F328103

General Info

Members Datasets Scaffolds Average Seq Length
216 139 216 254

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_142189_c1|nmdc:mga00v17_142189_c1_63_986
Length 307
Sequence MRLDTHRVKFARAIRMSPATHRRAARRSVEAGAWRPPPLSGDTRGLIVDVHLTDFVTIGLLVLLEGLLSADNALVLAVLVLGLPRAEQKKALRYGIVGAFAFRALATALAAYLIDVAWVKLVGAAYLLYLPYAHFTEKPEEGQKRTFKPARPWLGLSAFWATVVKVEFTDIVFAIDSILVAVAMSNKLWVIITGGILGIIAMRMLIGQLLTFVQRYPPLVDGAFIIIAWVGIKLLIEYLHQLHFIGFEVPRWLSLGLIVLIFTGAYAYARRVGAVEVADDGPPDAAEALFTEPDPEPDVTPASGDGR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.48
Nodule 0
Rhizoplane 0.46
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10207706 3300005290 Unclassified 1084
2 Ga0065715_10189471 3300005293 Bacteria 1424
3 Ga0070670_100013697 3300005331 Bacteria 6950
4 Ga0070670_100033357 3300005331 Bacteria 4433
5 Ga0070689_100074243 3300005340 Bacteria 2661
6 Ga0070668_100072443 3300005347 Bacteria 2684
7 Ga0070675_100042755 3300005354 Bacteria 3703
8 Ga0070671_100018312 3300005355 Bacteria 5688
9 Ga0070674_100010675 3300005356 Bacteria 5565
10 Ga0070674_100464316 3300005356 Bacteria 1047
11 Ga0070673_100222227 3300005364 Bacteria 1635
12 Ga0070688_100173348 3300005365 Bacteria 1491
13 Ga0070688_100220972 3300005365 Bacteria 1335
14 Ga0070714_100010789 3300005435 Bacteria 7232
15 Ga0070713_100471081 3300005436 Bacteria 1182
16 Ga0070681_10025701 3300005458 Bacteria 5921
17 Ga0068867_100035704 3300005459 Bacteria 3606
18 Ga0070706_100372380 3300005467 Bacteria 1331
19 Ga0070698_100005765 3300005471 Bacteria 13542
20 Ga0070699_100012499 3300005518 Bacteria 7326
21 Ga0070699_100441552 3300005518 Unclassified 1179
22 Ga0070679_100035194 3300005530 Bacteria 4968
23 Ga0070679_100075349 3300005530 Bacteria 3364
24 Ga0070684_100424736 3300005535 Unclassified 1227
25 Ga0070684_100645951 3300005535 Bacteria 985
26 Ga0070697_100374180 3300005536 Bacteria 1233
27 Ga0070697_100593834 3300005536 Unclassified 973
28 Ga0070672_100093527 3300005543 Bacteria 2429
29 Ga0070695_100080010 3300005545 Bacteria 2158
30 Ga0070696_100614774 3300005546 Unclassified 877
31 Ga0070704_100004800 3300005549 Bacteria 7829
32 Ga0070664_100109373 3300005564 Bacteria 2411
33 Ga0068854_100180275 3300005578 Bacteria 1650
34 Ga0068864_100555705 3300005618 Bacteria 1110
35 Ga0068866_10160023 3300005718 Unclassified 1312
36 Ga0068861_100375484 3300005719 Bacteria 1254
37 Ga0068863_100050015 3300005841 Bacteria 3964
38 Ga0068858_100017019 3300005842 Bacteria 6826
39 Ga0081538_10080852 3300005981 Bacteria 1731
40 Ga0075368_10120649 3300006042 Bacteria 1085
41 Ga0075363_100015403 3300006048 Bacteria 3758
42 Ga0075364_10100210 3300006051 Bacteria 1928
43 Ga0075432_10062909 3300006058 Bacteria 1324
44 Ga0075367_10047925 3300006178 Bacteria 2515
45 Ga0075366_10077310 3300006195 Bacteria 1986
46 Ga0075370_10026909 3300006353 Bacteria 3188
47 Ga0075370_10038654 3300006353 Bacteria 2686
48 Ga0068871_100454886 3300006358 Bacteria 1148
49 Ga0075428_100000010 3300006844 Bacteria 213631
50 Ga0075430_100002851 3300006846 Bacteria 14473
51 Ga0075430_100209807 3300006846 Bacteria 1616
52 Ga0075430_100284501 3300006846 Bacteria 1368
53 Ga0075430_100363579 3300006846 Unclassified 1195
54 Ga0075431_100076716 3300006847 Bacteria 3449
