F328039

General Info

Members Datasets Scaffolds Average Seq Length
216 153 216 386

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0128612|Ga0496126_0128612_896_2143
Length 415
Sequence MRPRLVLAVLASILGFALIATACGGGGASGPGANEREAVATLPTGAGGTAPRADDARLALKRVGEFDHPVYLAGAPGYPRLLFVVEQAGRIMVLDHGRSLPRPFLDIRDQVGYDGGERGLLSVAFPPDYAASGRFYVYYVDKVGSIQIDEFRRGSATRADPASRRGVITIPHPVNANHNGGQMQFLGDDLYFGTGDGGAAGDPPDNAQNLDSLLGKLLRIDPRPSGDSPYSVPPTNPFVGALGRDEIYSYGLRNPFRFGFDLVTRPGQPRLAIGDVGQNRFEEIDYTTLAAARGANFGWDAFEGRAPYSDEDSGTPDPGGTTKPILAYPHSRGGSCSVIGGYVVADPTLPSLRGDYIYADYCEGELRTLTPHLHRAGADHKLGIAVPSPTSFGEDTSHHIYVTSQDGPVYRLIEK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 12.96
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001513 3300005329 Bacteria 17964
2 Ga0070683_100016228 3300005329 Bacteria 6562
3 Ga0070677_10000020 3300005333 Bacteria 48941
4 Ga0070680_100106882 3300005336 Bacteria 2327
5 Ga0070682_100000032 3300005337 Bacteria 155141
6 Ga0068868_100000432 3300005338 Bacteria 28134
7 Ga0068868_100001166 3300005338 Bacteria 18003
8 Ga0070661_100000032 3300005344 Bacteria 112964
9 Ga0070675_100000022 3300005354 Bacteria 146580
10 Ga0070674_100000155 3300005356 Bacteria 31736
11 Ga0070688_100000031 3300005365 Bacteria 65288
12 Ga0070714_100213448 3300005435 Bacteria 1770
13 Ga0070663_100003263 3300005455 Bacteria 9342
14 Ga0070681_10304269 3300005458 Bacteria 1504
15 Ga0070681_10407454 3300005458 Bacteria 1271
16 Ga0068867_100019309 3300005459 Bacteria 4858
17 Ga0070685_10000981 3300005466 Bacteria 15342
18 Ga0070679_100000134 3300005530 Bacteria 59591
19 Ga0070679_100001450 3300005530 Bacteria 20983
20 Ga0070684_100101820 3300005535 Bacteria 2567
21 Ga0068853_100008937 3300005539 Bacteria 8066
22 Ga0070665_100000022 3300005548 Bacteria 379286
23 Ga0070665_100001252 3300005548 Bacteria 30657
24 Ga0068855_100097152 3300005563 Unclassified 3393
25 Ga0068854_100000101 3300005578 Bacteria 59973
26 Ga0068856_100033916 3300005614 Bacteria 4999
27 Ga0068852_100038850 3300005616 Bacteria 4004
28 Ga0068866_10000151 3300005718 Bacteria 31736
29 Ga0068861_100040328 3300005719 Bacteria 3491
30 Ga0068851_10002127 3300005834 Bacteria 8700
31 Ga0068858_100000763 3300005842 Bacteria 33724
32 Ga0070715_10000072 3300006163 Bacteria 30717
33 Ga0070712_100001859 3300006175 Bacteria 12859
34 Ga0105245_10000022 3300009098 Bacteria 181225
35 Ga0105245_10036222 3300009098 Bacteria 4382
36 Ga0105247_10000064 3300009101 Bacteria 123994
37 Ga0105243_10004153 3300009148 Bacteria 11496
38 Ga0105241_10021562 3300009174 Bacteria 4764
39 Ga0105242_10002557 3300009176 Bacteria 14258
40 Ga0105238_10000016 3300009551 Bacteria 236218
41 Ga0157374_10016498 3300013296 Bacteria 6494
42 Ga0157378_10046970 3300013297 Bacteria 3839
43 Ga0157372_10000239 3300013307 Bacteria 60707
44 Ga0157375_10091563 3300013308 Bacteria 3103
45 Ga0157380_10000039 3300014326 Bacteria 78322
46 Ga0157379_10059862 3300014968 Bacteria 3406
47 Ga0163161_10000103 3300017792 Bacteria 81496
48 Ga0207656_10001155 3300025321 Bacteria 8682
49 Ga0207682_10000550 3300025893 Bacteria 17257
50 Ga0207642_10000055 3300025899 Bacteria 34017
51 Ga0207685_10000073 3300025905 Bacteria 23848
52 Ga0207707_10320727 3300025912 Bacteria 1338
53 Ga0207693_10014647 3300025915 Bacteria 6300
