F328103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 216 | 139 | 216 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_142189_c1|nmdc:mga00v17_142189_c1_63_986 |
| Length | 307 |
| Sequence | MRLDTHRVKFARAIRMSPATHRRAARRSVEAGAWRPPPLSGDTRGLIVDVHLTDFVTIGLLVLLEGLLSADNALVLAVLVLGLPRAEQKKALRYGIVGAFAFRALATALAAYLIDVAWVKLVGAAYLLYLPYAHFTEKPEEGQKRTFKPARPWLGLSAFWATVVKVEFTDIVFAIDSILVAVAMSNKLWVIITGGILGIIAMRMLIGQLLTFVQRYPPLVDGAFIIIAWVGIKLLIEYLHQLHFIGFEVPRWLSLGLIVLIFTGAYAYARRVGAVEVADDGPPDAAEALFTEPDPEPDVTPASGDGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 95 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 100 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 101 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 103 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 104 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 105 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 110 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 111 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 121 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 126 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 127 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 138 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 139 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.48 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 93.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10207706 | 3300005290 | Unclassified | 1084 |
| 2 | Ga0065715_10189471 | 3300005293 | Bacteria | 1424 |
| 3 | Ga0070670_100013697 | 3300005331 | Bacteria | 6950 |
| 4 | Ga0070670_100033357 | 3300005331 | Bacteria | 4433 |
| 5 | Ga0070689_100074243 | 3300005340 | Bacteria | 2661 |
| 6 | Ga0070668_100072443 | 3300005347 | Bacteria | 2684 |
| 7 | Ga0070675_100042755 | 3300005354 | Bacteria | 3703 |
| 8 | Ga0070671_100018312 | 3300005355 | Bacteria | 5688 |
| 9 | Ga0070674_100010675 | 3300005356 | Bacteria | 5565 |
| 10 | Ga0070674_100464316 | 3300005356 | Bacteria | 1047 |
| 11 | Ga0070673_100222227 | 3300005364 | Bacteria | 1635 |
| 12 | Ga0070688_100173348 | 3300005365 | Bacteria | 1491 |
| 13 | Ga0070688_100220972 | 3300005365 | Bacteria | 1335 |
| 14 | Ga0070714_100010789 | 3300005435 | Bacteria | 7232 |
| 15 | Ga0070713_100471081 | 3300005436 | Bacteria | 1182 |
| 16 | Ga0070681_10025701 | 3300005458 | Bacteria | 5921 |
| 17 | Ga0068867_100035704 | 3300005459 | Bacteria | 3606 |
| 18 | Ga0070706_100372380 | 3300005467 | Bacteria | 1331 |
| 19 | Ga0070698_100005765 | 3300005471 | Bacteria | 13542 |
| 20 | Ga0070699_100012499 | 3300005518 | Bacteria | 7326 |
| 21 | Ga0070699_100441552 | 3300005518 | Unclassified | 1179 |
| 22 | Ga0070679_100035194 | 3300005530 | Bacteria | 4968 |
| 23 | Ga0070679_100075349 | 3300005530 | Bacteria | 3364 |
| 24 | Ga0070684_100424736 | 3300005535 | Unclassified | 1227 |
| 25 | Ga0070684_100645951 | 3300005535 | Bacteria | 985 |
| 26 | Ga0070697_100374180 | 3300005536 | Bacteria | 1233 |
| 27 | Ga0070697_100593834 | 3300005536 | Unclassified | 973 |
| 28 | Ga0070672_100093527 | 3300005543 | Bacteria | 2429 |
| 29 | Ga0070695_100080010 | 3300005545 | Bacteria | 2158 |
| 30 | Ga0070696_100614774 | 3300005546 | Unclassified | 877 |
| 31 | Ga0070704_100004800 | 3300005549 | Bacteria | 7829 |
| 32 | Ga0070664_100109373 | 3300005564 | Bacteria | 2411 |
| 33 | Ga0068854_100180275 | 3300005578 | Bacteria | 1650 |
| 34 | Ga0068864_100555705 | 3300005618 | Bacteria | 1110 |
| 35 | Ga0068866_10160023 | 3300005718 | Unclassified | 1312 |
| 36 | Ga0068861_100375484 | 3300005719 | Bacteria | 1254 |
| 37 | Ga0068863_100050015 | 3300005841 | Bacteria | 3964 |
| 38 | Ga0068858_100017019 | 3300005842 | Bacteria | 6826 |
| 39 | Ga0081538_10080852 | 3300005981 | Bacteria | 1731 |
| 40 | Ga0075368_10120649 | 3300006042 | Bacteria | 1085 |
| 41 | Ga0075363_100015403 | 3300006048 | Bacteria | 3758 |
| 42 | Ga0075364_10100210 | 3300006051 | Bacteria | 1928 |
| 43 | Ga0075432_10062909 | 3300006058 | Bacteria | 1324 |