55 Ga0075433_10095091 3300006852 Bacteria 2637
56 Ga0075434_100002119 3300006871 Bacteria 17262
57 Ga0075434_100073591 3300006871 Bacteria 3409
58 Ga0075434_100078662 3300006871 Bacteria 3293
59 Ga0075429_100019593 3300006880 Bacteria 5865
60 Ga0075436_100011621 3300006914 Bacteria 6042
61 Ga0075436_100048566 3300006914 Bacteria 2928
62 Ga0075436_100094482 3300006914 Bacteria 2079
63 Ga0097620_100057689 3300006931 Bacteria 3911
64 Ga0097620_100292221 3300006931 Bacteria 1723
65 Ga0075435_100003596 3300007076 Bacteria 10542
66 Ga0075435_100038179 3300007076 Bacteria 3829
67 Ga0075435_100066230 3300007076 Bacteria 2938
68 Ga0075435_100168556 3300007076 Bacteria 1847
69 Ga0075435_100197765 3300007076 Bacteria 1703
70 Ga0105240_10154385 3300009093 Bacteria 2732
71 Ga0111539_10000001 3300009094 Bacteria 1035431
72 Ga0111539_10102800 3300009094 Bacteria 3353
73 Ga0105247_10377853 3300009101 Bacteria 1004
74 Ga0114129_10005462 3300009147 Bacteria 17965
75 Ga0114129_10028693 3300009147 Bacteria 7884
76 Ga0114129_10319849 3300009147 Bacteria 2063
77 Ga0114129_10364341 3300009147 Bacteria 1912
78 Ga0114129_10378520 3300009147 Bacteria 1870
79 Ga0114129_10821095 3300009147 Bacteria 1184
80 Ga0105243_10008910 3300009148 Bacteria 7673
81 Ga0105248_10035461 3300009177 Bacteria 5580
82 Ga0105238_10274943 3300009551 Bacteria 1665
83 Ga0105249_10070700 3300009553 Bacteria 3222
84 Ga0105249_10291126 3300009553 Bacteria 1634
85 Ga0157369_10083341 3300013105 Bacteria 3420
86 Ga0157374_10067763 3300013296 Bacteria 3356
87 Ga0163163_10090945 3300014325 Bacteria 3065
88 Ga0163163_10681596 3300014325 Bacteria 1091
89 Ga0157380_10263213 3300014326 Bacteria 1568
90 Ga0157380_10445356 3300014326 Bacteria 1242
91 Ga0157379_10007994 3300014968 Bacteria 9172
92 Ga0207682_10031096 3300025893 Bacteria 2141
93 Ga0207682_10138452 3300025893 Bacteria 1091
94 Ga0207699_10364599 3300025906 Bacteria 1022
95 Ga0207707_10064532 3300025912 Bacteria 3188
96 Ga0207695_10109509 3300025913 Bacteria 2744
97 Ga0207695_10785757 3300025913 Bacteria 832
98 Ga0207662_10155925 3300025918 Bacteria 1456
99 Ga0207657_10206122 3300025919 Unclassified 1580
100 Ga0207646_10334504 3300025922 Bacteria 1368
101 Ga0207646_10394368 3300025922 Bacteria 1250
102 Ga0207681_10278196 3300025923 Bacteria 1317
103 Ga0207650_10009681 3300025925 Bacteria 6587
104 Ga0207650_10080345 3300025925 Bacteria 2472
105 Ga0207659_10149138 3300025926 Bacteria 1824
106 Ga0207664_10242189 3300025929 Bacteria 1571
107 Ga0207644_10093987 3300025931 Bacteria 2239
108 Ga0207690_10177887 3300025932 Unclassified 1599
109 Ga0207706_10478530 3300025933 Bacteria 1076
110 Ga0207669_10006952 3300025937 Bacteria 5206
111 Ga0207691_10048263 3300025940 Bacteria 3904
112 Ga0207691_10182213 3300025940 Unclassified 1835
113 Ga0207711_10116074 3300025941 Bacteria 2386
114 Ga0207661_10061608 3300025944 Bacteria 3032
115 Ga0207661_10362377 3300025944 Bacteria 1310
116 Ga0207661_10470959 3300025944 Bacteria 1146
117 Ga0207679_10119963 3300025945 Bacteria 2092
118 Ga0207679_10177529 3300025945 Bacteria 1759
119 Ga0207651_10127790 3300025960 Unclassified 1940
120 Ga0207651_10182202 3300025960 Bacteria 1667
121 Ga0207668_10050074 3300025972 Bacteria 2876
122 Ga0207640_10137037 3300025981 Bacteria 1778