54 Ga0207652_10001446 3300025921 Bacteria 21030
55 Ga0207652_10001785 3300025921 Bacteria 18715
56 Ga0207694_10000012 3300025924 Bacteria 411218
57 Ga0207659_10000030 3300025926 Bacteria 124433
58 Ga0207687_10000065 3300025927 Bacteria 80752
59 Ga0207687_10006877 3300025927 Bacteria 7493
60 Ga0207686_10001324 3300025934 Bacteria 14137
61 Ga0207709_10006474 3300025935 Bacteria 6574
62 Ga0207669_10000066 3300025937 Bacteria 52707
63 Ga0207661_10001090 3300025944 Bacteria 18024
64 Ga0207661_10009227 3300025944 Bacteria 7069
65 Ga0207661_10011430 3300025944 Bacteria 6433
66 Ga0207661_10100471 3300025944 Bacteria 2428
67 Ga0207640_10000100 3300025981 Bacteria 66511
68 Ga0207640_10010014 3300025981 Bacteria 5324
69 Ga0207677_10000369 3300026023 Bacteria 31296
70 Ga0207677_10007659 3300026023 Bacteria 5994
71 Ga0207703_10000070 3300026035 Bacteria 123480
72 Ga0207639_10004373 3300026041 Bacteria 9532
73 Ga0207678_10000536 3300026067 Bacteria 34629
74 Ga0207702_10011226 3300026078 Bacteria 7469
75 Ga0207648_10005436 3300026089 Bacteria 12837
76 Ga0207675_100081870 3300026118 Bacteria 3027
77 Ga0207698_10019520 3300026142 Bacteria 4643
78 Ga0268266_10000029 3300028379 Bacteria 424015
79 Ga0268266_10000428 3300028379 Bacteria 63292
80 Ga0316576_10005394 3300031727 Bacteria 7806
81 Ga0316574_0027651 3300035398 Bacteria 3417
82 Ga0451807_2023172 3300041486 Bacteria 1819
83 Ga0451849_0195264 3300041505 Bacteria 2493
84 Ga0466963_0000033 3300044694 Bacteria 45230
85 Ga0466967_0000013 3300045976 Bacteria 103249
86 Ga0495603_0000216 3300046455 Bacteria 29800
87 Ga0495603_0001723 3300046455 Bacteria 12887
88 Ga0495641_0000010 3300046461 Bacteria 158798
89 Ga0495641_0063068 3300046461 Bacteria 1671
90 Ga0495651_0049956 3300046462 Bacteria 3228
91 Ga0495653_0026772 3300046463 Bacteria 4620
92 Ga0495582_0000002 3300046473 Bacteria 219909
93 Ga0495662_0000416 3300046476 Bacteria 19129
94 Ga0495662_0007411 3300046476 Bacteria 5422
95 Ga0495606_0000550 3300046507 Bacteria 60050
96 Ga0495608_0004170 3300046511 Bacteria 10366
97 Ga0495608_0037683 3300046511 Bacteria 3251
98 Ga0495618_0000457 3300046514 Bacteria 29297
99 Ga0495620_0001864 3300046515 Bacteria 12408
100 Ga0495628_0006897 3300046516 Bacteria 9871
101 Ga0495628_0023197 3300046516 Bacteria 5095
102 Ga0495652_0061073 3300046529 Bacteria 3183
103 Ga0495587_0007919 3300046536 Bacteria 6863
104 Ga0495621_0002893 3300046539 Bacteria 4677
105 Ga0495634_0000193 3300046642 Bacteria 56072
106 Ga0495635_0000017 3300046663 Bacteria 195506
107 Ga0495657_0014561 3300046675 Bacteria 5771
108 Ga0495658_0000001 3300046683 Bacteria 385362
109 Ga0495624_0007490 3300046690 Bacteria 7658
110 Ga0495649_0002629 3300046694 Bacteria 12527
111 Ga0495600_0004794 3300046809 Bacteria 8117
112 Ga0495676_0000089 3300047321 Bacteria 67896
113 Ga0495676_0123685 3300047321 Bacteria 1878
114 Ga0495680_0002996 3300047322 Bacteria 16850
115 Ga0495602_0091208 3300048088 Bacteria 2528
116 Ga0496100_0000006 3300048903 Bacteria 297429
117 Ga0496101_0000009 3300048904 Bacteria 297429
118 Ga0496104_0000008 3300048907 Bacteria 516976
119 Ga0496104_0000029 3300048907 Bacteria 202968
120 Ga0496104_0000843 3300048907 Bacteria 26467
121 Ga0496104_0003844 3300048907 Bacteria 12995