| 44 | Ga0075367_10047925 | 3300006178 | Bacteria | 2515 |
| 45 | Ga0075366_10077310 | 3300006195 | Bacteria | 1986 |
| 46 | Ga0075370_10026909 | 3300006353 | Bacteria | 3188 |
| 47 | Ga0075370_10038654 | 3300006353 | Bacteria | 2686 |
| 48 | Ga0068871_100454886 | 3300006358 | Bacteria | 1148 |
| 49 | Ga0075428_100000010 | 3300006844 | Bacteria | 213631 |
| 50 | Ga0075430_100002851 | 3300006846 | Bacteria | 14473 |
| 51 | Ga0075430_100209807 | 3300006846 | Bacteria | 1616 |
| 52 | Ga0075430_100284501 | 3300006846 | Bacteria | 1368 |
| 53 | Ga0075430_100363579 | 3300006846 | Unclassified | 1195 |
| 54 | Ga0075431_100076716 | 3300006847 | Bacteria | 3449 |
| 55 | Ga0075433_10095091 | 3300006852 | Bacteria | 2637 |
| 56 | Ga0075434_100002119 | 3300006871 | Bacteria | 17262 |
| 57 | Ga0075434_100073591 | 3300006871 | Bacteria | 3409 |
| 58 | Ga0075434_100078662 | 3300006871 | Bacteria | 3293 |
| 59 | Ga0075429_100019593 | 3300006880 | Bacteria | 5865 |
| 60 | Ga0075436_100011621 | 3300006914 | Bacteria | 6042 |
| 61 | Ga0075436_100048566 | 3300006914 | Bacteria | 2928 |
| 62 | Ga0075436_100094482 | 3300006914 | Bacteria | 2079 |
| 63 | Ga0097620_100057689 | 3300006931 | Bacteria | 3911 |
| 64 | Ga0097620_100292221 | 3300006931 | Bacteria | 1723 |
| 65 | Ga0075435_100003596 | 3300007076 | Bacteria | 10542 |
| 66 | Ga0075435_100038179 | 3300007076 | Bacteria | 3829 |
| 67 | Ga0075435_100066230 | 3300007076 | Bacteria | 2938 |
| 68 | Ga0075435_100168556 | 3300007076 | Bacteria | 1847 |
| 69 | Ga0075435_100197765 | 3300007076 | Bacteria | 1703 |
| 70 | Ga0105240_10154385 | 3300009093 | Bacteria | 2732 |
| 71 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 72 | Ga0111539_10102800 | 3300009094 | Bacteria | 3353 |
| 73 | Ga0105247_10377853 | 3300009101 | Bacteria | 1004 |
| 74 | Ga0114129_10005462 | 3300009147 | Bacteria | 17965 |
| 75 | Ga0114129_10028693 | 3300009147 | Bacteria | 7884 |
| 76 | Ga0114129_10319849 | 3300009147 | Bacteria | 2063 |
| 77 | Ga0114129_10364341 | 3300009147 | Bacteria | 1912 |
| 78 | Ga0114129_10378520 | 3300009147 | Bacteria | 1870 |
| 79 | Ga0114129_10821095 | 3300009147 | Bacteria | 1184 |
| 80 | Ga0105243_10008910 | 3300009148 | Bacteria | 7673 |
| 81 | Ga0105248_10035461 | 3300009177 | Bacteria | 5580 |
| 82 | Ga0105238_10274943 | 3300009551 | Bacteria | 1665 |
| 83 | Ga0105249_10070700 | 3300009553 | Bacteria | 3222 |
| 84 | Ga0105249_10291126 | 3300009553 | Bacteria | 1634 |
| 85 | Ga0157369_10083341 | 3300013105 | Bacteria | 3420 |
| 86 | Ga0157374_10067763 | 3300013296 | Bacteria | 3356 |
| 87 | Ga0163163_10090945 | 3300014325 | Bacteria | 3065 |
| 88 | Ga0163163_10681596 | 3300014325 | Bacteria | 1091 |
| 89 | Ga0157380_10263213 | 3300014326 | Bacteria | 1568 |
| 90 | Ga0157380_10445356 | 3300014326 | Bacteria | 1242 |
| 91 | Ga0157379_10007994 | 3300014968 | Bacteria | 9172 |
| 92 | Ga0207682_10031096 | 3300025893 | Bacteria | 2141 |
| 93 | Ga0207682_10138452 | 3300025893 | Bacteria | 1091 |
| 94 | Ga0207699_10364599 | 3300025906 | Bacteria | 1022 |
| 95 | Ga0207707_10064532 | 3300025912 | Bacteria | 3188 |
| 96 | Ga0207695_10109509 | 3300025913 | Bacteria | 2744 |
| 97 | Ga0207695_10785757 | 3300025913 | Bacteria | 832 |
| 98 | Ga0207662_10155925 | 3300025918 | Bacteria | 1456 |
| 99 | Ga0207657_10206122 | 3300025919 | Unclassified | 1580 |
| 100 | Ga0207646_10334504 | 3300025922 | Bacteria | 1368 |
| 101 | Ga0207646_10394368 | 3300025922 | Bacteria | 1250 |
| 102 | Ga0207681_10278196 | 3300025923 | Bacteria | 1317 |
| 103 | Ga0207650_10009681 | 3300025925 | Bacteria | 6587 |
| 104 | Ga0207650_10080345 | 3300025925 | Bacteria | 2472 |
| 105 | Ga0207659_10149138 | 3300025926 | Bacteria | 1824 |
| 106 | Ga0207664_10242189 | 3300025929 | Bacteria | 1571 |
| 107 | Ga0207644_10093987 | 3300025931 | Bacteria | 2239 |
| 108 | Ga0207690_10177887 | 3300025932 | Unclassified | 1599 |
| 109 | Ga0207706_10478530 | 3300025933 | Bacteria | 1076 |
| 110 | Ga0207669_10006952 | 3300025937 | Bacteria | 5206 |
| 111 | Ga0207691_10048263 | 3300025940 | Bacteria | 3904 |
