057881 3300046522 Bacteria 2064
174 Ga0495581_0088141 3300047315 Bacteria 1800
175 Ga0495672_0023763 3300047320 Bacteria 3960
176 Ga0495684_0062351 3300047471 Bacteria 2836
177 Ga0496102_0014807 3300048905 Bacteria 6783
178 Ga0496102_0016155 3300048905 Bacteria 6521
179 Ga0496103_0075334 3300048906 Bacteria 2116
180 Ga0496104_0038629 3300048907 Bacteria 4468
181 Ga0496105_0056488 3300048908 Bacteria 3240
182 Ga0496106_0013116 3300048909 Bacteria 6116
183 Ga0496108_0062135 3300048911 Bacteria 3145
184 Ga0496109_0006434 3300048912 Bacteria 9896
185 Ga0496110_0003738 3300048913 Bacteria 11722
186 Ga0496112_0001400 3300048915 Bacteria 18427
187 Ga0496113_0092598 3300048916 Bacteria 2331
188 Ga0496115_0130287 3300048918 Bacteria 2073
189 Ga0496117_0000099 3300048920 Bacteria 194987
190 Ga0496118_0000105 3300048921 Bacteria 156739
191 Ga0496120_0000612 3300048923 Bacteria 54154
192 Ga0496121_0001661 3300048924 Bacteria 36718
193 Ga0496122_0030307 3300048925 Bacteria 4536
194 Ga0496125_0000186 3300048928 Bacteria 135128
195 Ga0496125_0002005 3300048928 Bacteria 27612
196 Ga0496125_0106702 3300048928 Bacteria 2043
197 Ga0496126_0001339 3300048929 Bacteria 39084
198 Ga0496126_0013302 3300048929 Bacteria 8382
199 Ga0496126_0018673 3300048929 Bacteria 6862
200 Ga0501067_0019110 3300049583 Bacteria 3793
201 Ga0501073_0016793 3300049589 Bacteria 5303
202 Ga0501077_0014614 3300049593 Bacteria 4935
203 Ga0501080_0008928 3300049742 Bacteria 9117
204 nmdc:mga09592_3357_c1 3300050508 Bacteria 12940
205 nmdc:mga06r32_123407_c1 3300050510 Bacteria 2556
206 nmdc:mga0n895_7544_c1 3300050512 Bacteria 9347
207 Ga0500556_0000447 3300053104 Bacteria 29406
208 Ga0500616_0000162 3300053153 Bacteria 111421
209 Ga0500637_0026571 3300053178 Bacteria 3189
210 Ga0466962_0001825 3300061719 Bacteria 10017
211 Ga0466962_0006803 3300061719 Bacteria 5486
212 Ga0466962_0020216 3300061719 Bacteria 3201
213 2644747843 2643221736 Bacteria 6608466
214 2819721554 2818991467 Bacteria 5893227
215 2917700876 2917699015 Bacteria 7043791
216 8006993197 8006984368 Bacteria 9651211
217 Ga0070665_100001112
218 JGI25151J46595_10000036
219 JGI25151J46595_10000209
220 JGI25151J46595_10000244
221 JGI25406J46586_10000163
222 JGI25153J46596_10000017
223 rootH1_10227421
224 Ga0055526_1000922
225 Ga0055526_1000977
226 Ga0055526_1002202
227 Ga0055537_1002622
228 Ga0055524_1000014
229 Ga0055531_10006003
230 Ga0068869_100022652
231 Ga0070666_10093210
232 Ga0070680_100055086
233 Ga0068868_100000340
234 Ga0068868_100064734
235 Ga0068868_100172259
236 Ga0070668_100185890
237 Ga0070671_100000215
238 Ga0070671_100185002
239 Ga0070667_100002678
240 Ga0070694_100042115
241 Ga0070708_100025798
242 Ga0070681_10001220
243 Ga0070681_10020270
244 Ga0070706_100000923
245 Ga0070679_100031638
246 Ga0070679_100096487
247 Ga0070686_100085819
248 Ga0070696_100025525
249 Ga0070665_100006614
250 Ga0070665_100008902
251 Ga0070665_100038783
252 Ga0070665_100081529