122 Ga0496105_0000002 3300048908 Bacteria 753215
123 Ga0496105_0000629 3300048908 Bacteria 23633
124 Ga0496105_0013482 3300048908 Bacteria 6490
125 Ga0496106_0000072 3300048909 Bacteria 80978
126 Ga0496106_0000107 3300048909 Bacteria 64689
127 Ga0496107_0000015 3300048910 Bacteria 173644
128 Ga0496107_0227444 3300048910 Bacteria 1388
129 Ga0496108_0000004 3300048911 Bacteria 545055
130 Ga0496108_0032406 3300048911 Bacteria 4341
131 Ga0496109_0000011 3300048912 Bacteria 234908
132 Ga0496109_0000031 3300048912 Bacteria 163998
133 Ga0496109_0166943 3300048912 Bacteria 2064
134 Ga0496110_0000444 3300048913 Bacteria 28125
135 Ga0496111_0000020 3300048914 Bacteria 67992
136 Ga0496111_0026938 3300048914 Bacteria 4062
137 Ga0496112_0000373 3300048915 Bacteria 29297
138 Ga0496113_0000002 3300048916 Bacteria 220193
139 Ga0496113_0064338 3300048916 Bacteria 2773
140 Ga0496114_0142345 3300048917 Bacteria 2077
141 Ga0496114_0208822 3300048917 Bacteria 1712
142 Ga0496115_0009470 3300048918 Bacteria 7235
143 Ga0496116_0000138 3300048919 Bacteria 151606
144 Ga0496117_0002787 3300048920 Bacteria 21348
145 Ga0496118_0011699 3300048921 Bacteria 8530
146 Ga0496119_0002607 3300048922 Bacteria 19564
147 Ga0496119_0008167 3300048922 Bacteria 9265
148 Ga0496119_0027776 3300048922 Bacteria 3878
149 Ga0496120_0033750 3300048923 Bacteria 3072
150 Ga0496121_0016150 3300048924 Bacteria 7734
151 Ga0496121_0037708 3300048924 Bacteria 4289
152 Ga0496121_0055047 3300048924 Bacteria 3318
153 Ga0496125_0007145 3300048928 Bacteria 11919
154 Ga0496125_0027255 3300048928 Bacteria 5184
155 Ga0496125_0038639 3300048928 Bacteria 4127
156 Ga0496126_0081643 3300048929 Bacteria 2857
157 Ga0496126_0128612 3300048929 Bacteria 2190
158 Ga0501031_0002559 3300049568 Bacteria 11590
159 Ga0501032_0007560 3300049569 Bacteria 7935
160 Ga0501033_0001432 3300049570 Bacteria 21166
161 Ga0501034_0006967 3300049571 Bacteria 12074
162 Ga0501034_0073927 3300049571 Bacteria 3417
163 Ga0501034_0257544 3300049571 Bacteria 1688
164 Ga0501036_0009526 3300049572 Bacteria 7989
165 Ga0501037_0003578 3300049573 Bacteria 11273
166 Ga0501038_0001628 3300049574 Bacteria 20897
167 Ga0501038_0118496 3300049574 Bacteria 2186
168 Ga0501039_0008417 3300049575 Bacteria 7861
169 Ga0501039_0026193 3300049575 Bacteria 4482
170 Ga0501040_0017107 3300049576 Bacteria 4811
171 Ga0501040_0039086 3300049576 Bacteria 3227
172 Ga0501040_0070258 3300049576 Bacteria 2416
173 Ga0501043_0001394 3300049579 Bacteria 21125
174 Ga0501046_0001660 3300049580 Bacteria 21275
175 Ga0501047_0001724 3300049581 Bacteria 21244
176 Ga0501047_0037372 3300049581 Bacteria 4695
177 Ga0501047_0084209 3300049581 Unclassified 3056
178 Ga0501047_0085952 3300049581 Bacteria 3022
179 Ga0501047_0319900 3300049581 Bacteria 1391
180 Ga0501048_0008170 3300049582 Bacteria 7915
181 Ga0501048_0012884 3300049582 Bacteria 6211
182 Ga0501068_0039961 3300049584 Bacteria 2815
183 Ga0501068_0055349 3300049584 Bacteria 2403
184 Ga0501068_0057269 3300049584 Bacteria 2363
185 Ga0501069_0035408 3300049585 Bacteria 2750
186 Ga0501070_0003071 3300049586 Bacteria 14540
187 Ga0501070_0010536 3300049586 Bacteria 7815
188 Ga0501071_0064147 3300049587 Bacteria 2665
189 Ga0501072_0048192 3300049588 Bacteria 3355
