F328101

General Info

Members Datasets Scaffolds Average Seq Length
216 185 190 115

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0548943|Ga0501044_0548943_307_702
Length 131
Sequence MVRVTHVRQNTIYRMQQIIYKIATVSEWQHAAASGQYSGSADDVRDGFIHLSSRFQLPGTLEKHFKGKTDLVLIAFEVDKLGAALKWETSRGGALFPHLYGNLPVSQALWQHPLIVGTDGIPLIDDEWFSC

Samples

Sample ID Description Type Environment
1 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
2 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
3 2818991435 Caulobacter henricii 536 Isolate Unclassified
4 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
5 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
6 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
7 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
8 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
9 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
10 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
11 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
12 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
13 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
14 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
15 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
16 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
17 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
18 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
19 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
20 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
21 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
22 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
23 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
184 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
185 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.96
Metatranscriptomes 0
Isolates 12.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.74
Nodule 6.94
Rhizoplane 8.33
Rhizosphere 61.11
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001286 3300003187 Bacteria 17668
2 JGI25165J46597_1029610 3300003214 Bacteria 706
3 JGI25153J46596_10031374 3300003215 Bacteria 1790
4 rootH2_10137356 3300003320 Bacteria 1501
5 rootL2_10131814 3300003322 Bacteria 1646
6 JGI25160J50197_1001662 3300003354 Bacteria 10861
7 Ga0055536_1004985 3300003781 Bacteria 6599
8 Ga0055536_1004999 3300003781 Bacteria 6587
9 Ga0055530_10004955 3300003791 Bacteria 6587
10 Ga0055531_10000294 3300003794 Bacteria 49839
11 Ga0055531_10006533 3300003794 Bacteria 6605
12 Ga0070689_100396471 3300005340 Bacteria 1166
13 Ga0070692_11003947 3300005345 Unclassified 584
14 Ga0070668_100950873 3300005347 Bacteria 770
15 Ga0070671_100593546 3300005355 Bacteria 957
16 Ga0070674_100240204 3300005356 Bacteria 1418
17 Ga0070688_100059652 3300005365 Bacteria 2407
18 Ga0070711_100307205 3300005439 Bacteria 1263
19 Ga0070663_101168715 3300005455 Bacteria 675
20 Ga0070678_100615474 3300005456 Bacteria 971
21 Ga0068867_100024173 3300005459 Bacteria 4354
22 Ga0070685_10451973 3300005466 Bacteria 900
23 Ga0068853_100132865 3300005539 Bacteria 2229
24 Ga0068853_100501519 3300005539 Bacteria 1146
25 Ga0070672_100110961 3300005543 Bacteria 2235