123 Ga0207677_10198447 3300026023 Bacteria 1593
124 Ga0207703_10337285 3300026035 Bacteria 1384
125 Ga0207641_10170163 3300026088 Bacteria 1988
126 Ga0207641_10588930 3300026088 Bacteria 1088
127 Ga0207648_10104057 3300026089 Bacteria 2489
128 Ga0207676_10568370 3300026095 Bacteria 1085
129 Ga0207675_100122272 3300026118 Bacteria 2464
130 Ga0207683_10044583 3300026121 Bacteria 3877
131 Ga0207428_10000002 3300027907 Bacteria 854851
132 Ga0207428_10003324 3300027907 Bacteria 15634
133 Ga0268266_10176887 3300028379 Bacteria 1940
134 Ga0307410_10204439 3300031852 Unclassified 1510
135 Ga0307410_10262297 3300031852 Bacteria 1348
136 Ga0307406_10055745 3300031901 Bacteria 2528
137 Ga0307412_10207355 3300031911 Bacteria 1493
138 Ga0307409_100152425 3300031995 Bacteria 2009
139 Ga0307409_100253992 3300031995 Bacteria 1609
140 Ga0307416_100187212 3300032002 Bacteria 1947
141 Ga0307416_100493056 3300032002 Unclassified 1288
142 Ga0307416_100645519 3300032002 Bacteria 1143
143 Ga0307411_10007614 3300032005 Bacteria 5539
144 Ga0307411_10359436 3300032005 Bacteria 1190
145 Ga0373954_0069612 3300035118 Bacteria 1671
146 Ga0373931_0078701 3300035691 Bacteria 1814
147 Ga0450920_002533 3300042122 Bacteria 3117
148 Ga0439464_0002978 3300042439 Bacteria 4230
149 Ga0466967_0073827 3300045976 Bacteria 3061
150 Ga0495638_0005681 3300046460 Bacteria 9192
151 Ga0495584_0121999 3300046491 Bacteria 1320
152 Ga0495659_0021302 3300046664 Bacteria 2183
153 Ga0495669_0103983 3300046684 Unclassified 1321
154 Ga0496104_0375746 3300048907 Unclassified 1334
155 Ga0501290_008245 3300049513 Unclassified 1314
156 Ga0501031_0064600 3300049568 Bacteria 2384
157 Ga0501031_0116234 3300049568 Bacteria 1748
158 Ga0501034_0262369 3300049571 Unclassified 1670
159 Ga0501042_0007559 3300049578 Bacteria 7131
160 Ga0501042_0113840 3300049578 Bacteria 1948
161 Ga0501048_0141189 3300049582 Bacteria 1703
162 Ga0501071_0013068 3300049587 Bacteria 5651
163 Ga0501071_0419278 3300049587 Bacteria 1023
164 Ga0501072_0061811 3300049588 Bacteria 2954
165 Ga0501072_0420084 3300049588 Bacteria 1060
166 Ga0501073_0376517 3300049589 Bacteria 981
167 Ga0501075_0366308 3300049591 Bacteria 1098
168 Ga0501077_0129973 3300049593 Bacteria 1597
169 Ga0501233_020529 3300049668 Bacteria 1411
170 Ga0501079_0111671 3300049741 Unclassified 2124
171 Ga0501079_0453515 3300049741 Bacteria 1007
172 Ga0501080_0224100 3300049742 Unclassified 1720
173 Ga0501045_0369671 3300049824 Bacteria 1067
174 nmdc:mga00v17_142189_c1 3300050491 Bacteria 1539
175 nmdc:mga06z11_112925_c1 3300050494 Bacteria 1507
176 nmdc:mga06z11_29219_c1 3300050494 Bacteria 2653
177 nmdc:mga06z11_30792_c1 3300050494 Bacteria 2600
178 nmdc:mga06z11_82901_c1 3300050494 Bacteria 1725
179 nmdc:mga07m45_169913_c1 3300050496 Bacteria 1267
180 nmdc:mga07m45_25497_c1 3300050496 Bacteria 3243
181 nmdc:mga05p37_1148_c1 3300050507 Bacteria 30482
182 nmdc:mga05p37_19472_c1 3300050507 Bacteria 8210
183 nmdc:mga05p37_241716_c1 3300050507 Bacteria 2170
184 nmdc:mga05p37_272330_c1 3300050507 Bacteria 2022
185 nmdc:mga05p37_378545_c1 3300050507 Unclassified 1659
186 nmdc:mga05p37_55930_c1 3300050507 Bacteria 4857
187 nmdc:mga09592_41622_c1 3300050508 Bacteria 3863
188 nmdc:mga09592_80760_c1 3300050508 Unclassified 2769