| 112 | Ga0207691_10182213 | 3300025940 | Unclassified | 1835 |
| 113 | Ga0207711_10116074 | 3300025941 | Bacteria | 2386 |
| 114 | Ga0207661_10061608 | 3300025944 | Bacteria | 3032 |
| 115 | Ga0207661_10362377 | 3300025944 | Bacteria | 1310 |
| 116 | Ga0207661_10470959 | 3300025944 | Bacteria | 1146 |
| 117 | Ga0207679_10119963 | 3300025945 | Bacteria | 2092 |
| 118 | Ga0207679_10177529 | 3300025945 | Bacteria | 1759 |
| 119 | Ga0207651_10127790 | 3300025960 | Unclassified | 1940 |
| 120 | Ga0207651_10182202 | 3300025960 | Bacteria | 1667 |
| 121 | Ga0207668_10050074 | 3300025972 | Bacteria | 2876 |
| 122 | Ga0207640_10137037 | 3300025981 | Bacteria | 1778 |
| 123 | Ga0207677_10198447 | 3300026023 | Bacteria | 1593 |
| 124 | Ga0207703_10337285 | 3300026035 | Bacteria | 1384 |
| 125 | Ga0207641_10170163 | 3300026088 | Bacteria | 1988 |
| 126 | Ga0207641_10588930 | 3300026088 | Bacteria | 1088 |
| 127 | Ga0207648_10104057 | 3300026089 | Bacteria | 2489 |
| 128 | Ga0207676_10568370 | 3300026095 | Bacteria | 1085 |
| 129 | Ga0207675_100122272 | 3300026118 | Bacteria | 2464 |
| 130 | Ga0207683_10044583 | 3300026121 | Bacteria | 3877 |
| 131 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 132 | Ga0207428_10003324 | 3300027907 | Bacteria | 15634 |
| 133 | Ga0268266_10176887 | 3300028379 | Bacteria | 1940 |
| 134 | Ga0307410_10204439 | 3300031852 | Unclassified | 1510 |
| 135 | Ga0307410_10262297 | 3300031852 | Bacteria | 1348 |
| 136 | Ga0307406_10055745 | 3300031901 | Bacteria | 2528 |
| 137 | Ga0307412_10207355 | 3300031911 | Bacteria | 1493 |
| 138 | Ga0307409_100152425 | 3300031995 | Bacteria | 2009 |
| 139 | Ga0307409_100253992 | 3300031995 | Bacteria | 1609 |
| 140 | Ga0307416_100187212 | 3300032002 | Bacteria | 1947 |
| 141 | Ga0307416_100493056 | 3300032002 | Unclassified | 1288 |
| 142 | Ga0307416_100645519 | 3300032002 | Bacteria | 1143 |
| 143 | Ga0307411_10007614 | 3300032005 | Bacteria | 5539 |
| 144 | Ga0307411_10359436 | 3300032005 | Bacteria | 1190 |
| 145 | Ga0373954_0069612 | 3300035118 | Bacteria | 1671 |
| 146 | Ga0373931_0078701 | 3300035691 | Bacteria | 1814 |
| 147 | Ga0450920_002533 | 3300042122 | Bacteria | 3117 |
| 148 | Ga0439464_0002978 | 3300042439 | Bacteria | 4230 |
| 149 | Ga0466967_0073827 | 3300045976 | Bacteria | 3061 |
| 150 | Ga0495638_0005681 | 3300046460 | Bacteria | 9192 |
| 151 | Ga0495584_0121999 | 3300046491 | Bacteria | 1320 |
| 152 | Ga0495659_0021302 | 3300046664 | Bacteria | 2183 |
| 153 | Ga0495669_0103983 | 3300046684 | Unclassified | 1321 |
| 154 | Ga0496104_0375746 | 3300048907 | Unclassified | 1334 |
| 155 | Ga0501290_008245 | 3300049513 | Unclassified | 1314 |
| 156 | Ga0501031_0064600 | 3300049568 | Bacteria | 2384 |
| 157 | Ga0501031_0116234 | 3300049568 | Bacteria | 1748 |
| 158 | Ga0501034_0262369 | 3300049571 | Unclassified | 1670 |
| 159 | Ga0501042_0007559 | 3300049578 | Bacteria | 7131 |
| 160 | Ga0501042_0113840 | 3300049578 | Bacteria | 1948 |
| 161 | Ga0501048_0141189 | 3300049582 | Bacteria | 1703 |
| 162 | Ga0501071_0013068 | 3300049587 | Bacteria | 5651 |
| 163 | Ga0501071_0419278 | 3300049587 | Bacteria | 1023 |
| 164 | Ga0501072_0061811 | 3300049588 | Bacteria | 2954 |
| 165 | Ga0501072_0420084 | 3300049588 | Bacteria | 1060 |
| 166 | Ga0501073_0376517 | 3300049589 | Bacteria | 981 |
| 167 | Ga0501075_0366308 | 3300049591 | Bacteria | 1098 |
| 168 | Ga0501077_0129973 | 3300049593 | Bacteria | 1597 |
| 169 | Ga0501233_020529 | 3300049668 | Bacteria | 1411 |
| 170 | Ga0501079_0111671 | 3300049741 | Unclassified | 2124 |
| 171 | Ga0501079_0453515 | 3300049741 | Bacteria | 1007 |
| 172 | Ga0501080_0224100 | 3300049742 | Unclassified | 1720 |
| 173 | Ga0501045_0369671 | 3300049824 | Bacteria | 1067 |
| 174 | nmdc:mga00v17_142189_c1 | 3300050491 | Bacteria | 1539 |
| 175 | nmdc:mga06z11_112925_c1 | 3300050494 | Bacteria | 1507 |
| 176 | nmdc:mga06z11_29219_c1 | 3300050494 | Bacteria | 2653 |
| 177 | nmdc:mga06z11_30792_c1 | 3300050494 | Bacteria | 2600 |