26 Ga0070693_100514926 3300005547 Bacteria 851
27 Ga0070665_100431361 3300005548 Bacteria 1327
28 Ga0068856_100756026 3300005614 Bacteria 992
29 Ga0070702_100587006 3300005615 Bacteria 833
30 Ga0068859_101528265 3300005617 Bacteria 737
31 Ga0068866_10107203 3300005718 Bacteria 1552
32 Ga0068870_10254997 3300005840 Bacteria 1089
33 Ga0068863_100250545 3300005841 Bacteria 1710
34 Ga0068858_100015030 3300005842 Bacteria 7282
35 Ga0068860_100187112 3300005843 Bacteria 2003
36 Ga0068862_102399793 3300005844 Unclassified 539
37 Ga0081540_1066983 3300005983 Bacteria 1680
38 Ga0081540_1170335 3300005983 Bacteria 830
39 Ga0075369_10003398 3300006186 Bacteria 5790
40 Ga0075369_10405176 3300006186 Bacteria 643
41 Ga0075370_10147113 3300006353 Bacteria 1380
42 Ga0075428_100040893 3300006844 Bacteria 5099
43 Ga0075430_100000278 3300006846 Bacteria 35937
44 Ga0075430_100469284 3300006846 Bacteria 1039
45 Ga0075431_100818670 3300006847 Bacteria 904
46 Ga0068865_100254944 3300006881 Bacteria 1386
47 Ga0097620_101528256 3300006931 Bacteria 737
48 Ga0105247_10016734 3300009101 Bacteria 4397
49 Ga0114129_10117180 3300009147 Bacteria 3670
50 Ga0105239_12165623 3300010375 Bacteria 646
51 Ga0105246_10383934 3300011119 Bacteria 1161
52 Ga0157373_11217966 3300013100 Bacteria 568
53 Ga0157370_10067968 3300013104 Bacteria 3368
54 Ga0157378_10469752 3300013297 Bacteria 1251
55 Ga0163162_11759737 3300013306 Bacteria 708
56 Ga0157375_10015675 3300013308 Bacteria 6789
57 Ga0157380_10219370 3300014326 Bacteria 1700
58 Ga0157380_10754291 3300014326 Bacteria 985
59 Ga0157379_10003446 3300014968 Bacteria 13388
60 Ga0157379_10421271 3300014968 Bacteria 1230
61 Ga0157376_10017242 3300014969 Bacteria 5501
62 Ga0209233_1022897 3300025261 Bacteria 1591
63 Ga0209130_1000675 3300025284 Bacteria 30869
64 Ga0209676_1000392 3300025292 Bacteria 79950
65 Ga0209025_1000408 3300025294 Bacteria 86719
66 Ga0209758_1009360 3300025297 Bacteria 6104
67 Ga0209050_1000411 3300025298 Bacteria 79805
68 Ga0209050_1003869 3300025298 Bacteria 10634
69 Ga0207426_1000066 3300025302 Bacteria 351182
70 Ga0209257_1000513 3300025304 Bacteria 67348
71 Ga0207642_10167192 3300025899 Bacteria 1186
72 Ga0207710_10020041 3300025900 Bacteria 2857
73 Ga0207680_10243048 3300025903 Bacteria 1241
74 Ga0207643_10258665 3300025908 Bacteria 1074
75 Ga0207663_10238822 3300025916 Bacteria 1332
76 Ga0207660_10165291 3300025917 Bacteria 1710
77 Ga0207670_10547193 3300025936 Bacteria 945
78 Ga0207669_10956367 3300025937 Bacteria 718
79 Ga0207704_10277139 3300025938 Bacteria 1273
80 Ga0207691_10173953 3300025940 Bacteria 1884
81 Ga0207711_10029488 3300025941 Bacteria 4629
82 Ga0207703_10422119 3300026035 Bacteria 1241
83 Ga0207639_10080955 3300026041 Bacteria 2571
84 Ga0207678_10837552 3300026067 Bacteria 812
85 Ga0207702_11979153 3300026078 Unclassified 573
86 Ga0207641_10252659 3300026088 Bacteria 1647
87 Ga0207648_10074575 3300026089 Bacteria 2957
88 Ga0207683_10237476 3300026121 Bacteria 1662
89 Ga0268266_10897413 3300028379 Bacteria 857
90 Ga0307515_10107224 3300028794 Bacteria 3305
91 Ga0307515_10426798 3300028794 Bacteria 945
92 Ga0265338_10395494 3300028800 Bacteria 986