253 Ga0068855_100000604
254 Ga0068855_100017842
255 Ga0068856_100096535
256 Ga0068852_100000059
257 Ga0068859_100014428
258 Ga0068859_100126298
259 Ga0068863_100003800
260 Ga0068863_100007491
261 Ga0068863_100021987
262 Ga0068858_100000357
263 Ga0068858_100002399
264 Ga0068860_100004082
265 Ga0068860_100018739
266 Ga0068862_100012811
267 Ga0081539_10000072
268 Ga0081539_10000412
269 Ga0070717_10000088
270 Ga0097621_100018460
271 Ga0075431_100134486
272 Ga0075429_100013284
273 Ga0097620_100014429
274 Ga0097620_100126306
275 Ga0105240_10001059
276 Ga0105240_10007419
277 Ga0105240_10020911
278 Ga0105240_10027517
279 Ga0105240_10061690
280 Ga0105245_10124671
281 Ga0105247_10001331
282 Ga0114129_10106223
283 Ga0105248_10036336
284 Ga0105248_10077051
285 Ga0105237_10005097
286 Ga0105237_10080687
287 Ga0105238_10047125
288 Ga0105238_10136754
289 Ga0105249_10010754
290 Ga0105249_10049076
291 Ga0105249_10179142
292 Ga0105239_10004042
293 Ga0105239_10242908
294 Ga0157369_10015584
295 Ga0171462_1016
296 Ga0157372_10270474
297 Ga0163163_10042644
298 Ga0157379_10001280
299 Ga0207425_1000022
300 Ga0209565_1000100
301 Ga0209675_1002452
302 Ga0209676_1004869
303 Ga0209025_1000017
304 Ga0209025_1001912
305 Ga0209025_1017681
306 Ga0209564_1000023
307 Ga0209564_1000082
308 Ga0209564_1000793
309 Ga0209564_1009392
310 Ga0209758_1000004
311 Ga0209758_1000602
312 Ga0209758_1019153
313 Ga0209050_1000001
314 Ga0209256_1000033
315 Ga0209256_1000470
316 Ga0209051_1000303
317 Ga0209051_1005720
318 Ga0209257_1005031
319 Ga0207710_10000134
320 Ga0207684_10043007
321 Ga0207707_10006031
322 Ga0207695_10026056
323 Ga0207695_10028775
324 Ga0207695_10060198
325 Ga0207695_10062936
326 Ga0207671_10026256
327 Ga0207660_10005910
328 Ga0207660_10036212
329 Ga0207652_10072786
330 Ga0207694_10156312
331 Ga0207644_10012211
332 Ga0207644_10050899
333 Ga0207711_10012485
334 Ga0207661_10056830
335 Ga0207667_10005615
336 Ga0207667_10050565
337 Ga0207658_10005284
338 Ga0207677_10000002
339 Ga0207703_10000393
340 Ga0207703_10002175
341 Ga0207702_10014360
342 Ga0207641_10000312
343 Ga0207641_10001649
344 Ga0207641_10027751
345 Ga0207641_10110368
346 Ga0207675_100045116
347 Ga0207683_10083431
348 Ga0207698_10000099
349 Ga0268266_10001116
350 Ga0268266_10005127
351 Ga0268266_10015336
352 Ga0268265_10008505
353 Ga0268264_10000796
354 Ga0268264_10086207
355 Ga0307511_10000205
356 Ga0265331_10022508
357 Ga0307513_10014811
358 Ga0307509_10000167
359 Ga0307510_10000009
360 Ga0307510_10025964
361 Ga0307510_10044063
362 Ga0307510_10054078
363 Ga0373936_0002654
364 Ga0373935_0026184
365 Ga0373947_0013507
366 Ga0436365_1032783
367 Ga0466969_0002822
368 Ga0466969_0010444
369 Ga0466972_0013607
370 Ga0466982_0000008
371 Ga0466966_0000285
372 Ga0466966_0011729
373 Ga0466966_0053298
374 Ga0466961_0003796
375 Ga0466963_0000894
376 Ga0466971_0000494
377 Ga0466971_0033352
378 Ga0466970_0003711
379 Ga0466970_0008076
380 Ga0466960_0054836
381 Ga0466959_0000935