189 nmdc:mga0qj67_8503_c1 3300050509 Bacteria 7616
190 nmdc:mga06r32_29050_c1 3300050510 Bacteria 5178
191 nmdc:mga08y16_156_c1 3300050511 Bacteria 59323
192 nmdc:mga08y16_30610_c1 3300050511 Bacteria 5663
193 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
194 nmdc:mga0n895_102685_c1 3300050512 Bacteria 2870
195 nmdc:mga0n895_255376_c1 3300050512 Bacteria 1779
196 nmdc:mga0n895_257602_c1 3300050512 Bacteria 1771
197 nmdc:mga0n895_257870_c1 3300050512 Bacteria 1770
198 nmdc:mga0n895_618169_c1 3300050512 Bacteria 1085
199 nmdc:mga0n895_96553_c1 3300050512 Bacteria 2961
200 nmdc:mga0rr50_1072_c1 3300050513 Bacteria 14885
201 nmdc:mga0rr50_15930_c1 3300050513 Bacteria 4976
202 nmdc:mga0rr50_22552_c1 3300050513 Bacteria 4324
203 nmdc:mga0rr50_43063_c1 3300050513 Bacteria 3301
204 nmdc:mga08x19_2366_c1 3300050514 Bacteria 11427
205 nmdc:mga08x19_37774_c1 3300050514 Bacteria 3066
206 nmdc:mga0a205_220597_c1 3300050515 Bacteria 1782
207 nmdc:mga0a205_306480_c1 3300050515 Bacteria 1460
208 nmdc:mga0a205_331933_c1 3300050515 Bacteria 1390
209 nmdc:mga0a205_6930_c1 3300050515 Bacteria 9856
210 Ga0501084_0251824 3300054114 Bacteria 1491
211 Ga0501084_0327459 3300054114 Bacteria 1294
212 Ga0590071_000003 3300059421 Bacteria 75639
213 Ga0590071_000209 3300059421 Bacteria 17299
214 Ga0590075_000088 3300059424 Bacteria 23833
215 Ga0590075_000678 3300059424 Bacteria 9063
216 Ga0590077_000016 3300059426 Bacteria 38540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10061608 Ga0207661_100616084 230
2 3300009093 Ga0105240_10154385 Ga0105240_101543852 236
3 3300013105 Ga0157369_10083341 Ga0157369_100833413 236
4 3300006846 Ga0075430_100284501 Ga0075430_1002845012 239
5 3300005354 Ga0070675_100042755 Ga0070675_1000427553 240
6 3300009553 Ga0105249_10291126 Ga0105249_102911262 240
7 3300025926 Ga0207659_10149138 Ga0207659_101491383 240
8 3300045976 Ga0466967_0073827 Ga0466967_0073827_1955_2698 240
9 3300006846 Ga0075430_100002851 Ga0075430_1000028517 241
10 3300006847 Ga0075431_100076716 Ga0075431_1000767162 241
11 3300006880 Ga0075429_100019593 Ga0075429_1000195934 241
12 3300009147 Ga0114129_10005462 Ga0114129_100054627 241
13 3300027907 Ga0207428_10003324 Ga0207428_1000332412 241
14 3300031901 Ga0307406_10055745 Ga0307406_100557454 241
15 3300031995 Ga0307409_100253992 Ga0307409_1002539922 241
16 3300032002 Ga0307416_100187212 Ga0307416_1001872122 241
17 3300042439 Ga0439464_0002978 Ga0439464_0002978_2521_3261 241
18 3300049513 Ga0501290_008245 Ga0501290_008245_234_974 241
19 3300049668 Ga0501233_020529 Ga0501233_020529_316_1056 241
20 3300050507 nmdc:mga05p37_1148_c1 nmdc:mga05p37_1148_c1_22626_23366 241
21 3300050508 nmdc:mga09592_41622_c1 nmdc:mga09592_41622_c1_750_1490 241
22 3300050509 nmdc:mga0qj67_8503_c1 nmdc:mga0qj67_8503_c1_5081_5821 241
23 3300050510 nmdc:mga06r32_29050_c1 nmdc:mga06r32_29050_c1_1688_2428 241
24 3300050511 nmdc:mga08y16_156_c1 nmdc:mga08y16_156_c1_42525_43265 241
25 3300005356 Ga0070674_100464316 Ga0070674_1004643161 242
26 3300005981 Ga0081538_10080852 Ga0081538_100808522 242
27 3300006358 Ga0068871_100454886 Ga0068871_1004548862 242
28 3300006914 Ga0075436_100094482 Ga0075436_1000944822 242
29 3300006931 Ga0097620_100057689 Ga0097620_1000576892 242
30 3300026023 Ga0207677_10198447 Ga0207677_101984471 242