93 Ga0265340_10150341 3300031247 Bacteria 1061
94 Ga0265340_10521523 3300031247 Bacteria 523
95 Ga0265327_10000794 3300031251 Bacteria 48452
96 Ga0307412_10658927 3300031911 Bacteria 894
97 Ga0307414_10124366 3300032004 Bacteria 1989
98 Ga0307414_10597788 3300032004 Bacteria 989
99 Ga0307414_11262774 3300032004 Bacteria 685
100 Ga0373941_0194656 3300035115 Bacteria 768
101 Ga0373935_1105208 3300035692 Bacteria 590
102 Ga0316582_1161863 3300036647 Bacteria 526
103 Ga0439465_0042972 3300041413 Bacteria 1466
104 Ga0451847_0020904 3300041503 Unclassified 554
105 Ga0451853_3405935 3300041512 Bacteria 1400
106 Ga0439431_0053108 3300041997 Bacteria 1054
107 Ga0439445_0064269 3300042004 Bacteria 1007
108 Ga0439449_0373994 3300042007 Bacteria 540
109 Ga0450908_065364 3300042184 Bacteria 642
110 Ga0439435_0035342 3300042436 Bacteria 1377
111 Ga0495590_0437352 3300046457 Bacteria 505
112 Ga0495638_0001082 3300046460 Bacteria 26547
113 Ga0495605_0307480 3300046474 Bacteria 670
114 Ga0495585_0416008 3300046492 Bacteria 646
115 Ga0495610_0003404 3300046512 Bacteria 12414
116 Ga0495610_0038723 3300046512 Bacteria 2418
117 Ga0495632_0003085 3300046519 Bacteria 12087
118 Ga0495609_0105237 3300046538 Bacteria 1220
119 Ga0495668_0000034 3300046616 Bacteria 254171
120 Ga0495668_0130549 3300046616 Bacteria 1375
121 Ga0495668_0239723 3300046616 Bacteria 993
122 Ga0495625_0055710 3300046660 Bacteria 2818
123 Ga0495649_0129296 3300046694 Bacteria 1333
124 Ga0495672_0158954 3300047320 Bacteria 1164
125 Ga0495679_002489 3300047446 Bacteria 9346
126 Ga0495673_0241617 3300047469 Bacteria 662
127 Ga0495686_0054536 3300047472 Bacteria 2502
128 Ga0496100_0024572 3300048903 Bacteria 3676
129 Ga0496101_0001118 3300048904 Bacteria 15981
130 Ga0496102_0028434 3300048905 Bacteria 4993
131 Ga0496103_0021607 3300048906 Bacteria 3872
132 Ga0496104_0118406 3300048907 Bacteria 2542
133 Ga0496105_0245609 3300048908 Bacteria 1451
134 Ga0496106_0004936 3300048909 Bacteria 9866
135 Ga0496107_0004616 3300048910 Bacteria 9341
136 Ga0496108_0019530 3300048911 Bacteria 5566
137 Ga0496108_1520636 3300048911 Unclassified 556
138 Ga0496109_0011217 3300048912 Bacteria 7692
139 Ga0496109_0128033 3300048912 Bacteria 2368
140 Ga0496110_0142381 3300048913 Bacteria 2168
141 Ga0496112_0015489 3300048915 Bacteria 7118
142 Ga0496113_0924048 3300048916 Bacteria 689
143 Ga0496114_0012390 3300048917 Bacteria 6825
144 Ga0496115_0003691 3300048918 Bacteria 11021
145 Ga0496115_0478543 3300048918 Bacteria 1003
146 Ga0496121_0680947 3300048924 Bacteria 622
147 Ga0496124_0014384 3300048927 Bacteria 7651
148 Ga0496125_0029877 3300048928 Bacteria 4887
149 Ga0496126_0004925 3300048929 Bacteria 15584
150 Ga0495682_0120823 3300049460 Bacteria 938
151 Ga0501040_0365920 3300049576 Bacteria 1034
152 Ga0501046_0290153 3300049580 Bacteria 1197
153 Ga0501047_0026508 3300049581 Bacteria 5576
154 Ga0501067_0008784 3300049583 Bacteria 5598
155 Ga0501071_0333466 3300049587 Bacteria 1153
156 Ga0501072_0245035 3300049588 Unclassified 1428
157 Ga0501072_0989502 3300049588 Bacteria 656
158 Ga0501073_0122708 3300049589 Bacteria 1801
159 Ga0501073_0387315 3300049589 Bacteria 966