| 178 | nmdc:mga06z11_82901_c1 | 3300050494 | Bacteria | 1725 |
| 179 | nmdc:mga07m45_169913_c1 | 3300050496 | Bacteria | 1267 |
| 180 | nmdc:mga07m45_25497_c1 | 3300050496 | Bacteria | 3243 |
| 181 | nmdc:mga05p37_1148_c1 | 3300050507 | Bacteria | 30482 |
| 182 | nmdc:mga05p37_19472_c1 | 3300050507 | Bacteria | 8210 |
| 183 | nmdc:mga05p37_241716_c1 | 3300050507 | Bacteria | 2170 |
| 184 | nmdc:mga05p37_272330_c1 | 3300050507 | Bacteria | 2022 |
| 185 | nmdc:mga05p37_378545_c1 | 3300050507 | Unclassified | 1659 |
| 186 | nmdc:mga05p37_55930_c1 | 3300050507 | Bacteria | 4857 |
| 187 | nmdc:mga09592_41622_c1 | 3300050508 | Bacteria | 3863 |
| 188 | nmdc:mga09592_80760_c1 | 3300050508 | Unclassified | 2769 |
| 189 | nmdc:mga0qj67_8503_c1 | 3300050509 | Bacteria | 7616 |
| 190 | nmdc:mga06r32_29050_c1 | 3300050510 | Bacteria | 5178 |
| 191 | nmdc:mga08y16_156_c1 | 3300050511 | Bacteria | 59323 |
| 192 | nmdc:mga08y16_30610_c1 | 3300050511 | Bacteria | 5663 |
| 193 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 194 | nmdc:mga0n895_102685_c1 | 3300050512 | Bacteria | 2870 |
| 195 | nmdc:mga0n895_255376_c1 | 3300050512 | Bacteria | 1779 |
| 196 | nmdc:mga0n895_257602_c1 | 3300050512 | Bacteria | 1771 |
| 197 | nmdc:mga0n895_257870_c1 | 3300050512 | Bacteria | 1770 |
| 198 | nmdc:mga0n895_618169_c1 | 3300050512 | Bacteria | 1085 |
| 199 | nmdc:mga0n895_96553_c1 | 3300050512 | Bacteria | 2961 |
| 200 | nmdc:mga0rr50_1072_c1 | 3300050513 | Bacteria | 14885 |
| 201 | nmdc:mga0rr50_15930_c1 | 3300050513 | Bacteria | 4976 |
| 202 | nmdc:mga0rr50_22552_c1 | 3300050513 | Bacteria | 4324 |
| 203 | nmdc:mga0rr50_43063_c1 | 3300050513 | Bacteria | 3301 |
| 204 | nmdc:mga08x19_2366_c1 | 3300050514 | Bacteria | 11427 |
| 205 | nmdc:mga08x19_37774_c1 | 3300050514 | Bacteria | 3066 |
| 206 | nmdc:mga0a205_220597_c1 | 3300050515 | Bacteria | 1782 |
| 207 | nmdc:mga0a205_306480_c1 | 3300050515 | Bacteria | 1460 |
| 208 | nmdc:mga0a205_331933_c1 | 3300050515 | Bacteria | 1390 |
| 209 | nmdc:mga0a205_6930_c1 | 3300050515 | Bacteria | 9856 |
| 210 | Ga0501084_0251824 | 3300054114 | Bacteria | 1491 |
| 211 | Ga0501084_0327459 | 3300054114 | Bacteria | 1294 |
| 212 | Ga0590071_000003 | 3300059421 | Bacteria | 75639 |
| 213 | Ga0590071_000209 | 3300059421 | Bacteria | 17299 |
| 214 | Ga0590075_000088 | 3300059424 | Bacteria | 23833 |
| 215 | Ga0590075_000678 | 3300059424 | Bacteria | 9063 |
| 216 | Ga0590077_000016 | 3300059426 | Bacteria | 38540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025944 | Ga0207661_10061608 | Ga0207661_100616084 | 230 |
| 2 | 3300009093 | Ga0105240_10154385 | Ga0105240_101543852 | 236 |
| 3 | 3300013105 | Ga0157369_10083341 | Ga0157369_100833413 | 236 |
| 4 | 3300006846 | Ga0075430_100284501 | Ga0075430_1002845012 | 239 |
| 5 | 3300005354 | Ga0070675_100042755 | Ga0070675_1000427553 | 240 |
| 6 | 3300009553 | Ga0105249_10291126 | Ga0105249_102911262 | 240 |
| 7 | 3300025926 | Ga0207659_10149138 | Ga0207659_101491383 | 240 |
| 8 | 3300045976 | Ga0466967_0073827 | Ga0466967_0073827_1955_2698 | 240 |
| 9 | 3300006846 | Ga0075430_100002851 | Ga0075430_1000028517 | 241 |
| 10 | 3300006847 | Ga0075431_100076716 | Ga0075431_1000767162 | 241 |
| 11 | 3300006880 | Ga0075429_100019593 | Ga0075429_1000195934 | 241 |
| 12 | 3300009147 | Ga0114129_10005462 | Ga0114129_100054627 | 241 |
| 13 | 3300027907 | Ga0207428_10003324 | Ga0207428_1000332412 | 241 |
| 14 | 3300031901 | Ga0307406_10055745 | Ga0307406_100557454 | 241 |
| 15 | 3300031995 | Ga0307409_100253992 | Ga0307409_1002539922 | 241 |
| 16 | 3300032002 | Ga0307416_100187212 | Ga0307416_1001872122 | 241 |
| 17 | 3300042439 | Ga0439464_0002978 | Ga0439464_0002978_2521_3261 | 241 |
| 18 | 3300049513 | Ga0501290_008245 | Ga0501290_008245_234_974 | 241 |
| 19 | 3300049668 | Ga0501233_020529 | Ga0501233_020529_316_1056 | 241 |
| 20 | 3300050507 | nmdc:mga05p37_1148_c1 | nmdc:mga05p37_1148_c1_22626_23366 | 241 |
| 21 | 3300050508 | nmdc:mga09592_41622_c1 | nmdc:mga09592_41622_c1_750_1490 | 241 |