31 3300031852 Ga0307410_10262297 Ga0307410_102622972 242
32 3300031911 Ga0307412_10207355 Ga0307412_102073552 242
33 3300031995 Ga0307409_100152425 Ga0307409_1001524251 242
34 3300032002 Ga0307416_100645519 Ga0307416_1006455191 242
35 3300032005 Ga0307411_10007614 Ga0307411_100076142 242
36 3300032005 Ga0307411_10359436 Ga0307411_103594362 242
37 3300049568 Ga0501031_0064600 Ga0501031_0064600_1367_2116 242
38 3300049578 Ga0501042_0007559 Ga0501042_0007559_4382_5131 242
39 3300049582 Ga0501048_0141189 Ga0501048_0141189_720_1469 242
40 3300049587 Ga0501071_0013068 Ga0501071_0013068_3177_3926 242
41 3300049588 Ga0501072_0061811 Ga0501072_0061811_588_1337 242
42 3300049589 Ga0501073_0376517 Ga0501073_0376517_214_963 242
43 3300049593 Ga0501077_0129973 Ga0501077_0129973_651_1400 242
44 3300049741 Ga0501079_0111671 Ga0501079_0111671_146_895 242
45 3300049742 Ga0501080_0224100 Ga0501080_0224100_929_1678 242
46 3300049824 Ga0501045_0369671 Ga0501045_0369671_284_1033 242
47 3300054114 Ga0501084_0251824 Ga0501084_0251824_180_932 242
48 3300059421 Ga0590071_000003 Ga0590071_000003_33854_34627 242
49 3300059421 Ga0590071_000209 Ga0590071_000209_12974_13747 242
50 3300059424 Ga0590075_000088 Ga0590075_000088_4426_5199 242
51 3300059424 Ga0590075_000678 Ga0590075_000678_7022_7795 242
52 3300059426 Ga0590077_000016 Ga0590077_000016_19250_20023 242
53 3300005293 Ga0065715_10189471 Ga0065715_101894712 243
54 3300005347 Ga0070668_100072443 Ga0070668_1000724432 243
55 3300005467 Ga0070706_100372380 Ga0070706_1003723802 243
56 3300005535 Ga0070684_100645951 Ga0070684_1006459511 243
57 3300005545 Ga0070695_100080010 Ga0070695_1000800102 243
58 3300005564 Ga0070664_100109373 Ga0070664_1001093733 243
59 3300006051 Ga0075364_10100210 Ga0075364_101002102 243
60 3300006195 Ga0075366_10077310 Ga0075366_100773102 243
61 3300006846 Ga0075430_100209807 Ga0075430_1002098072 243
62 3300013296 Ga0157374_10067763 Ga0157374_100677635 243
63 3300014326 Ga0157380_10263213 Ga0157380_102632132 243
64 3300014326 Ga0157380_10445356 Ga0157380_104453562 243
65 3300025923 Ga0207681_10278196 Ga0207681_102781962 243
66 3300025933 Ga0207706_10478530 Ga0207706_104785302 243
67 3300025945 Ga0207679_10177529 Ga0207679_101775293 243
68 3300025972 Ga0207668_10050074 Ga0207668_100500742 243
69 3300042122 Ga0450920_002533 Ga0450920_002533_230_1018 243
70 3300046664 Ga0495659_0021302 Ga0495659_0021302_761_1501 243
71 3300046684 Ga0495669_0103983 Ga0495669_0103983_530_1270 243
72 3300005356 Ga0070674_100010675 Ga0070674_1000106753 244
73 3300005459 Ga0068867_100035704 Ga0068867_1000357043 244
74 3300005718 Ga0068866_10160023 Ga0068866_101600231 244
75 3300006844 Ga0075428_100000010 Ga0075428_10000001080 244
76 3300006846 Ga0075430_100363579 Ga0075430_1003635791 244
77 3300009094 Ga0111539_10000001 Ga0111539_10000001120 244
78 3300009148 Ga0105243_10008910 Ga0105243_100089104 244
79 3300009553 Ga0105249_10070700 Ga0105249_100707002 244
80 3300025893 Ga0207682_10138452 Ga0207682_101384522 244
81 3300025937 Ga0207669_10006952 Ga0207669_100069523 244
82 3300026089 Ga0207648_10104057 Ga0207648_101040572 244
83 3300027907 Ga0207428_10000002 Ga0207428_10000002133 244
84 3300031852 Ga0307410_10204439 Ga0307410_102044392 244