160 Ga0501076_0225136 3300049592 Bacteria 1533
161 Ga0501076_1560889 3300049592 Bacteria 542
162 Ga0501080_1127029 3300049742 Bacteria 676
163 Ga0501081_0753788 3300049743 Bacteria 732
164 Ga0501081_1321607 3300049743 Bacteria 547
165 Ga0501044_0268172 3300049823 Bacteria 1644
166 Ga0501044_0548943 3300049823 Bacteria 1053
167 Ga0501045_0798454 3300049824 Bacteria 695
168 nmdc:mga07m45_29452_c1 3300050496 Bacteria 3036
169 nmdc:mga05p37_75694_c1 3300050507 Bacteria 4143
170 nmdc:mga09592_65672_c1 3300050508 Bacteria 3074
171 nmdc:mga0qj67_152_c1 3300050509 Bacteria 46576
172 nmdc:mga0qj67_785752_c1 3300050509 Bacteria 754
173 nmdc:mga06r32_1509799_c1 3300050510 Bacteria 612
174 nmdc:mga06r32_1599604_c1 3300050510 Bacteria 590
175 nmdc:mga06r32_750139_c1 3300050510 Bacteria 939
176 nmdc:mga0sz30_128730_c1 3300050516 Bacteria 1115
177 nmdc:mga0sz30_363653_c1 3300050516 Bacteria 647
178 Ga0500610_0009493 3300053079 Bacteria 4318
179 Ga0500608_000429 3300053122 Bacteria 15955
180 Ga0500618_000092 3300053125 Bacteria 73216
181 Ga0500559_0000760 3300053136 Bacteria 21156
182 Ga0500568_0023269 3300053139 Bacteria 2637
183 Ga0500573_0023979 3300053140 Bacteria 3506
184 Ga0500573_0451273 3300053140 Bacteria 594
185 Ga0500622_0005190 3300053156 Bacteria 7889
186 Ga0500645_047510 3300053730 Bacteria 1258
187 Ga0500645_122847 3300053730 Bacteria 723
188 Ga0501084_1616757 3300054114 Bacteria 542
189 Ga0501082_0149936 3300060353 Bacteria 2025
190 Ga0501082_0278626 3300060353 Bacteria 1456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10395494 Ga0265338_103954942 98
2 3300031247 Ga0265340_10150341 Ga0265340_101503411 98
3 3300031247 Ga0265340_10521523 Ga0265340_105215231 98
4 3300041503 Ga0451847_0020904 Ga0451847_0020904_83_412 100
5 3300053140 Ga0500573_0023979 Ga0500573_0023979_2303_2647 108
6 iso_pu_bacteria 2643221552 2643783136 109
7 iso_pu_bacteria 2818991435 2819536155 109
8 iso_pu_bacteria 2818991454 2819644548 109
9 iso_pu_bacteria 2821443989 2821449221 109
10 iso_pu_bacteria 2857504554 2857508652 109
11 iso_pu_bacteria 2884960567 2884961449 109
12 3300003322 rootL2_10131814 rootL2_101318142 110
13 3300049589 Ga0501073_0387315 Ga0501073_0387315_588_929 110
14 iso_pu_bacteria 2513237090 2513612414 110
15 iso_pu_bacteria 2847686936 2847689303 110
16 iso_pu_bacteria 2871444079 2871445224 110
17 iso_pu_bacteria 2874102143 2874104196 110
18 iso_pu_bacteria 2904578770 2904579209 110
19 iso_pu_bacteria 2906328253 2906329498 110
20 iso_pu_bacteria 2919119836 2919121965 110
21 iso_pu_bacteria 2922158528 2922161069 110
22 iso_pu_bacteria 2924726620 2924729869 110
23 iso_pu_bacteria 2937891427 2937892301 110
24 iso_pu_bacteria 2958115193 2958119807 110
25 iso_pu_bacteria 2965062239 2965065309 110
26 iso_pu_bacteria 2968097103 2968102699 110
27 iso_pu_bacteria 2968128360 2968131511 110
28 iso_pu_bacteria 2979779861 2979781568 110
29 iso_pu_bacteria 2996341866 2996347018 110
30 3300003320 rootH2_10137356 rootH2_101373562 111
31 3300003781 Ga0055536_1004985 Ga0055536_10049852 111
32 3300003781 Ga0055536_1004999 Ga0055536_10049992 111
33 3300003791 Ga0055530_10004955 Ga0055530_100049552 111