190 Ga0501072_0049759 3300049588 Bacteria 3299
191 Ga0501072_0186576 3300049588 Bacteria 1654
192 Ga0501073_0008085 3300049589 Bacteria 7802
193 Ga0501074_0003868 3300049590 Bacteria 10664
194 Ga0501074_0079593 3300049590 Bacteria 2351
195 Ga0501075_0052631 3300049591 Bacteria 3061
196 Ga0501076_0106681 3300049592 Bacteria 2261
197 Ga0501077_0066963 3300049593 Bacteria 2278
198 Ga0501079_0027286 3300049741 Bacteria 4377
199 Ga0501080_0049872 3300049742 Bacteria 3896
200 Ga0501083_0007112 3300049744 Bacteria 7949
201 Ga0501035_0011766 3300049822 Bacteria 8102
202 Ga0501044_0002460 3300049823 Bacteria 21123
203 Ga0501044_0272599 3300049823 Unclassified 1627
204 Ga0501045_0026029 3300049824 Bacteria 4206
205 Ga0501045_0044130 3300049824 Bacteria 3247
206 Ga0501045_0062764 3300049824 Bacteria 2726
207 Ga0495601_0000019 3300053077 Bacteria 161673
208 Ga0495601_0000221 3300053077 Bacteria 30508
209 Ga0495612_0000710 3300053078 Bacteria 13507
210 Ga0495612_0003985 3300053078 Bacteria 6125
211 Ga0495595_0001482 3300053084 Bacteria 9160
212 Ga0495619_0000022 3300053085 Bacteria 184144
213 Ga0500595_006309 3300053119 Bacteria 5047
214 Ga0501082_0152684 3300060353 Bacteria 2006
215 Ga0530510_0006062 3300061734 Bacteria 8395
216 Ga0530510_0071202 3300061734 Bacteria 2524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_2023172 Ga0451807_2023172_509_1699 343
2 3300041505 Ga0451849_0195264 Ga0451849_0195264_1228_2418 343
3 3300049571 Ga0501034_0006967 Ga0501034_0006967_4576_5613 343
4 3300049581 Ga0501047_0319900 Ga0501047_0319900_294_1331 343
5 3300049574 Ga0501038_0118496 Ga0501038_0118496_889_2037 344
6 3300005337 Ga0070682_100000032 Ga0070682_10000003252 349
7 3300049576 Ga0501040_0039086 Ga0501040_0039086_1921_3060 351
8 3300049575 Ga0501039_0026193 Ga0501039_0026193_3200_4393 359
9 3300049576 Ga0501040_0017107 Ga0501040_0017107_2845_4038 359
10 3300049588 Ga0501072_0048192 Ga0501072_0048192_898_2091 359
11 3300049590 Ga0501074_0079593 Ga0501074_0079593_261_1454 359
12 3300049591 Ga0501075_0052631 Ga0501075_0052631_1051_2244 359
13 3300049592 Ga0501076_0106681 Ga0501076_0106681_992_2185 359
14 3300049593 Ga0501077_0066963 Ga0501077_0066963_697_1890 359
15 3300049824 Ga0501045_0062764 Ga0501045_0062764_684_1877 359
16 3300061734 Ga0530510_0006062 Ga0530510_0006062_977_2170 359
17 3300005548 Ga0070665_100001252 Ga0070665_10000125230 360
18 3300028379 Ga0268266_10000428 Ga0268266_1000042838 360
19 3300049586 Ga0501070_0003071 Ga0501070_0003071_7541_8761 360
20 3300048922 Ga0496119_0027776 Ga0496119_0027776_1219_2439 363
21 3300053085 Ga0495619_0000022 Ga0495619_0000022_4093_5280 363
22 3300046462 Ga0495651_0049956 Ga0495651_0049956_1567_2772 364
23 3300048924 Ga0496121_0055047 Ga0496121_0055047_1915_3138 367
24 3300049582 Ga0501048_0012884 Ga0501048_0012884_1785_2978 367
25 3300049584 Ga0501068_0057269 Ga0501068_0057269_685_1866 368
26 3300049588 Ga0501072_0186576 Ga0501072_0186576_376_1539 368
27 3300061734 Ga0530510_0071202 Ga0530510_0071202_1076_2239 368
28 3300005578 Ga0068854_100000101 Ga0068854_10000010128 369
29 3300009098 Ga0105245_10036222 Ga0105245_100362224 369
30 3300025927 Ga0207687_10006877 Ga0207687_100068774 369
31 3300025944 Ga0207661_10100471 Ga0207661_101004713 369