| 22 | 3300050509 | nmdc:mga0qj67_8503_c1 | nmdc:mga0qj67_8503_c1_5081_5821 | 241 |
| 23 | 3300050510 | nmdc:mga06r32_29050_c1 | nmdc:mga06r32_29050_c1_1688_2428 | 241 |
| 24 | 3300050511 | nmdc:mga08y16_156_c1 | nmdc:mga08y16_156_c1_42525_43265 | 241 |
| 25 | 3300005356 | Ga0070674_100464316 | Ga0070674_1004643161 | 242 |
| 26 | 3300005981 | Ga0081538_10080852 | Ga0081538_100808522 | 242 |
| 27 | 3300006358 | Ga0068871_100454886 | Ga0068871_1004548862 | 242 |
| 28 | 3300006914 | Ga0075436_100094482 | Ga0075436_1000944822 | 242 |
| 29 | 3300006931 | Ga0097620_100057689 | Ga0097620_1000576892 | 242 |
| 30 | 3300026023 | Ga0207677_10198447 | Ga0207677_101984471 | 242 |
| 31 | 3300031852 | Ga0307410_10262297 | Ga0307410_102622972 | 242 |
| 32 | 3300031911 | Ga0307412_10207355 | Ga0307412_102073552 | 242 |
| 33 | 3300031995 | Ga0307409_100152425 | Ga0307409_1001524251 | 242 |
| 34 | 3300032002 | Ga0307416_100645519 | Ga0307416_1006455191 | 242 |
| 35 | 3300032005 | Ga0307411_10007614 | Ga0307411_100076142 | 242 |
| 36 | 3300032005 | Ga0307411_10359436 | Ga0307411_103594362 | 242 |
| 37 | 3300049568 | Ga0501031_0064600 | Ga0501031_0064600_1367_2116 | 242 |
| 38 | 3300049578 | Ga0501042_0007559 | Ga0501042_0007559_4382_5131 | 242 |
| 39 | 3300049582 | Ga0501048_0141189 | Ga0501048_0141189_720_1469 | 242 |
| 40 | 3300049587 | Ga0501071_0013068 | Ga0501071_0013068_3177_3926 | 242 |
| 41 | 3300049588 | Ga0501072_0061811 | Ga0501072_0061811_588_1337 | 242 |
| 42 | 3300049589 | Ga0501073_0376517 | Ga0501073_0376517_214_963 | 242 |
| 43 | 3300049593 | Ga0501077_0129973 | Ga0501077_0129973_651_1400 | 242 |
| 44 | 3300049741 | Ga0501079_0111671 | Ga0501079_0111671_146_895 | 242 |
| 45 | 3300049742 | Ga0501080_0224100 | Ga0501080_0224100_929_1678 | 242 |
| 46 | 3300049824 | Ga0501045_0369671 | Ga0501045_0369671_284_1033 | 242 |
| 47 | 3300054114 | Ga0501084_0251824 | Ga0501084_0251824_180_932 | 242 |
| 48 | 3300059421 | Ga0590071_000003 | Ga0590071_000003_33854_34627 | 242 |
| 49 | 3300059421 | Ga0590071_000209 | Ga0590071_000209_12974_13747 | 242 |
| 50 | 3300059424 | Ga0590075_000088 | Ga0590075_000088_4426_5199 | 242 |
| 51 | 3300059424 | Ga0590075_000678 | Ga0590075_000678_7022_7795 | 242 |
| 52 | 3300059426 | Ga0590077_000016 | Ga0590077_000016_19250_20023 | 242 |
| 53 | 3300005293 | Ga0065715_10189471 | Ga0065715_101894712 | 243 |
| 54 | 3300005347 | Ga0070668_100072443 | Ga0070668_1000724432 | 243 |
| 55 | 3300005467 | Ga0070706_100372380 | Ga0070706_1003723802 | 243 |
| 56 | 3300005535 | Ga0070684_100645951 | Ga0070684_1006459511 | 243 |
| 57 | 3300005545 | Ga0070695_100080010 | Ga0070695_1000800102 | 243 |
| 58 | 3300005564 | Ga0070664_100109373 | Ga0070664_1001093733 | 243 |
| 59 | 3300006051 | Ga0075364_10100210 | Ga0075364_101002102 | 243 |
| 60 | 3300006195 | Ga0075366_10077310 | Ga0075366_100773102 | 243 |
| 61 | 3300006846 | Ga0075430_100209807 | Ga0075430_1002098072 | 243 |
| 62 | 3300013296 | Ga0157374_10067763 | Ga0157374_100677635 | 243 |
| 63 | 3300014326 | Ga0157380_10263213 | Ga0157380_102632132 | 243 |
| 64 | 3300014326 | Ga0157380_10445356 | Ga0157380_104453562 | 243 |
| 65 | 3300025923 | Ga0207681_10278196 | Ga0207681_102781962 | 243 |
| 66 | 3300025933 | Ga0207706_10478530 | Ga0207706_104785302 | 243 |
| 67 | 3300025945 | Ga0207679_10177529 | Ga0207679_101775293 | 243 |
| 68 | 3300025972 | Ga0207668_10050074 | Ga0207668_100500742 | 243 |
| 69 | 3300042122 | Ga0450920_002533 | Ga0450920_002533_230_1018 | 243 |
| 70 | 3300046664 | Ga0495659_0021302 | Ga0495659_0021302_761_1501 | 243 |
| 71 | 3300046684 | Ga0495669_0103983 | Ga0495669_0103983_530_1270 | 243 |
| 72 | 3300005356 | Ga0070674_100010675 | Ga0070674_1000106753 | 244 |
| 73 | 3300005459 | Ga0068867_100035704 | Ga0068867_1000357043 | 244 |
| 74 | 3300005718 | Ga0068866_10160023 | Ga0068866_101600231 | 244 |
| 75 | 3300006844 | Ga0075428_100000010 | Ga0075428_10000001080 | 244 |
| 76 | 3300006846 | Ga0075430_100363579 | Ga0075430_1003635791 | 244 |
| 77 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001120 | 244 |