85 3300046460 Ga0495638_0005681 Ga0495638_0005681_4471_5298 244
86 3300049568 Ga0501031_0116234 Ga0501031_0116234_288_1028 244
87 3300049578 Ga0501042_0113840 Ga0501042_0113840_629_1369 244
88 3300049587 Ga0501071_0419278 Ga0501071_0419278_240_980 244
89 3300049588 Ga0501072_0420084 Ga0501072_0420084_235_975 244
90 3300049591 Ga0501075_0366308 Ga0501075_0366308_192_932 244
91 3300049741 Ga0501079_0453515 Ga0501079_0453515_192_932 244
92 3300050508 nmdc:mga09592_80760_c1 nmdc:mga09592_80760_c1_125_871 244
93 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_138498_139244 244
94 3300054114 Ga0501084_0327459 Ga0501084_0327459_57_797 244
95 3300005471 Ga0070698_100005765 Ga0070698_1000057654 245
96 3300005518 Ga0070699_100012499 Ga0070699_1000124992 245
97 3300005530 Ga0070679_100075349 Ga0070679_1000753492 245
98 3300005536 Ga0070697_100593834 Ga0070697_1005938341 245
99 3300005546 Ga0070696_100614774 Ga0070696_1006147741 245
100 3300005549 Ga0070704_100004800 Ga0070704_1000048003 245
101 3300005842 Ga0068858_100017019 Ga0068858_1000170195 245
102 3300006852 Ga0075433_10095091 Ga0075433_100950912 245
103 3300006871 Ga0075434_100002119 Ga0075434_1000021192 245
104 3300006871 Ga0075434_100073591 Ga0075434_1000735912 245
105 3300006871 Ga0075434_100078662 Ga0075434_1000786622 245
106 3300007076 Ga0075435_100038179 Ga0075435_1000381793 245
107 3300007076 Ga0075435_100168556 Ga0075435_1001685562 245
108 3300007076 Ga0075435_100197765 Ga0075435_1001977652 245
109 3300009101 Ga0105247_10377853 Ga0105247_103778532 245
110 3300009147 Ga0114129_10821095 Ga0114129_108210952 245
111 3300014968 Ga0157379_10007994 Ga0157379_100079942 245
112 3300025912 Ga0207707_10064532 Ga0207707_100645322 245
113 3300025922 Ga0207646_10394368 Ga0207646_103943682 245
114 3300026035 Ga0207703_10337285 Ga0207703_103372851 245
115 3300026088 Ga0207641_10588930 Ga0207641_105889301 245
116 3300032002 Ga0307416_100493056 Ga0307416_1004930562 245
117 3300035118 Ga0373954_0069612 Ga0373954_0069612_40_786 245
118 3300035691 Ga0373931_0078701 Ga0373931_0078701_401_1144 245
119 3300046491 Ga0495584_0121999 Ga0495584_0121999_203_952 245
120 3300050507 nmdc:mga05p37_19472_c1 nmdc:mga05p37_19472_c1_2438_3199 245
121 3300050507 nmdc:mga05p37_272330_c1 nmdc:mga05p37_272330_c1_1082_1858 245
122 3300050512 nmdc:mga0n895_102685_c1 nmdc:mga0n895_102685_c1_1581_2345 245
123 3300050512 nmdc:mga0n895_257602_c1 nmdc:mga0n895_257602_c1_371_1159 245
124 3300050512 nmdc:mga0n895_257870_c1 nmdc:mga0n895_257870_c1_310_1059 245
125 3300050512 nmdc:mga0n895_96553_c1 nmdc:mga0n895_96553_c1_535_1284 245
126 3300050513 nmdc:mga0rr50_15930_c1 nmdc:mga0rr50_15930_c1_1419_2168 245
127 3300050513 nmdc:mga0rr50_22552_c1 nmdc:mga0rr50_22552_c1_2623_3387 245
128 3300050515 nmdc:mga0a205_220597_c1 nmdc:mga0a205_220597_c1_189_938 245
129 3300050515 nmdc:mga0a205_6930_c1 nmdc:mga0a205_6930_c1_1620_2369 245
130 3300005331 Ga0070670_100033357 Ga0070670_1000333572 246
131 3300005355 Ga0070671_100018312 Ga0070671_1000183122 246
132 3300005518 Ga0070699_100441552 Ga0070699_1004415521 246
133 3300005536 Ga0070697_100374180 Ga0070697_1003741801 246
134 3300005543 Ga0070672_100093527 Ga0070672_1000935272 246
135 3300005578 Ga0068854_100180275 Ga0068854_1001802753 246