32 3300025981 Ga0207640_10000100 Ga0207640_1000010027 369
33 3300046642 Ga0495634_0000193 Ga0495634_0000193_31426_32586 369
34 3300048924 Ga0496121_0037708 Ga0496121_0037708_1171_2391 369
35 3300049581 Ga0501047_0037372 Ga0501047_0037372_371_1609 369
36 3300049824 Ga0501045_0044130 Ga0501045_0044130_134_1327 369
37 3300005329 Ga0070683_100016228 Ga0070683_1000162285 370
38 3300005455 Ga0070663_100003263 Ga0070663_1000032633 370
39 3300005458 Ga0070681_10304269 Ga0070681_103042692 370
40 3300005530 Ga0070679_100001450 Ga0070679_1000014503 370
41 3300025921 Ga0207652_10001446 Ga0207652_1000144618 370
42 3300025944 Ga0207661_10011430 Ga0207661_100114305 370
43 3300026067 Ga0207678_10000536 Ga0207678_100005363 370
44 3300046463 Ga0495653_0026772 Ga0495653_0026772_1026_2159 370
45 3300049571 Ga0501034_0073927 Ga0501034_0073927_14_1180 370
46 3300049571 Ga0501034_0257544 Ga0501034_0257544_209_1432 370
47 3300005435 Ga0070714_100213448 Ga0070714_1002134482 371
48 3300048928 Ga0496125_0027255 Ga0496125_0027255_3935_5167 371
49 3300005535 Ga0070684_100101820 Ga0070684_1001018202 372
50 3300025944 Ga0207661_10009227 Ga0207661_100092277 372
51 3300048907 Ga0496104_0003844 Ga0496104_0003844_1179_2432 373
52 3300048908 Ga0496105_0013482 Ga0496105_0013482_2625_3878 373
53 3300048922 Ga0496119_0002607 Ga0496119_0002607_6126_7379 373
54 3300048924 Ga0496121_0016150 Ga0496121_0016150_4517_5770 373
55 3300049584 Ga0501068_0039961 Ga0501068_0039961_1059_2279 373
56 3300049585 Ga0501069_0035408 Ga0501069_0035408_676_1914 373
57 3300049588 Ga0501072_0049759 Ga0501072_0049759_177_1427 373
58 3300053078 Ga0495612_0003985 Ga0495612_0003985_2743_3948 373
59 3300049568 Ga0501031_0002559 Ga0501031_0002559_6534_7784 374
60 3300049569 Ga0501032_0007560 Ga0501032_0007560_186_1436 374
61 3300049570 Ga0501033_0001432 Ga0501033_0001432_6323_7573 374
62 3300049572 Ga0501036_0009526 Ga0501036_0009526_6308_7558 374
63 3300049573 Ga0501037_0003578 Ga0501037_0003578_3705_4955 374
64 3300049574 Ga0501038_0001628 Ga0501038_0001628_13553_14803 374
65 3300049575 Ga0501039_0008417 Ga0501039_0008417_166_1416 374
66 3300049576 Ga0501040_0070258 Ga0501040_0070258_378_1628 374
67 3300049579 Ga0501043_0001394 Ga0501043_0001394_6301_7551 374
68 3300049580 Ga0501046_0001660 Ga0501046_0001660_6451_7701 374
69 3300049581 Ga0501047_0001724 Ga0501047_0001724_6410_7660 374
70 3300049582 Ga0501048_0008170 Ga0501048_0008170_136_1386 374
71 3300049584 Ga0501068_0055349 Ga0501068_0055349_996_2246 374
72 3300049586 Ga0501070_0010536 Ga0501070_0010536_6315_7565 374
73 3300049587 Ga0501071_0064147 Ga0501071_0064147_1233_2483 374
74 3300049589 Ga0501073_0008085 Ga0501073_0008085_308_1558 374
75 3300049590 Ga0501074_0003868 Ga0501074_0003868_5050_6300 374
76 3300049741 Ga0501079_0027286 Ga0501079_0027286_2880_4130 374
77 3300049742 Ga0501080_0049872 Ga0501080_0049872_2486_3736 374
78 3300049744 Ga0501083_0007112 Ga0501083_0007112_6299_7549 374
79 3300049822 Ga0501035_0011766 Ga0501035_0011766_426_1676 374
80 3300049823 Ga0501044_0002460 Ga0501044_0002460_13572_14822 374
81 3300049824 Ga0501045_0026029 Ga0501045_0026029_153_1403 374
82 3300060353 Ga0501082_0152684 Ga0501082_0152684_363_1613 374
83 3300013307 Ga0157372_10000239 Ga0157372_1000023920 375