34 3300003794 Ga0055531_10000294 Ga0055531_1000029453 111
35 3300003794 Ga0055531_10006533 Ga0055531_100065332 111
36 3300005539 Ga0068853_100132865 Ga0068853_1001328653 111
37 3300006186 Ga0075369_10003398 Ga0075369_100033986 111
38 3300006353 Ga0075370_10147113 Ga0075370_101471132 111
39 3300006846 Ga0075430_100000278 Ga0075430_10000027818 111
40 3300014968 Ga0157379_10421271 Ga0157379_104212712 111
41 3300025292 Ga0209676_1000392 Ga0209676_100039213 111
42 3300025298 Ga0209050_1000411 Ga0209050_100041153 111
43 3300025298 Ga0209050_1003869 Ga0209050_100386912 111
44 3300025304 Ga0209257_1000513 Ga0209257_100051328 111
45 3300026041 Ga0207639_10080955 Ga0207639_100809552 111
46 3300028794 Ga0307515_10107224 Ga0307515_101072244 111
47 3300028794 Ga0307515_10426798 Ga0307515_104267982 111
48 3300031251 Ga0265327_10000794 Ga0265327_100007944 111
49 3300041413 Ga0439465_0042972 Ga0439465_0042972_772_1116 111
50 3300041512 Ga0451853_3405935 Ga0451853_3405935_106_450 111
51 3300042004 Ga0439445_0064269 Ga0439445_0064269_417_845 111
52 3300042436 Ga0439435_0035342 Ga0439435_0035342_402_746 111
53 3300046460 Ga0495638_0001082 Ga0495638_0001082_24549_24893 111
54 3300046474 Ga0495605_0307480 Ga0495605_0307480_118_462 111
55 3300046492 Ga0495585_0416008 Ga0495585_0416008_117_461 111
56 3300046512 Ga0495610_0003404 Ga0495610_0003404_4774_5118 111
57 3300046519 Ga0495632_0003085 Ga0495632_0003085_2798_3142 111
58 3300046538 Ga0495609_0105237 Ga0495609_0105237_248_592 111
59 3300046616 Ga0495668_0000034 Ga0495668_0000034_59591_59935 111
60 3300046616 Ga0495668_0130549 Ga0495668_0130549_497_841 111
61 3300047446 Ga0495679_002489 Ga0495679_002489_1856_2200 111
62 3300047472 Ga0495686_0054536 Ga0495686_0054536_1104_1448 111
63 3300048916 Ga0496113_0924048 Ga0496113_0924048_254_598 111
64 3300048918 Ga0496115_0478543 Ga0496115_0478543_140_484 111
65 3300048924 Ga0496121_0680947 Ga0496121_0680947_255_596 111
66 3300048927 Ga0496124_0014384 Ga0496124_0014384_1229_1573 111
67 3300048928 Ga0496125_0029877 Ga0496125_0029877_2155_2499 111
68 3300048929 Ga0496126_0004925 Ga0496126_0004925_6598_6942 111
69 3300050496 nmdc:mga07m45_29452_c1 nmdc:mga07m45_29452_c1_2115_2459 111
70 3300050509 nmdc:mga0qj67_152_c1 nmdc:mga0qj67_152_c1_13137_13481 111
71 3300050516 nmdc:mga0sz30_128730_c1 nmdc:mga0sz30_128730_c1_377_721 111
72 3300053122 Ga0500608_000429 Ga0500608_000429_5236_5580 111
73 3300053125 Ga0500618_000092 Ga0500618_000092_65331_65675 111
74 3300053136 Ga0500559_0000760 Ga0500559_0000760_190_534 111
75 3300053140 Ga0500573_0451273 Ga0500573_0451273_187_531 111
76 3300053156 Ga0500622_0005190 Ga0500622_0005190_2040_2384 111
77 3300053730 Ga0500645_122847 Ga0500645_122847_166_507 111
78 3300006844 Ga0075428_100040893 Ga0075428_1000408937 112
79 3300006846 Ga0075430_100469284 Ga0075430_1004692842 112
80 3300006847 Ga0075431_100818670 Ga0075431_1008186702 112
81 3300009147 Ga0114129_10117180 Ga0114129_101171803 112
82 3300014326 Ga0157380_10219370 Ga0157380_102193702 112
83 3300014326 Ga0157380_10754291 Ga0157380_107542912 112
84 3300047320 Ga0495672_0158954 Ga0495672_0158954_610_993 112
85 3300049743 Ga0501081_0753788 Ga0501081_0753788_242_589 112