382 Ga0466959_0003691
383 Ga0466959_0132523
384 Ga0451576_0239800
385 Ga0466958_0039645
386 Ga0466967_0019324
387 Ga0495610_0021360
388 Ga0495620_0000835
389 Ga0495643_0057881
390 Ga0495581_0088141
391 Ga0495672_0023763
392 Ga0495684_0062351
393 Ga0496102_0014807
394 Ga0496102_0016155
395 Ga0496103_0075334
396 Ga0496104_0038629
397 Ga0496105_0056488
398 Ga0496106_0013116
399 Ga0496108_0062135
400 Ga0496109_0006434
401 Ga0496110_0003738
402 Ga0496112_0001400
403 Ga0496113_0092598
404 Ga0496115_0130287
405 Ga0496117_0000099
406 Ga0496118_0000105
407 Ga0496120_0000612
408 Ga0496121_0001661
409 Ga0496122_0030307
410 Ga0496125_0000186
411 Ga0496125_0002005
412 Ga0496125_0106702
413 Ga0496126_0001339
414 Ga0496126_0013302
415 Ga0496126_0018673
416 Ga0501067_0019110
417 Ga0501073_0016793
418 Ga0501077_0014614
419 Ga0501080_0008928
420 nmdc:mga09592_3357_c1
421 nmdc:mga06r32_123407_c1
422 nmdc:mga0n895_7544_c1
423 Ga0500556_0000447
424 Ga0500616_0000162
425 Ga0500637_0026571
426 Ga0466962_0001825
427 Ga0466962_0006803
428 Ga0466962_0020216
429 2644747843
430 2819721554
431 2917700876
432 8006993197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

23

423

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jda-assembly1.cif.gz_B cyro-em structure of the na+/h+ antipoter sos1 from arabidopsis thaliana,class2 0.7388 5 378
8j2m-assembly1.cif.gz_B the truncated rice na+/h+ antiporter sos1 (1-976) in a constitutively active state 0.691 5 374
6z3z-assembly1.cif.gz_B cryoem structure of horse sodium/proton exchanger nhe9 without c-terminal regulatory domain in an inward-facing conformation 0.6842 4 377
7dsv-assembly1.cif.gz_B structure of a human nhe1-chp1 complex under ph 6.5 0.6816 1 377
6z3z-assembly1.cif.gz_A cryoem structure of horse sodium/proton exchanger nhe9 without c-terminal regulatory domain in an inward-facing conformation 0.6781 7 377
ID Description Score Start End Superfamily
af_Q0DVI9_1_189_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7634 7 163 1.20.1530.20
af_A0A0G2K3D4_38_443_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7251 1 375 1.20.1530.20
af_Q8S397_18_450_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7208 4 377 1.20.1530.20
af_Q5TAH2_32_425_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.704 7 369 1.20.1530.20
af_P76007_6_393_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6992 1 379 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A4R4FT36-F1-model_v4 deleted 0.9069 4 158
AF-A0A536XLB0-F1-model_v4 Na+/H+ antiporter 0.8909 1 155 GO:0005886
GO:0015385
GO:0015386
GO:0051453
GO:0098719
AF-A0A536XLB0-F1-model_v4 Na+/H+ antiporter 0.8804 1 155 GO:0005886
GO:0015385
GO:0015386
GO:0051453
GO:0098719
AF-A0A844EGK4-F1-model_v4 Sodium:proton antiporter 0.8749 1 155 GO:0005886
GO:0015385
GO:0015386
GO:0051453
GO:0098719
AF-A0A2W6SFP8-F1-model_v4 Na+/H+ antiporter 0.8727 4 162 GO:0005886
GO:0015385
GO:0015386
GO:0051453
GO:0098719

Map