84 3300047321 Ga0495676_0123685 Ga0495676_0123685_375_1517 375
85 3300048910 Ga0496107_0227444 Ga0496107_0227444_36_1202 375
86 3300048917 Ga0496114_0142345 Ga0496114_0142345_237_1442 375
87 3300005834 Ga0068851_10002127 Ga0068851_100021275 376
88 3300009148 Ga0105243_10004153 Ga0105243_1000415312 376
89 3300009174 Ga0105241_10021562 Ga0105241_100215624 376
90 3300025321 Ga0207656_10001155 Ga0207656_100011554 376
91 3300025935 Ga0207709_10006474 Ga0207709_100064746 376
92 3300048915 Ga0496112_0000373 Ga0496112_0000373_23523_24674 376
93 3300048916 Ga0496113_0000002 Ga0496113_0000002_148126_149277 376
94 3300049581 Ga0501047_0084209 Ga0501047_0084209_232_1428 376
95 3300049823 Ga0501044_0272599 Ga0501044_0272599_145_1341 376
96 3300005365 Ga0070688_100000031 Ga0070688_10000003113 377
97 3300005466 Ga0070685_10000981 Ga0070685_100009814 377
98 3300014326 Ga0157380_10000039 Ga0157380_1000003937 377
99 3300046507 Ga0495606_0000550 Ga0495606_0000550_25161_26369 377
100 3300046516 Ga0495628_0023197 Ga0495628_0023197_2789_3937 377
101 3300046694 Ga0495649_0002629 Ga0495649_0002629_5135_6313 377
102 3300048920 Ga0496117_0002787 Ga0496117_0002787_8790_10019 377
103 3300048921 Ga0496118_0011699 Ga0496118_0011699_1301_2530 377
104 3300005344 Ga0070661_100000032 Ga0070661_10000003273 378
105 3300005354 Ga0070675_100000022 Ga0070675_10000002285 378
106 3300005616 Ga0068852_100038850 Ga0068852_1000388504 378
107 3300025926 Ga0207659_10000030 Ga0207659_1000003051 378
108 3300026142 Ga0207698_10019520 Ga0207698_100195203 378
109 3300006175 Ga0070712_100001859 Ga0070712_1000018593 379
110 3300025915 Ga0207693_10014647 Ga0207693_100146476 379
111 3300046461 Ga0495641_0063068 Ga0495641_0063068_71_1225 379
112 3300048088 Ga0495602_0091208 Ga0495602_0091208_96_1250 379
113 3300048907 Ga0496104_0000843 Ga0496104_0000843_10296_11489 379
114 3300048908 Ga0496105_0000629 Ga0496105_0000629_15283_16476 379
115 3300048913 Ga0496110_0000444 Ga0496110_0000444_2187_3347 379
116 3300048914 Ga0496111_0000020 Ga0496111_0000020_64766_65926 379
117 3300048914 Ga0496111_0026938 Ga0496111_0026938_1513_2676 379
118 3300048928 Ga0496125_0007145 Ga0496125_0007145_6841_7998 379
119 3300013308 Ga0157375_10091563 Ga0157375_100915633 380
120 3300014968 Ga0157379_10059862 Ga0157379_100598622 380
121 3300046473 Ga0495582_0000002 Ga0495582_0000002_11378_12538 380
122 3300046476 Ga0495662_0007411 Ga0495662_0007411_808_2034 380
123 3300046516 Ga0495628_0006897 Ga0495628_0006897_8086_9243 380
124 3300046663 Ga0495635_0000017 Ga0495635_0000017_9678_10835 380
125 3300046683 Ga0495658_0000001 Ga0495658_0000001_379730_380890 380
126 3300048911 Ga0496108_0032406 Ga0496108_0032406_143_1285 380
127 3300048912 Ga0496109_0000011 Ga0496109_0000011_210528_211670 380
128 3300005338 Ga0068868_100001166 Ga0068868_10000116612 381
129 3300026023 Ga0207677_10007659 Ga0207677_100076593 381
130 3300053077 Ga0495601_0000019 Ga0495601_0000019_89302_90534 381
131 3300006163 Ga0070715_10000072 Ga0070715_100000729 382
132 3300046455 Ga0495603_0000216 Ga0495603_0000216_19985_21190 382
133 3300048907 Ga0496104_0000029 Ga0496104_0000029_102450_103652 382
134 3300048908 Ga0496105_0000002 Ga0496105_0000002_102450_103652 382
135 3300048916 Ga0496113_0064338 Ga0496113_0064338_1495_2643 382