86 3300050507 nmdc:mga05p37_75694_c1 nmdc:mga05p37_75694_c1_2356_2697 112
87 3300050508 nmdc:mga09592_65672_c1 nmdc:mga09592_65672_c1_2322_2663 112
88 3300050509 nmdc:mga0qj67_785752_c1 nmdc:mga0qj67_785752_c1_34_375 112
89 3300050510 nmdc:mga06r32_1509799_c1 nmdc:mga06r32_1509799_c1_196_543 112
90 3300050510 nmdc:mga06r32_1599604_c1 nmdc:mga06r32_1599604_c1_24_377 112
91 3300050510 nmdc:mga06r32_750139_c1 nmdc:mga06r32_750139_c1_28_399 112
92 3300053730 Ga0500645_047510 Ga0500645_047510_591_938 112
93 iso_pu_bacteria 8003830390 8003831657 112
94 iso_pu_bacteria 8004445564 8004447771 112
95 iso_pu_bacteria 8004703790 8004707391 112
96 3300003214 JGI25165J46597_1029610 JGI25165J46597_10296102 113
97 3300005340 Ga0070689_100396471 Ga0070689_1003964712 113
98 3300005345 Ga0070692_11003947 Ga0070692_110039471 113
99 3300005347 Ga0070668_100950873 Ga0070668_1009508732 113
100 3300005355 Ga0070671_100593546 Ga0070671_1005935462 113
101 3300005356 Ga0070674_100240204 Ga0070674_1002402042 113
102 3300005365 Ga0070688_100059652 Ga0070688_1000596523 113
103 3300005439 Ga0070711_100307205 Ga0070711_1003072051 113
104 3300005456 Ga0070678_100615474 Ga0070678_1006154741 113
105 3300005459 Ga0068867_100024173 Ga0068867_1000241733 113
106 3300005466 Ga0070685_10451973 Ga0070685_104519732 113
107 3300005539 Ga0068853_100501519 Ga0068853_1005015192 113
108 3300005543 Ga0070672_100110961 Ga0070672_1001109613 113
109 3300005547 Ga0070693_100514926 Ga0070693_1005149262 113
110 3300005548 Ga0070665_100431361 Ga0070665_1004313612 113
111 3300005614 Ga0068856_100756026 Ga0068856_1007560262 113
112 3300005615 Ga0070702_100587006 Ga0070702_1005870062 113
113 3300005718 Ga0068866_10107203 Ga0068866_101072033 113
114 3300005840 Ga0068870_10254997 Ga0068870_102549972 113
115 3300005841 Ga0068863_100250545 Ga0068863_1002505453 113
116 3300005842 Ga0068858_100015030 Ga0068858_1000150305 113
117 3300005843 Ga0068860_100187112 Ga0068860_1001871122 113
118 3300005844 Ga0068862_102399793 Ga0068862_1023997931 113
119 3300006881 Ga0068865_100254944 Ga0068865_1002549441 113
120 3300009101 Ga0105247_10016734 Ga0105247_100167345 113
121 3300010375 Ga0105239_12165623 Ga0105239_121656231 113
122 3300011119 Ga0105246_10383934 Ga0105246_103839342 113
123 3300013100 Ga0157373_11217966 Ga0157373_112179661 113
124 3300013297 Ga0157378_10469752 Ga0157378_104697522 113
125 3300013306 Ga0163162_11759737 Ga0163162_117597372 113
126 3300013308 Ga0157375_10015675 Ga0157375_100156755 113
127 3300014968 Ga0157379_10003446 Ga0157379_100034464 113
128 3300014969 Ga0157376_10017242 Ga0157376_100172424 113
129 3300025261 Ga0209233_1022897 Ga0209233_10228971 113
130 3300025899 Ga0207642_10167192 Ga0207642_101671922 113
131 3300025900 Ga0207710_10020041 Ga0207710_100200414 113
132 3300025903 Ga0207680_10243048 Ga0207680_102430482 113
133 3300025908 Ga0207643_10258665 Ga0207643_102586651 113
134 3300025916 Ga0207663_10238822 Ga0207663_102388221 113
135 3300025936 Ga0207670_10547193 Ga0207670_105471932 113
136 3300025937 Ga0207669_10956367 Ga0207669_109563671 113
137 3300025938 Ga0207704_10277139 Ga0207704_102771392 113