136 3300005719 Ga0068861_100375484 Ga0068861_1003754842 246
137 3300005841 Ga0068863_100050015 Ga0068863_1000500152 246
138 3300006042 Ga0075368_10120649 Ga0075368_101206491 246
139 3300006048 Ga0075363_100015403 Ga0075363_1000154032 246
140 3300006058 Ga0075432_10062909 Ga0075432_100629091 246
141 3300006178 Ga0075367_10047925 Ga0075367_100479252 246
142 3300006353 Ga0075370_10026909 Ga0075370_100269094 246
143 3300006353 Ga0075370_10038654 Ga0075370_100386542 246
144 3300006914 Ga0075436_100011621 Ga0075436_1000116214 246
145 3300006914 Ga0075436_100048566 Ga0075436_1000485662 246
146 3300007076 Ga0075435_100003596 Ga0075435_1000035962 246
147 3300007076 Ga0075435_100066230 Ga0075435_1000662303 246
148 3300009147 Ga0114129_10364341 Ga0114129_103643412 246
149 3300014325 Ga0163163_10681596 Ga0163163_106815961 246
150 3300025922 Ga0207646_10334504 Ga0207646_103345042 246
151 3300025925 Ga0207650_10080345 Ga0207650_100803452 246
152 3300025931 Ga0207644_10093987 Ga0207644_100939873 246
153 3300025940 Ga0207691_10048263 Ga0207691_100482633 246
154 3300025944 Ga0207661_10470959 Ga0207661_104709592 246
155 3300025945 Ga0207679_10119963 Ga0207679_101199632 246
156 3300025960 Ga0207651_10182202 Ga0207651_101822022 246
157 3300025981 Ga0207640_10137037 Ga0207640_101370372 246
158 3300026088 Ga0207641_10170163 Ga0207641_101701632 246
159 3300026118 Ga0207675_100122272 Ga0207675_1001222722 246
160 3300026121 Ga0207683_10044583 Ga0207683_100445834 246
161 3300050494 nmdc:mga06z11_112925_c1 nmdc:mga06z11_112925_c1_479_1357 246
162 3300050494 nmdc:mga06z11_29219_c1 nmdc:mga06z11_29219_c1_1549_2427 246
163 3300050494 nmdc:mga06z11_30792_c1 nmdc:mga06z11_30792_c1_475_1317 246
164 3300050494 nmdc:mga06z11_82901_c1 nmdc:mga06z11_82901_c1_475_1311 246
165 3300050496 nmdc:mga07m45_169913_c1 nmdc:mga07m45_169913_c1_276_1112 246
166 3300050496 nmdc:mga07m45_25497_c1 nmdc:mga07m45_25497_c1_1496_2338 246
167 3300050507 nmdc:mga05p37_241716_c1 nmdc:mga05p37_241716_c1_334_1083 246
168 3300050512 nmdc:mga0n895_255376_c1 nmdc:mga0n895_255376_c1_611_1363 246
169 3300050512 nmdc:mga0n895_618169_c1 nmdc:mga0n895_618169_c1_322_1074 246
170 3300050513 nmdc:mga0rr50_1072_c1 nmdc:mga0rr50_1072_c1_6054_6806 246
171 3300050513 nmdc:mga0rr50_43063_c1 nmdc:mga0rr50_43063_c1_846_1598 246
172 3300050514 nmdc:mga08x19_2366_c1 nmdc:mga08x19_2366_c1_6106_6858 246
173 3300050514 nmdc:mga08x19_37774_c1 nmdc:mga08x19_37774_c1_730_1482 246
174 3300028379 Ga0268266_10176887 Ga0268266_101768872 247
175 3300005340 Ga0070689_100074243 Ga0070689_1000742433 248
176 3300005365 Ga0070688_100173348 Ga0070688_1001733482 248
177 3300009147 Ga0114129_10028693 Ga0114129_100286935 248
178 3300050507 nmdc:mga05p37_55930_c1 nmdc:mga05p37_55930_c1_3341_4090 248
179 3300005435 Ga0070714_100010789 Ga0070714_1000107893 249
180 3300005436 Ga0070713_100471081 Ga0070713_1004710811 249
181 3300025906 Ga0207699_10364599 Ga0207699_103645991 249
182 3300025913 Ga0207695_10109509 Ga0207695_101095092 249
183 3300025913 Ga0207695_10785757 Ga0207695_107857571 249
184 3300025929 Ga0207664_10242189 Ga0207664_102421891 249
185 3300005331 Ga0070670_100013697 Ga0070670_1000136972 250
186 3300005458 Ga0070681_10025701 Ga0070681_100257013 250
187 3300005530 Ga0070679_100035194 Ga0070679_1000351942 250