136 3300048923 Ga0496120_0033750 Ga0496120_0033750_819_2021 382
137 3300005356 Ga0070674_100000155 Ga0070674_10000015511 383
138 3300005718 Ga0068866_10000151 Ga0068866_1000015111 383
139 3300025899 Ga0207642_10000055 Ga0207642_1000005521 383
140 3300025905 Ga0207685_10000073 Ga0207685_100000739 383
141 3300025937 Ga0207669_10000066 Ga0207669_1000006611 383
142 3300046476 Ga0495662_0000416 Ga0495662_0000416_13990_15183 383
143 3300005548 Ga0070665_100000022 Ga0070665_100000022275 384
144 3300005842 Ga0068858_100000763 Ga0068858_10000076333 384
145 3300013296 Ga0157374_10016498 Ga0157374_100164983 384
146 3300026035 Ga0207703_10000070 Ga0207703_1000007034 384
147 3300028379 Ga0268266_10000029 Ga0268266_10000029179 384
148 3300048912 Ga0496109_0166943 Ga0496109_0166943_640_1833 384
149 3300049581 Ga0501047_0085952 Ga0501047_0085952_1002_2270 384
150 3300053077 Ga0495601_0000221 Ga0495601_0000221_20604_21758 384
151 3300031727 Ga0316576_10005394 Ga0316576_100053943 385
152 3300035398 Ga0316574_0027651 Ga0316574_0027651_1262_2491 385
153 3300045976 Ga0466967_0000013 Ga0466967_0000013_85545_86741 385
154 3300046539 Ga0495621_0002893 Ga0495621_0002893_132_1310 385
155 3300025893 Ga0207682_10000550 Ga0207682_100005503 386
156 3300005338 Ga0068868_100000432 Ga0068868_10000043225 387
157 3300005459 Ga0068867_100019309 Ga0068867_1000193094 387
158 3300005719 Ga0068861_100040328 Ga0068861_1000403282 387
159 3300013297 Ga0157378_10046970 Ga0157378_100469704 387
160 3300026023 Ga0207677_10000369 Ga0207677_1000036927 387
161 3300026089 Ga0207648_10005436 Ga0207648_100054364 387
162 3300026118 Ga0207675_100081870 Ga0207675_1000818703 387
163 3300048919 Ga0496116_0000138 Ga0496116_0000138_72745_73962 387
164 3300048922 Ga0496119_0008167 Ga0496119_0008167_2818_4035 387
165 3300046515 Ga0495620_0001864 Ga0495620_0001864_7265_8440 389
166 3300053119 Ga0500595_006309 Ga0500595_006309_2541_3755 389
167 3300009101 Ga0105247_10000064 Ga0105247_100000644 390
168 3300046529 Ga0495652_0061073 Ga0495652_0061073_62_1252 390
169 3300048929 Ga0496126_0081643 Ga0496126_0081643_797_2029 390
170 3300009098 Ga0105245_10000022 Ga0105245_1000002269 391
171 3300009176 Ga0105242_10002557 Ga0105242_1000255715 391
172 3300009551 Ga0105238_10000016 Ga0105238_1000001653 391
173 3300025924 Ga0207694_10000012 Ga0207694_10000012368 391
174 3300025927 Ga0207687_10000065 Ga0207687_100000659 391
175 3300025934 Ga0207686_10001324 Ga0207686_100013242 391
176 3300046511 Ga0495608_0004170 Ga0495608_0004170_7549_8739 391
177 3300048903 Ga0496100_0000006 Ga0496100_0000006_198623_199810 391
178 3300048904 Ga0496101_0000009 Ga0496101_0000009_198623_199810 391
179 3300048909 Ga0496106_0000072 Ga0496106_0000072_1720_2907 391
180 3300048910 Ga0496107_0000015 Ga0496107_0000015_94851_96038 391
181 3300053084 Ga0495595_0001482 Ga0495595_0001482_5949_7139 391
182 3300005333 Ga0070677_10000020 Ga0070677_1000002050 392
183 3300005336 Ga0070680_100106882 Ga0070680_1001068822 392
184 3300005458 Ga0070681_10407454 Ga0070681_104074541 392
185 3300005530 Ga0070679_100000134 Ga0070679_1000001343 392
186 3300005563 Ga0068855_100097152 Ga0068855_1000971523 392
187 3300025912 Ga0207707_10320727 Ga0207707_103207271 392