138 3300025940 Ga0207691_10173953 Ga0207691_101739533 113
139 3300025941 Ga0207711_10029488 Ga0207711_100294883 113
140 3300026035 Ga0207703_10422119 Ga0207703_104221191 113
141 3300026067 Ga0207678_10837552 Ga0207678_108375522 113
142 3300026078 Ga0207702_11979153 Ga0207702_119791531 113
143 3300026088 Ga0207641_10252659 Ga0207641_102526591 113
144 3300026089 Ga0207648_10074575 Ga0207648_100745754 113
145 3300026121 Ga0207683_10237476 Ga0207683_102374762 113
146 3300028379 Ga0268266_10897413 Ga0268266_108974131 113
147 3300035115 Ga0373941_0194656 Ga0373941_0194656_353_703 113
148 3300035692 Ga0373935_1105208 Ga0373935_1105208_40_390 113
149 3300036647 Ga0316582_1161863 Ga0316582_1161863_124_474 113
150 3300046457 Ga0495590_0437352 Ga0495590_0437352_42_392 113
151 3300046616 Ga0495668_0239723 Ga0495668_0239723_510_860 113
152 3300046660 Ga0495625_0055710 Ga0495625_0055710_2035_2385 113
153 3300048903 Ga0496100_0024572 Ga0496100_0024572_690_1040 113
154 3300048904 Ga0496101_0001118 Ga0496101_0001118_6733_7083 113
155 3300048905 Ga0496102_0028434 Ga0496102_0028434_4363_4713 113
156 3300048906 Ga0496103_0021607 Ga0496103_0021607_102_452 113
157 3300048907 Ga0496104_0118406 Ga0496104_0118406_266_616 113
158 3300048908 Ga0496105_0245609 Ga0496105_0245609_834_1184 113
159 3300048909 Ga0496106_0004936 Ga0496106_0004936_2167_2517 113
160 3300048910 Ga0496107_0004616 Ga0496107_0004616_1162_1512 113
161 3300048911 Ga0496108_0019530 Ga0496108_0019530_5147_5497 113
162 3300048911 Ga0496108_1520636 Ga0496108_1520636_93_443 113
163 3300048912 Ga0496109_0011217 Ga0496109_0011217_626_976 113
164 3300048912 Ga0496109_0128033 Ga0496109_0128033_1640_1990 113
165 3300048913 Ga0496110_0142381 Ga0496110_0142381_106_456 113
166 3300048915 Ga0496112_0015489 Ga0496112_0015489_5115_5465 113
167 3300048917 Ga0496114_0012390 Ga0496114_0012390_2113_2463 113
168 3300048918 Ga0496115_0003691 Ga0496115_0003691_10370_10720 113
169 3300049576 Ga0501040_0365920 Ga0501040_0365920_63_413 113
170 3300049580 Ga0501046_0290153 Ga0501046_0290153_561_911 113
171 3300049587 Ga0501071_0333466 Ga0501071_0333466_452_805 113
172 3300049588 Ga0501072_0245035 Ga0501072_0245035_179_532 113
173 3300049588 Ga0501072_0989502 Ga0501072_0989502_18_368 113
174 3300049592 Ga0501076_0225136 Ga0501076_0225136_336_686 113
175 3300049592 Ga0501076_1560889 Ga0501076_1560889_117_467 113
176 3300049742 Ga0501080_1127029 Ga0501080_1127029_208_558 113
177 3300049743 Ga0501081_1321607 Ga0501081_1321607_131_481 113
178 3300049824 Ga0501045_0798454 Ga0501045_0798454_164_514 113
179 3300053079 Ga0500610_0009493 Ga0500610_0009493_2900_3250 113
180 3300054114 Ga0501084_1616757 Ga0501084_1616757_122_472 113
181 3300060353 Ga0501082_0278626 Ga0501082_0278626_852_1202 113
182 iso_pu_bacteria 2844533157 2844535378 113
183 3300049581 Ga0501047_0026508 Ga0501047_0026508_986_1339 114
184 3300049583 Ga0501067_0008784 Ga0501067_0008784_5072_5425 114
185 3300049589 Ga0501073_0122708 Ga0501073_0122708_223_576 114
186 3300049823 Ga0501044_0268172 Ga0501044_0268172_49_402 114
187 3300049823 Ga0501044_0548943 Ga0501044_0548943_307_702 114
188 3300060353 Ga0501082_0149936 Ga0501082_0149936_916_1269 114