188 3300005618 Ga0068864_100555705 Ga0068864_1005557052 250
189 3300006931 Ga0097620_100292221 Ga0097620_1002922212 250
190 3300009094 Ga0111539_10102800 Ga0111539_101028002 250
191 3300009147 Ga0114129_10319849 Ga0114129_103198492 250
192 3300009147 Ga0114129_10378520 Ga0114129_103785202 250
193 3300014325 Ga0163163_10090945 Ga0163163_100909452 250
194 3300025918 Ga0207662_10155925 Ga0207662_101559252 250
195 3300025919 Ga0207657_10206122 Ga0207657_102061222 250
196 3300025925 Ga0207650_10009681 Ga0207650_100096815 250
197 3300025932 Ga0207690_10177887 Ga0207690_101778872 250
198 3300025944 Ga0207661_10362377 Ga0207661_103623771 250
199 3300026095 Ga0207676_10568370 Ga0207676_105683702 250
200 3300050507 nmdc:mga05p37_378545_c1 nmdc:mga05p37_378545_c1_184_945 250
201 3300050511 nmdc:mga08y16_30610_c1 nmdc:mga08y16_30610_c1_4242_5003 250
202 3300050515 nmdc:mga0a205_306480_c1 nmdc:mga0a205_306480_c1_55_816 250
203 3300050515 nmdc:mga0a205_331933_c1 nmdc:mga0a205_331933_c1_170_931 250
204 3300005364 Ga0070673_100222227 Ga0070673_1002222272 253
205 3300005365 Ga0070688_100220972 Ga0070688_1002209722 253
206 3300009177 Ga0105248_10035461 Ga0105248_100354612 253
207 3300025893 Ga0207682_10031096 Ga0207682_100310962 253
208 3300025941 Ga0207711_10116074 Ga0207711_101160742 253
209 3300025960 Ga0207651_10127790 Ga0207651_101277902 253
210 3300049571 Ga0501034_0262369 Ga0501034_0262369_760_1521 253
211 3300005535 Ga0070684_100424736 Ga0070684_1004247362 255
212 3300025940 Ga0207691_10182213 Ga0207691_101822131 255
213 3300048907 Ga0496104_0375746 Ga0496104_0375746_341_1156 255
214 3300050491 nmdc:mga00v17_142189_c1 nmdc:mga00v17_142189_c1_63_986 255
215 3300005290 Ga0065712_10207706 Ga0065712_102077061 258
216 3300009551 Ga0105238_10274943 Ga0105238_102749432 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

59

238

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4006 15 204
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3832 16 204
4pyp-assembly1.cif.gz_A crystal structure of the human glucose transporter glut1 0.3639 16 215
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.3608 22 203
4ybq-assembly2.cif.gz_B rat glut5 with fv in the outward-open form 0.3513 2 205
ID Description Score Start End Superfamily
af_Q1W0R3_258_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4919 19 199 1.20.1250.20
af_Q1W0R3_258_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4622 19 199 1.20.1250.20
af_P32135_206_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4612 4 209 1.20.1250.20
af_P32135_206_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4469 4 209 1.20.1250.20
af_Q4DA26_40_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4341 14 205 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A843RWC7-F1-model_v4 DUF475 domain-containing protein 0.9443 14 237 GO:0016020
AF-A0A7V7X4T7-F1-model_v4 DUF475 domain-containing protein 0.919 14 245 GO:0016020
AF-A0A3N5XSW7-F1-model_v4 TerC family protein 0.9093 14 241 GO:0016020
AF-A0A7V7X4T7-F1-model_v4 DUF475 domain-containing protein 0.9076 14 245 GO:0016020
AF-A0A7V8M8P4-F1-model_v4 deleted 0.8355 22 247

Feature Viewer

pLDDT pTM Quality
82.15 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map