188 3300025921 Ga0207652_10001785 Ga0207652_1000178512 392
189 3300025981 Ga0207640_10010014 Ga0207640_100100143 392
190 3300044694 Ga0466963_0000033 Ga0466963_0000033_24052_25239 392
191 3300046461 Ga0495641_0000010 Ga0495641_0000010_88632_89810 392
192 3300046511 Ga0495608_0037683 Ga0495608_0037683_585_1763 392
193 3300046536 Ga0495587_0007919 Ga0495587_0007919_4295_5494 392
194 3300047321 Ga0495676_0000089 Ga0495676_0000089_30692_31870 392
195 3300047322 Ga0495680_0002996 Ga0495680_0002996_13921_15120 392
196 3300048907 Ga0496104_0000008 Ga0496104_0000008_387604_388815 392
197 3300048911 Ga0496108_0000004 Ga0496108_0000004_183936_185129 392
198 3300048912 Ga0496109_0000031 Ga0496109_0000031_30149_31342 392
199 3300048928 Ga0496125_0038639 Ga0496125_0038639_1247_2440 392
200 3300048929 Ga0496126_0128612 Ga0496126_0128612_896_2143 392
201 3300053078 Ga0495612_0000710 Ga0495612_0000710_7287_8465 392
202 3300005329 Ga0070683_100001513 Ga0070683_10000151314 393
203 3300005539 Ga0068853_100008937 Ga0068853_1000089374 393
204 3300005614 Ga0068856_100033916 Ga0068856_1000339164 393
205 3300017792 Ga0163161_10000103 Ga0163161_1000010381 393
206 3300025944 Ga0207661_10001090 Ga0207661_100010905 393
207 3300026041 Ga0207639_10004373 Ga0207639_100043735 393
208 3300026078 Ga0207702_10011226 Ga0207702_100112265 393
209 3300046455 Ga0495603_0001723 Ga0495603_0001723_9089_10291 393
210 3300046514 Ga0495618_0000457 Ga0495618_0000457_21593_22789 393
211 3300046675 Ga0495657_0014561 Ga0495657_0014561_571_1770 393
212 3300046690 Ga0495624_0007490 Ga0495624_0007490_3537_4733 393
213 3300046809 Ga0495600_0004794 Ga0495600_0004794_1298_2494 393
214 3300048909 Ga0496106_0000107 Ga0496106_0000107_9288_10481 393
215 3300048917 Ga0496114_0208822 Ga0496114_0208822_145_1350 393
216 3300048918 Ga0496115_0009470 Ga0496115_0009470_2037_3236 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

66

382

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.8391 38 393
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.8343 38 393
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.8327 38 393
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.8259 38 393
2ism-assembly1.cif.gz_A crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8 0.8226 37 391
ID Description Score Start End Superfamily
af_Q14DK5_187_578_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8885 36 389 2.120.10.30
af_Q2QLJ8_215_613_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8681 48 365 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8072 37 391 2.120.10.30
af_Q14DK5_187_578_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.804 36 389 2.120.10.30
af_A0A0R0JZF2_3_250_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8029 208 391 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A1Q7GDY2-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.98 60 131
AF-A0A7W0K7M9-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9709 50 142
AF-A0A7V8VKD8-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9534 34 393
AF-A0A7V9KKI7-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9532 48 393
AF-A0A1Q3NDI7-F1-model_v4 deleted 0.9505 28 391

Feature Viewer

pLDDT pTM Quality
86.11 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map