189 3300031911 Ga0307412_10658927 Ga0307412_106589272 115
190 3300032004 Ga0307414_10124366 Ga0307414_101243664 115
191 3300032004 Ga0307414_10597788 Ga0307414_105977882 115
192 3300032004 Ga0307414_11262774 Ga0307414_112627742 115
193 3300003187 JGI25151J46595_10001286 JGI25151J46595_1000128614 117
194 3300003215 JGI25153J46596_10031374 JGI25153J46596_100313742 117
195 3300003354 JGI25160J50197_1001662 JGI25160J50197_10016625 117
196 3300005455 Ga0070663_101168715 Ga0070663_1011687151 117
197 3300005617 Ga0068859_101528265 Ga0068859_1015282652 117
198 3300005983 Ga0081540_1066983 Ga0081540_10669833 117
199 3300005983 Ga0081540_1170335 Ga0081540_11703352 117
200 3300006186 Ga0075369_10405176 Ga0075369_104051761 117
201 3300006931 Ga0097620_101528256 Ga0097620_1015282561 117
202 3300013104 Ga0157370_10067968 Ga0157370_100679681 117
203 3300025284 Ga0209130_1000675 Ga0209130_100067514 117
204 3300025294 Ga0209025_1000408 Ga0209025_100040863 117
205 3300025297 Ga0209758_1009360 Ga0209758_10093604 117
206 3300025302 Ga0207426_1000066 Ga0207426_1000066297 117
207 3300025917 Ga0207660_10165291 Ga0207660_101652912 117
208 3300041997 Ga0439431_0053108 Ga0439431_0053108_310_663 117
209 3300042007 Ga0439449_0373994 Ga0439449_0373994_66_422 117
210 3300042184 Ga0450908_065364 Ga0450908_065364_119_472 117
211 3300046512 Ga0495610_0038723 Ga0495610_0038723_515_871 117
212 3300046694 Ga0495649_0129296 Ga0495649_0129296_96_449 117
213 3300047469 Ga0495673_0241617 Ga0495673_0241617_174_527 117
214 3300049460 Ga0495682_0120823 Ga0495682_0120823_213_566 117
215 3300050516 nmdc:mga0sz30_363653_c1 nmdc:mga0sz30_363653_c1_168_521 117
216 3300053139 Ga0500568_0023269 Ga0500568_0023269_2002_2358 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06108

DUF952

Protein of unknown function (DUF952)

22

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.9683 1 106
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.9649 1 106
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.8941 1 106
2jqn-assembly1.cif.gz_A solution nmr structure of cc0527 from caulobacter crescentus. northeast structural genomics target ccr55 0.8919 2 105
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.8912 1 106
ID Description Score Start End Superfamily
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.9554 1 106 3.20.170.20
af_Q0DQS8_1_107_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.947 8 104 3.20.170.20
2jqnA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8919 2 105 3.20.170.20
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8894 1 106 3.20.170.20
af_Q0DQS8_1_107_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8542 8 104 3.20.170.20
ID Description Score Start End GO Terms
AF-A0A530LLX4-F1-model_v4 DUF952 domain-containing protein 1.005 2 61
AF-A0A529ZHU9-F1-model_v4 DUF952 domain-containing protein 1 2 93
AF-A0A0S3PT68-F1-model_v4 Dihydroorotate dehydrogenase 0.9996 2 98
AF-A0A5C5WEY3-F1-model_v4 DUF952 domain-containing protein 0.9987 2 99
AF-A0A537SCE3-F1-model_v4 DUF952 domain-containing protein 0.9975 2 93

Feature Viewer

pLDDT pTM Quality
95.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map