| 78 | 3300009148 | Ga0105243_10008910 | Ga0105243_100089104 | 244 |
| 79 | 3300009553 | Ga0105249_10070700 | Ga0105249_100707002 | 244 |
| 80 | 3300025893 | Ga0207682_10138452 | Ga0207682_101384522 | 244 |
| 81 | 3300025937 | Ga0207669_10006952 | Ga0207669_100069523 | 244 |
| 82 | 3300026089 | Ga0207648_10104057 | Ga0207648_101040572 | 244 |
| 83 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002133 | 244 |
| 84 | 3300031852 | Ga0307410_10204439 | Ga0307410_102044392 | 244 |
| 85 | 3300046460 | Ga0495638_0005681 | Ga0495638_0005681_4471_5298 | 244 |
| 86 | 3300049568 | Ga0501031_0116234 | Ga0501031_0116234_288_1028 | 244 |
| 87 | 3300049578 | Ga0501042_0113840 | Ga0501042_0113840_629_1369 | 244 |
| 88 | 3300049587 | Ga0501071_0419278 | Ga0501071_0419278_240_980 | 244 |
| 89 | 3300049588 | Ga0501072_0420084 | Ga0501072_0420084_235_975 | 244 |
| 90 | 3300049591 | Ga0501075_0366308 | Ga0501075_0366308_192_932 | 244 |
| 91 | 3300049741 | Ga0501079_0453515 | Ga0501079_0453515_192_932 | 244 |
| 92 | 3300050508 | nmdc:mga09592_80760_c1 | nmdc:mga09592_80760_c1_125_871 | 244 |
| 93 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_138498_139244 | 244 |
| 94 | 3300054114 | Ga0501084_0327459 | Ga0501084_0327459_57_797 | 244 |
| 95 | 3300005471 | Ga0070698_100005765 | Ga0070698_1000057654 | 245 |
| 96 | 3300005518 | Ga0070699_100012499 | Ga0070699_1000124992 | 245 |
| 97 | 3300005530 | Ga0070679_100075349 | Ga0070679_1000753492 | 245 |
| 98 | 3300005536 | Ga0070697_100593834 | Ga0070697_1005938341 | 245 |
| 99 | 3300005546 | Ga0070696_100614774 | Ga0070696_1006147741 | 245 |
| 100 | 3300005549 | Ga0070704_100004800 | Ga0070704_1000048003 | 245 |
| 101 | 3300005842 | Ga0068858_100017019 | Ga0068858_1000170195 | 245 |
| 102 | 3300006852 | Ga0075433_10095091 | Ga0075433_100950912 | 245 |
| 103 | 3300006871 | Ga0075434_100002119 | Ga0075434_1000021192 | 245 |
| 104 | 3300006871 | Ga0075434_100073591 | Ga0075434_1000735912 | 245 |
| 105 | 3300006871 | Ga0075434_100078662 | Ga0075434_1000786622 | 245 |
| 106 | 3300007076 | Ga0075435_100038179 | Ga0075435_1000381793 | 245 |
| 107 | 3300007076 | Ga0075435_100168556 | Ga0075435_1001685562 | 245 |
| 108 | 3300007076 | Ga0075435_100197765 | Ga0075435_1001977652 | 245 |
| 109 | 3300009101 | Ga0105247_10377853 | Ga0105247_103778532 | 245 |
| 110 | 3300009147 | Ga0114129_10821095 | Ga0114129_108210952 | 245 |
| 111 | 3300014968 | Ga0157379_10007994 | Ga0157379_100079942 | 245 |
| 112 | 3300025912 | Ga0207707_10064532 | Ga0207707_100645322 | 245 |
| 113 | 3300025922 | Ga0207646_10394368 | Ga0207646_103943682 | 245 |
| 114 | 3300026035 | Ga0207703_10337285 | Ga0207703_103372851 | 245 |
| 115 | 3300026088 | Ga0207641_10588930 | Ga0207641_105889301 | 245 |
| 116 | 3300032002 | Ga0307416_100493056 | Ga0307416_1004930562 | 245 |
| 117 | 3300035118 | Ga0373954_0069612 | Ga0373954_0069612_40_786 | 245 |
| 118 | 3300035691 | Ga0373931_0078701 | Ga0373931_0078701_401_1144 | 245 |
| 119 | 3300046491 | Ga0495584_0121999 | Ga0495584_0121999_203_952 | 245 |
| 120 | 3300050507 | nmdc:mga05p37_19472_c1 | nmdc:mga05p37_19472_c1_2438_3199 | 245 |
| 121 | 3300050507 | nmdc:mga05p37_272330_c1 | nmdc:mga05p37_272330_c1_1082_1858 | 245 |
| 122 | 3300050512 | nmdc:mga0n895_102685_c1 | nmdc:mga0n895_102685_c1_1581_2345 | 245 |
| 123 | 3300050512 | nmdc:mga0n895_257602_c1 | nmdc:mga0n895_257602_c1_371_1159 | 245 |
| 124 | 3300050512 | nmdc:mga0n895_257870_c1 | nmdc:mga0n895_257870_c1_310_1059 | 245 |
| 125 | 3300050512 | nmdc:mga0n895_96553_c1 | nmdc:mga0n895_96553_c1_535_1284 | 245 |
| 126 | 3300050513 | nmdc:mga0rr50_15930_c1 | nmdc:mga0rr50_15930_c1_1419_2168 | 245 |
| 127 | 3300050513 | nmdc:mga0rr50_22552_c1 | nmdc:mga0rr50_22552_c1_2623_3387 | 245 |
| 128 | 3300050515 | nmdc:mga0a205_220597_c1 | nmdc:mga0a205_220597_c1_189_938 | 245 |
| 129 | 3300050515 | nmdc:mga0a205_6930_c1 | nmdc:mga0a205_6930_c1_1620_2369 | 245 |
| 130 | 3300005331 | Ga0070670_100033357 | Ga0070670_1000333572 | 246 |
| 131 | 3300005355 | Ga0070671_100018312 | Ga0070671_1000183122 | 246 |
| 132 | 3300005518 | Ga0070699_100441552 | Ga0070699_1004415521 | 246 |
| 133 | 3300005536 | Ga0070697_100374180 | Ga0070697_1003741801 | 246 |
| 134 | 3300005543 | Ga0070672_100093527 | Ga0070672_1000935272 | 246 |
| 135 | 3300005578 | Ga0068854_100180275 | Ga0068854_1001802753 | 246 |
| 136 | 3300005719 | Ga0068861_100375484 | Ga0068861_1003754842 | 246 |
| 137 | 3300005841 | Ga0068863_100050015 | Ga0068863_1000500152 | 246 |
| 138 | 3300006042 | Ga0075368_10120649 | Ga0075368_101206491 | 246 |
| 139 | 3300006048 | Ga0075363_100015403 | Ga0075363_1000154032 | 246 |
| 140 | 3300006058 | Ga0075432_10062909 | Ga0075432_100629091 | 246 |
| 141 | 3300006178 | Ga0075367_10047925 | Ga0075367_100479252 | 246 |
| 142 | 3300006353 | Ga0075370_10026909 | Ga0075370_100269094 | 246 |
| 143 | 3300006353 | Ga0075370_10038654 | Ga0075370_100386542 | 246 |
| 144 | 3300006914 | Ga0075436_100011621 | Ga0075436_1000116214 | 246 |
| 145 | 3300006914 | Ga0075436_100048566 | Ga0075436_1000485662 | 246 |
| 146 | 3300007076 | Ga0075435_100003596 | Ga0075435_1000035962 | 246 |
| 147 | 3300007076 | Ga0075435_100066230 | Ga0075435_1000662303 | 246 |
| 148 | 3300009147 | Ga0114129_10364341 | Ga0114129_103643412 | 246 |
| 149 | 3300014325 | Ga0163163_10681596 | Ga0163163_106815961 | 246 |
| 150 | 3300025922 | Ga0207646_10334504 | Ga0207646_103345042 | 246 |
| 151 | 3300025925 | Ga0207650_10080345 | Ga0207650_100803452 | 246 |
| 152 | 3300025931 | Ga0207644_10093987 | Ga0207644_100939873 | 246 |
| 153 | 3300025940 | Ga0207691_10048263 | Ga0207691_100482633 | 246 |
| 154 | 3300025944 | Ga0207661_10470959 | Ga0207661_104709592 | 246 |
| 155 | 3300025945 | Ga0207679_10119963 | Ga0207679_101199632 | 246 |
| 156 | 3300025960 | Ga0207651_10182202 | Ga0207651_101822022 | 246 |
| 157 | 3300025981 | Ga0207640_10137037 | Ga0207640_101370372 | 246 |
| 158 | 3300026088 | Ga0207641_10170163 | Ga0207641_101701632 | 246 |
| 159 | 3300026118 | Ga0207675_100122272 | Ga0207675_1001222722 | 246 |
| 160 | 3300026121 | Ga0207683_10044583 | Ga0207683_100445834 | 246 |
| 161 | 3300050494 | nmdc:mga06z11_112925_c1 | nmdc:mga06z11_112925_c1_479_1357 | 246 |
| 162 | 3300050494 | nmdc:mga06z11_29219_c1 | nmdc:mga06z11_29219_c1_1549_2427 | 246 |
| 163 | 3300050494 | nmdc:mga06z11_30792_c1 | nmdc:mga06z11_30792_c1_475_1317 | 246 |
| 164 | 3300050494 | nmdc:mga06z11_82901_c1 | nmdc:mga06z11_82901_c1_475_1311 | 246 |
| 165 | 3300050496 | nmdc:mga07m45_169913_c1 | nmdc:mga07m45_169913_c1_276_1112 | 246 |
| 166 | 3300050496 | nmdc:mga07m45_25497_c1 | nmdc:mga07m45_25497_c1_1496_2338 | 246 |
| 167 | 3300050507 | nmdc:mga05p37_241716_c1 | nmdc:mga05p37_241716_c1_334_1083 | 246 |
| 168 | 3300050512 | nmdc:mga0n895_255376_c1 | nmdc:mga0n895_255376_c1_611_1363 | 246 |
| 169 | 3300050512 | nmdc:mga0n895_618169_c1 | nmdc:mga0n895_618169_c1_322_1074 | 246 |
| 170 | 3300050513 | nmdc:mga0rr50_1072_c1 | nmdc:mga0rr50_1072_c1_6054_6806 | 246 |
| 171 | 3300050513 | nmdc:mga0rr50_43063_c1 | nmdc:mga0rr50_43063_c1_846_1598 | 246 |
| 172 | 3300050514 | nmdc:mga08x19_2366_c1 | nmdc:mga08x19_2366_c1_6106_6858 | 246 |
| 173 | 3300050514 | nmdc:mga08x19_37774_c1 | nmdc:mga08x19_37774_c1_730_1482 | 246 |
| 174 | 3300028379 | Ga0268266_10176887 | Ga0268266_101768872 | 247 |
| 175 | 3300005340 | Ga0070689_100074243 | Ga0070689_1000742433 | 248 |
| 176 | 3300005365 | Ga0070688_100173348 | Ga0070688_1001733482 | 248 |
| 177 | 3300009147 | Ga0114129_10028693 | Ga0114129_100286935 | 248 |
| 178 | 3300050507 | nmdc:mga05p37_55930_c1 | nmdc:mga05p37_55930_c1_3341_4090 | 248 |
| 179 | 3300005435 | Ga0070714_100010789 | Ga0070714_1000107893 | 249 |
| 180 | 3300005436 | Ga0070713_100471081 | Ga0070713_1004710811 | 249 |
| 181 | 3300025906 | Ga0207699_10364599 | Ga0207699_103645991 | 249 |
| 182 | 3300025913 | Ga0207695_10109509 | Ga0207695_101095092 | 249 |
| 183 | 3300025913 | Ga0207695_10785757 | Ga0207695_107857571 | 249 |
| 184 | 3300025929 | Ga0207664_10242189 | Ga0207664_102421891 | 249 |
| 185 | 3300005331 | Ga0070670_100013697 | Ga0070670_1000136972 | 250 |
| 186 | 3300005458 | Ga0070681_10025701 | Ga0070681_100257013 | 250 |
| 187 | 3300005530 | Ga0070679_100035194 | Ga0070679_1000351942 | 250 |
| 188 | 3300005618 | Ga0068864_100555705 | Ga0068864_1005557052 | 250 |
| 189 | 3300006931 | Ga0097620_100292221 | Ga0097620_1002922212 | 250 |
| 190 | 3300009094 | Ga0111539_10102800 | Ga0111539_101028002 | 250 |
| 191 | 3300009147 | Ga0114129_10319849 | Ga0114129_103198492 | 250 |
| 192 | 3300009147 | Ga0114129_10378520 | Ga0114129_103785202 | 250 |
| 193 | 3300014325 | Ga0163163_10090945 | Ga0163163_100909452 | 250 |
| 194 | 3300025918 | Ga0207662_10155925 | Ga0207662_101559252 | 250 |
| 195 | 3300025919 | Ga0207657_10206122 | Ga0207657_102061222 | 250 |
| 196 | 3300025925 | Ga0207650_10009681 | Ga0207650_100096815 | 250 |
| 197 | 3300025932 | Ga0207690_10177887 | Ga0207690_101778872 | 250 |
| 198 | 3300025944 | Ga0207661_10362377 | Ga0207661_103623771 | 250 |
| 199 | 3300026095 | Ga0207676_10568370 | Ga0207676_105683702 | 250 |
| 200 | 3300050507 | nmdc:mga05p37_378545_c1 | nmdc:mga05p37_378545_c1_184_945 | 250 |
| 201 | 3300050511 | nmdc:mga08y16_30610_c1 | nmdc:mga08y16_30610_c1_4242_5003 | 250 |
| 202 | 3300050515 | nmdc:mga0a205_306480_c1 | nmdc:mga0a205_306480_c1_55_816 | 250 |
| 203 | 3300050515 | nmdc:mga0a205_331933_c1 | nmdc:mga0a205_331933_c1_170_931 | 250 |
| 204 | 3300005364 | Ga0070673_100222227 | Ga0070673_1002222272 | 253 |
| 205 | 3300005365 | Ga0070688_100220972 | Ga0070688_1002209722 | 253 |
| 206 | 3300009177 | Ga0105248_10035461 | Ga0105248_100354612 | 253 |
| 207 | 3300025893 | Ga0207682_10031096 | Ga0207682_100310962 | 253 |
| 208 | 3300025941 | Ga0207711_10116074 | Ga0207711_101160742 | 253 |
| 209 | 3300025960 | Ga0207651_10127790 | Ga0207651_101277902 | 253 |
| 210 | 3300049571 | Ga0501034_0262369 | Ga0501034_0262369_760_1521 | 253 |
| 211 | 3300005535 | Ga0070684_100424736 | Ga0070684_1004247362 | 255 |
| 212 | 3300025940 | Ga0207691_10182213 | Ga0207691_101822131 | 255 |
| 213 | 3300048907 | Ga0496104_0375746 | Ga0496104_0375746_341_1156 | 255 |
| 214 | 3300050491 | nmdc:mga00v17_142189_c1 | nmdc:mga00v17_142189_c1_63_986 | 255 |
| 215 | 3300005290 | Ga0065712_10207706 | Ga0065712_102077061 | 258 |
| 216 | 3300009551 | Ga0105238_10274943 | Ga0105238_102749432 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ob6-assembly1.cif.gz_A | human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned | 0.4006 | 15 | 204 |
| 6ob6-assembly2.cif.gz_B | human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned | 0.3832 | 16 | 204 |
| 4pyp-assembly1.cif.gz_A | crystal structure of the human glucose transporter glut1 | 0.3639 | 16 | 215 |
| 6h7d-assembly1.cif.gz_A | crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state | 0.3608 | 22 | 203 |
| 4ybq-assembly2.cif.gz_B | rat glut5 with fv in the outward-open form | 0.3513 | 2 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1W0R3_258_450_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4919 | 19 | 199 | 1.20.1250.20 |
| af_Q1W0R3_258_450_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4622 | 19 | 199 | 1.20.1250.20 |
| af_P32135_206_419_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4612 | 4 | 209 | 1.20.1250.20 |
| af_P32135_206_419_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4469 | 4 | 209 | 1.20.1250.20 |
| af_Q4DA26_40_234_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4341 | 14 | 205 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A843RWC7-F1-model_v4 | DUF475 domain-containing protein | 0.9443 | 14 | 237 |
GO:0016020
|
| AF-A0A7V7X4T7-F1-model_v4 | DUF475 domain-containing protein | 0.919 | 14 | 245 |
GO:0016020
|
| AF-A0A3N5XSW7-F1-model_v4 | TerC family protein | 0.9093 | 14 | 241 |
GO:0016020
|
| AF-A0A7V7X4T7-F1-model_v4 | DUF475 domain-containing protein | 0.9076 | 14 | 245 |
GO:0016020
|
| AF-A0A7V8M8P4-F1-model_v4 | deleted | 0.8355 | 22 | 247 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar