F328159

General Info

Members Datasets Scaffolds Average Seq Length
216 162 210 178

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154155|2515851125
Length 206
Sequence HDPPGKAKAAVGASRAVTVQGEAARSVLDEADIARALTRIAHEILERNKGAREVVLLGIPTRGVELARRIGERISAVEGSFGGVGALDVTMYRDDLRLRPTRVLGHTEIPESGIDGKVVVLVDDVLFSGRTIRAALTALDDIGRPRAVQLAVLVDRGHRELPIRADFVGKNLPTAADERVVVSLRESDGGESVVIAKREPVGEGTS

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
3 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
4 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
5 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
79 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
80 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
86 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
87 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
146 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
147 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
162 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0.93
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 11.11
Rhizosphere 84.72
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10130182 3300005293 Bacteria 2031
2 Ga0065715_10183175 3300005293 Bacteria 1462
3 Ga0070683_100316569 3300005329 Bacteria 1485
4 Ga0070670_100349363 3300005331 Bacteria 1299
5 Ga0070666_10457968 3300005335 Bacteria 922
6 Ga0070682_100037904 3300005337 Bacteria 2954
7 Ga0070668_100051598 3300005347 Bacteria 3170
8 Ga0070668_100089355 3300005347 Bacteria 2426
9 Ga0070673_100564929 3300005364 Bacteria 1035
10 Ga0070659_100529251 3300005366 Bacteria 1007
11 Ga0070667_100463722 3300005367 Bacteria 1158
12 Ga0070667_100686538 3300005367 Bacteria 947
13 Ga0070705_100020686 3300005440 Bacteria 3487
14 Ga0070708_100385217 3300005445 Bacteria 1322
15 Ga0070681_10043825 3300005458 Bacteria 4479
16 Ga0068867_100656366 3300005459 Bacteria 921
17 Ga0070698_100009315 3300005471 Bacteria 10532
18 Ga0070684_100523723 3300005535 Bacteria 1099
19 Ga0070696_100203648 3300005546 Bacteria 1478
20 Ga0070693_100541861 3300005547 Bacteria 832
21 Ga0070704_100398749 3300005549 Bacteria 1173
22 Ga0068854_100622623 3300005578 Bacteria 924
23 Ga0068852_100199225 3300005616 Bacteria 1894
24 Ga0068861_100291669 3300005719 Bacteria 1409
25 Ga0068851_10095934 3300005834 Bacteria 1567
26 Ga0068870_10228039 3300005840 Bacteria 1144
27 Ga0068860_101353993 3300005843 Bacteria 733
28 Ga0068862_100039218 3300005844 Bacteria 4022
29 Ga0081455_10000773 3300005937 Bacteria 41270
30 Ga0075428_100000215 3300006844 Bacteria 55598
31 Ga0075428_100901862 3300006844 Bacteria 937
32 Ga0075431_100412098 3300006847 Unclassified 1351
33 Ga0075433_10208739 3300006852 Bacteria 1736
34 Ga0075433_10719708 3300006852 Bacteria 874
35 Ga0075434_100091815 3300006871 Bacteria 3038
36 Ga0105245_10004258 3300009098 Bacteria 12687
37 Ga0105245_10092793 3300009098 Bacteria 2781
38 Ga0105245_11593289 3300009098 Bacteria 705
39 Ga0114129_10043167 3300009147 Bacteria 6344
40 Ga0114129_10214672 3300009147 Bacteria 2598
41 Ga0114129_10931968 3300009147 Bacteria 1098
42 Ga0105243_10006529 3300009148 Bacteria 9011
43 Ga0105243_10016689 3300009148 Bacteria 5551
44 Ga0105241_10071430 3300009174 Bacteria 2695
45 Ga0105242_10127811 3300009176 Bacteria 2189
46 Ga0105242_10297611 3300009176 Bacteria 1471
47 Ga0105242_10767322 3300009176 Bacteria 951
48 Ga0105248_10831207 3300009177 Bacteria 1042
49 Ga0105237_10363182 3300009545 Bacteria 1452
50 Ga0105238_10037839 3300009551 Bacteria 4902
51 Ga0105238_10614859 3300009551 Bacteria 1095
52 Ga0105249_10017399 3300009553 Bacteria 6381
53 Ga0105249_10535236 3300009553 Bacteria 1220
54 Ga0105239_10267490 3300010375 Bacteria 1922
55 Ga0105239_10359283 3300010375 Bacteria 1645
56 Ga0105246_10015147 3300011119 Bacteria 4862
57 Ga0105246_10214091 3300011119 Bacteria 1506
58 Ga0157374_10482209 3300013296 Bacteria 1243
59 Ga0157378_10008190 3300013297 Bacteria 9115
60 Ga0157378_10031377 3300013297 Bacteria 4695
61 Ga0163162_10157520 3300013306 Bacteria 2391
62 Ga0163162_10261671 3300013306 Bacteria 1862
63 Ga0157372_10869557 3300013307 Bacteria 1046
64 Ga0157372_11477622 3300013307 Bacteria 783
65 Ga0157375_10006171 3300013308 Bacteria 10443
66 Ga0163163_10961907 3300014325 Bacteria 917
67 Ga0157380_10050189 3300014326 Bacteria 3294
68 Ga0157380_10061259 3300014326 Bacteria 3010
69 Ga0157380_10975762 3300014326 Bacteria 879
70 Ga0157377_10005423 3300014745 Bacteria 5993
71 Ga0157376_10313496 3300014969 Bacteria 1489
72 Ga0163161_10201317 3300017792 Bacteria 1535
73 Ga0206353_10789076 3300020082 Bacteria 1742
74 Ga0207642_10339587 3300025899 Bacteria 883
75 Ga0207643_10170552 3300025908 Bacteria 1313
76 Ga0207654_10272245 3300025911 Bacteria 1143
77 Ga0207681_10486879 3300025923 Bacteria 1008
78 Ga0207694_10401038 3300025924 Bacteria 1140
79 Ga0207694_10616087 3300025924 Bacteria 913
80 Ga0207650_10542010 3300025925 Bacteria 975
81 Ga0207690_10461126 3300025932 Bacteria 1023
82 Ga0207690_10634666 3300025932 Bacteria 874
83 Ga0207709_10048087 3300025935 Bacteria 2598
84 Ga0207709_10925513 3300025935 Bacteria 710
85 Ga0207669_10295537 3300025937 Bacteria 1228
86 Ga0207661_10155904 3300025944 Bacteria 1978
87 Ga0207661_10205829 3300025944 Bacteria 1732
88 Ga0207679_10374170 3300025945 Bacteria 1247
89 Ga0207712_10213420 3300025961 Bacteria 1539
90 Ga0207668_10041772 3300025972 Bacteria 3102
91 Ga0207640_10845585 3300025981 Bacteria 796
92 Ga0207658_10166187 3300025986 Bacteria 1813
93 Ga0207648_10165029 3300026089 Bacteria 1957
94 Ga0207675_100029695 3300026118 Bacteria 5091
95 Ga0207683_10383638 3300026121 Bacteria 1292
96 Ga0207698_10325555 3300026142 Bacteria 1441
97 Ga0268265_10017135 3300028380 Bacteria 4992
98 Ga0268265_10075636 3300028380 Bacteria 2638
99 Ga0316183_1087843 3300030742 Bacteria 2237
100 Ga0316181_1037279 3300030744 Bacteria 1466
101 Ga0316182_1092058 3300030745 Bacteria 2174
102 Ga0316576_10000047 3300031727 Bacteria 37553
103 Ga0316576_10006863 3300031727 Bacteria 7117
104 Ga0316576_10414476 3300031727 Bacteria 997
105 Ga0316576_10789140 3300031727 Bacteria 684
106 Ga0316578_10000940 3300031728 Bacteria 11068
107 Ga0316578_10297546 3300031728 Bacteria 965
108 Ga0316577_10028248 3300031733 Bacteria 3128
109 Ga0316583_10001644 3300032133 Bacteria 7556
110 Ga0316585_10001443 3300032137 Bacteria 6279
111 Ga0316580_10003623 3300032139 Bacteria 4407
112 Ga0316593_10053316 3300032168 Bacteria 1370
113 Ga0373929_0069202 3300035085 Bacteria 841
114 Ga0373934_0043454 3300035086 Bacteria 1776
115 Ga0373961_0071498 3300035241 Bacteria 1074
116 Ga0373961_0170115 3300035241 Bacteria 753
117 Ga0316574_0079447 3300035398 Bacteria 2080
118 Ga0373931_0210815 3300035691 Bacteria 1165
119 Ga0373931_0242450 3300035691 Bacteria 1093
120 Ga0373937_0123737 3300036401 Bacteria 2411
121 Ga0316582_0004554 3300036647 Bacteria 7019
122 Ga0316584_0000644 3300036712 Bacteria 18952
123 Ga0316581_0000290 3300037588 Bacteria 8864
124 Ga0395901_0612513 3300038443 Bacteria 1097
125 Ga0439465_0190778 3300041413 Bacteria 744
126 Ga0451789_0936328 3300041443 Bacteria 1195
127 Ga0451793_1458501 3300041452 Bacteria 1449
128 Ga0451807_2335560 3300041486 Bacteria 986
129 Ga0451833_0736545 3300041491 Bacteria 5807
130 Ga0451837_1116111 3300041494 Bacteria 1631
131 Ga0451839_0440467 3300041496 Bacteria 1356
132 Ga0439445_0008169 3300042004 Bacteria 2445
133 Ga0439445_0026401 3300042004 Bacteria 1487
134 Ga0439448_0051871 3300042005 Bacteria 1344
135 Ga0439432_016822 3300042006 Bacteria 2459
136 Ga0439432_139011 3300042006 Bacteria 715
137 Ga0439455_0130517 3300042012 Bacteria 708
138 Ga0439446_0106578 3300042156 Bacteria 891
139 Ga0439435_0055266 3300042436 Bacteria 1145
140 Ga0453684_0980630 3300044712 Bacteria 900
141 Ga0466957_0006416 3300044842 Bacteria 6643
142 Ga0451576_0032580 3300045051 Bacteria 5546
143 Ga0451576_0141006 3300045051 Bacteria 2513
144 Ga0466958_0104732 3300045836 Bacteria 1762
145 Ga0466967_0736829 3300045976 Bacteria 977
146 Ga0495641_0195350 3300046461 Bacteria 907
147 Ga0495618_0433596 3300046514 Bacteria 800
148 Ga0495630_0424437 3300046517 Bacteria 1019
149 Ga0495640_0334340 3300046533 Bacteria 937
150 Ga0495587_0170889 3300046536 Bacteria 1235
151 Ga0495634_0265504 3300046642 Bacteria 1046
152 Ga0495657_0103596 3300046675 Bacteria 1810
153 Ga0495658_0315908 3300046683 Bacteria 990
154 Ga0495604_0178122 3300047317 Bacteria 1489
155 Ga0495674_0593581 3300047319 Bacteria 878
156 Ga0495675_0464311 3300047444 Bacteria 731
157 Ga0496100_0198922 3300048903 Bacteria 1459
158 Ga0496102_0084026 3300048905 Bacteria 2938
159 Ga0496102_0137966 3300048905 Bacteria 2285
160 Ga0496102_1328949 3300048905 Bacteria 638
161 Ga0496103_0069810 3300048906 Bacteria 2197
162 Ga0496104_0103845 3300048907 Bacteria 2723
163 Ga0496104_0344585 3300048907 Bacteria 1403
164 Ga0496105_0132243 3300048908 Bacteria 2057
165 Ga0496105_0164277 3300048908 Bacteria 1822
166 Ga0496106_0061230 3300048909 Bacteria 2855
167 Ga0496106_0104721 3300048909 Bacteria 2197
168 Ga0496107_0045373 3300048910 Bacteria 3161
169 Ga0496108_0280183 3300048911 Bacteria 1451
170 Ga0496109_0044270 3300048912 Bacteria 4038
171 Ga0496109_0509281 3300048912 Bacteria 1136
172 Ga0496110_0032613 3300048913 Bacteria 4500
173 Ga0496110_0140367 3300048913 Bacteria 2184
174 Ga0496111_0139903 3300048914 Bacteria 1793
175 Ga0496113_0231393 3300048916 Bacteria 1474
176 Ga0496113_0480864 3300048916 Bacteria 998
177 Ga0496114_0155267 3300048917 Bacteria 1987
178 Ga0501295_075463 3300049518 Bacteria 760
179 Ga0501034_0010551 3300049571 Bacteria 9619
180 Ga0501040_0372533 3300049576 Bacteria 1024
181 Ga0501068_0247857 3300049584 Bacteria 1135
182 Ga0501070_0302871 3300049586 Bacteria 1302
183 Ga0501206_045506 3300049653 Bacteria 686
184 Ga0501256_004277 3300049685 Bacteria 1221
185 Ga0501266_016769 3300049763 Bacteria 975
186 nmdc:mga05p37_30761_c1 3300050507 Bacteria 6552
187 nmdc:mga05p37_405203_c1 3300050507 Bacteria 1591
188 nmdc:mga05p37_424716_c1 3300050507 Bacteria 1546
189 nmdc:mga09592_170189_c1 3300050508 Bacteria 1884
190 nmdc:mga0qj67_141710_c1 3300050509 Unclassified 1949
191 nmdc:mga0qj67_40811_c1 3300050509 Bacteria 3648
192 nmdc:mga06r32_122458_c1 3300050510 Bacteria 2566
193 nmdc:mga06r32_1586206_c1 3300050510 Bacteria 593
194 nmdc:mga06r32_50125_c1 3300050510 Bacteria 3994
195 nmdc:mga08y16_68967_c1 3300050511 Bacteria 3687
196 nmdc:mga0n895_1120929_c1 3300050512 Bacteria 763
197 nmdc:mga0n895_137476_c1 3300050512 Bacteria 2471
198 nmdc:mga0n895_3186_c1 3300050512 Bacteria 13111
199 nmdc:mga0n895_42914_c1 3300050512 Bacteria 4404
200 nmdc:mga0n895_463624_c1 3300050512 Bacteria 1278
201 nmdc:mga0rr50_153251_c1 3300050513 Bacteria 1865
202 nmdc:mga08x19_160870_c1 3300050514 Bacteria 1525
203 nmdc:mga0a205_182274_c1 3300050515 Bacteria 1994
204 nmdc:mga0a205_287626_c1 3300050515 Bacteria 1519
205 nmdc:mga0a205_94799_c2 3300050515 Bacteria 1132
206 Ga0495612_0282834 3300053078 Bacteria 742
207 Ga0495619_0013899 3300053085 Bacteria 5081
208 Ga0500604_0011341 3300053151 Bacteria 2392
209 Ga0500616_0001343 3300053153 Bacteria 24047
210 Ga0500627_0158974 3300053158 Bacteria 1020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032168 Ga0316593_10053316 Ga0316593_100533161 161
2 3300048909 Ga0496106_0061230 Ga0496106_0061230_1218_1763 162
3 3300009176 Ga0105242_10767322 Ga0105242_107673222 163
4 3300035241 Ga0373961_0071498 Ga0373961_0071498_456_1010 164
5 3300035691 Ga0373931_0210815 Ga0373931_0210815_520_1074 164
6 3300045976 Ga0466967_0736829 Ga0466967_0736829_13_549 165
7 3300005458 Ga0070681_10043825 Ga0070681_100438255 166
8 3300009098 Ga0105245_10092793 Ga0105245_100927933 166
9 3300048903 Ga0496100_0198922 Ga0496100_0198922_368_922 166
10 3300048905 Ga0496102_0137966 Ga0496102_0137966_696_1250 166
11 3300048906 Ga0496103_0069810 Ga0496103_0069810_1167_1721 166
12 3300048907 Ga0496104_0103845 Ga0496104_0103845_2071_2625 166
13 3300048908 Ga0496105_0164277 Ga0496105_0164277_923_1477 166
14 3300048909 Ga0496106_0104721 Ga0496106_0104721_114_668 166
15 3300048910 Ga0496107_0045373 Ga0496107_0045373_1843_2397 166
16 3300048911 Ga0496108_0280183 Ga0496108_0280183_231_785 166
17 3300048913 Ga0496110_0140367 Ga0496110_0140367_1321_1875 166
18 3300048914 Ga0496111_0139903 Ga0496111_0139903_1027_1581 166
19 3300048917 Ga0496114_0155267 Ga0496114_0155267_607_1161 166
20 3300050512 nmdc:mga0n895_463624_c1 nmdc:mga0n895_463624_c1_711_1265 166
21 3300005834 Ga0068851_10095934 Ga0068851_100959342 168
22 3300005366 Ga0070659_100529251 Ga0070659_1005292511 169
23 3300005547 Ga0070693_100541861 Ga0070693_1005418611 169
24 3300009551 Ga0105238_10614859 Ga0105238_106148592 169
25 3300046675 Ga0495657_0103596 Ga0495657_0103596_518_1030 169
26 3300048912 Ga0496109_0509281 Ga0496109_0509281_52_582 169
27 3300049685 Ga0501256_004277 Ga0501256_004277_10_528 170
28 3300049763 Ga0501266_016769 Ga0501266_016769_24_542 170
29 3300009098 Ga0105245_10004258 Ga0105245_100042584 171
30 3300009147 Ga0114129_10214672 Ga0114129_102146723 171
31 3300009148 Ga0105243_10006529 Ga0105243_100065293 171
32 3300009174 Ga0105241_10071430 Ga0105241_100714303 171
33 3300009176 Ga0105242_10127811 Ga0105242_101278112 171
34 3300009177 Ga0105248_10831207 Ga0105248_108312072 171
35 3300009545 Ga0105237_10363182 Ga0105237_103631821 171
36 3300009553 Ga0105249_10017399 Ga0105249_100173995 171
37 3300010375 Ga0105239_10267490 Ga0105239_102674902 171
38 3300011119 Ga0105246_10015147 Ga0105246_100151472 171
39 3300013296 Ga0157374_10482209 Ga0157374_104822092 171
40 3300013297 Ga0157378_10008190 Ga0157378_100081908 171
41 3300013306 Ga0163162_10261671 Ga0163162_102616712 171
42 3300013307 Ga0157372_10869557 Ga0157372_108695571 171
43 3300013308 Ga0157375_10006171 Ga0157375_100061718 171
44 3300014325 Ga0163163_10961907 Ga0163163_109619071 171
45 3300014326 Ga0157380_10061259 Ga0157380_100612592 171
46 3300014745 Ga0157377_10005423 Ga0157377_100054234 171
47 3300014969 Ga0157376_10313496 Ga0157376_103134962 171
48 3300035241 Ga0373961_0170115 Ga0373961_0170115_174_689 171
49 3300042005 Ga0439448_0051871 Ga0439448_0051871_379_894 171
50 3300042012 Ga0439455_0130517 Ga0439455_0130517_46_561 171
51 3300044712 Ga0453684_0980630 Ga0453684_0980630_11_526 171
52 3300045051 Ga0451576_0032580 Ga0451576_0032580_4452_4967 171
53 3300045051 Ga0451576_0141006 Ga0451576_0141006_654_1169 171
54 3300048905 Ga0496102_0084026 Ga0496102_0084026_1731_2246 171
55 3300049518 Ga0501295_075463 Ga0501295_075463_215_730 171
56 3300050507 nmdc:mga05p37_30761_c1 nmdc:mga05p37_30761_c1_3966_4481 171
57 3300050508 nmdc:mga09592_170189_c1 nmdc:mga09592_170189_c1_535_1050 171
58 3300050509 nmdc:mga0qj67_40811_c1 nmdc:mga0qj67_40811_c1_1864_2379 171
59 3300050510 nmdc:mga06r32_50125_c1 nmdc:mga06r32_50125_c1_2762_3277 171
60 3300050511 nmdc:mga08y16_68967_c1 nmdc:mga08y16_68967_c1_362_877 171
61 3300050512 nmdc:mga0n895_137476_c1 nmdc:mga0n895_137476_c1_537_1052 171
62 3300050512 nmdc:mga0n895_42914_c1 nmdc:mga0n895_42914_c1_3247_3762 171
63 3300050513 nmdc:mga0rr50_153251_c1 nmdc:mga0rr50_153251_c1_1175_1690 171
64 3300050514 nmdc:mga08x19_160870_c1 nmdc:mga08x19_160870_c1_880_1395 171
65 3300050515 nmdc:mga0a205_182274_c1 nmdc:mga0a205_182274_c1_142_657 171
66 3300050515 nmdc:mga0a205_287626_c1 nmdc:mga0a205_287626_c1_362_877 171
67 3300053151 Ga0500604_0011341 Ga0500604_0011341_585_1103 171
68 3300053153 Ga0500616_0001343 Ga0500616_0001343_17207_17725 171
69 3300053158 Ga0500627_0158974 Ga0500627_0158974_260_778 171
70 3300005329 Ga0070683_100316569 Ga0070683_1003165693 172
71 3300005347 Ga0070668_100089355 Ga0070668_1000893553 172
72 3300005440 Ga0070705_100020686 Ga0070705_1000206863 172
73 3300005535 Ga0070684_100523723 Ga0070684_1005237232 172
74 3300005546 Ga0070696_100203648 Ga0070696_1002036481 172
75 3300009098 Ga0105245_11593289 Ga0105245_115932892 172
76 3300009148 Ga0105243_10016689 Ga0105243_100166894 172
77 3300009176 Ga0105242_10297611 Ga0105242_102976112 172
78 3300009551 Ga0105238_10037839 Ga0105238_100378395 172
79 3300009553 Ga0105249_10535236 Ga0105249_105352362 172
80 3300010375 Ga0105239_10359283 Ga0105239_103592833 172
81 3300011119 Ga0105246_10214091 Ga0105246_102140912 172
82 3300013297 Ga0157378_10031377 Ga0157378_100313773 172
83 3300013306 Ga0163162_10157520 Ga0163162_101575202 172
84 3300013307 Ga0157372_11477622 Ga0157372_114776221 172
85 3300014326 Ga0157380_10050189 Ga0157380_100501893 172
86 3300017792 Ga0163161_10201317 Ga0163161_102013173 172
87 3300020082 Ga0206353_10789076 Ga0206353_107890762 172
88 3300025899 Ga0207642_10339587 Ga0207642_103395872 172
89 3300025924 Ga0207694_10401038 Ga0207694_104010382 172
90 3300025924 Ga0207694_10616087 Ga0207694_106160871 172
91 3300025932 Ga0207690_10461126 Ga0207690_104611261 172
92 3300025932 Ga0207690_10634666 Ga0207690_106346661 172
93 3300025935 Ga0207709_10925513 Ga0207709_109255131 172
94 3300025944 Ga0207661_10205829 Ga0207661_102058292 172
95 3300025945 Ga0207679_10374170 Ga0207679_103741702 172
96 3300025972 Ga0207668_10041772 Ga0207668_100417724 172
97 3300026121 Ga0207683_10383638 Ga0207683_103836382 172
98 3300035086 Ga0373934_0043454 Ga0373934_0043454_822_1340 172
99 3300035691 Ga0373931_0242450 Ga0373931_0242450_435_953 172
100 3300036401 Ga0373937_0123737 Ga0373937_0123737_768_1286 172
101 3300038443 Ga0395901_0612513 Ga0395901_0612513_514_1056 172
102 3300046514 Ga0495618_0433596 Ga0495618_0433596_252_770 172
103 3300046533 Ga0495640_0334340 Ga0495640_0334340_135_671 172
104 3300046536 Ga0495587_0170889 Ga0495587_0170889_497_1015 172
105 3300046642 Ga0495634_0265504 Ga0495634_0265504_291_809 172
106 3300047317 Ga0495604_0178122 Ga0495604_0178122_745_1263 172
107 3300047444 Ga0495675_0464311 Ga0495675_0464311_60_578 172
108 3300048916 Ga0496113_0480864 Ga0496113_0480864_239_757 172
109 3300049584 Ga0501068_0247857 Ga0501068_0247857_352_870 172
110 3300053078 Ga0495612_0282834 Ga0495612_0282834_129_710 172
111 3300053085 Ga0495619_0013899 Ga0495619_0013899_2900_3418 172
112 3300005347 Ga0070668_100051598 Ga0070668_1000515983 173
113 3300005578 Ga0068854_100622623 Ga0068854_1006226232 173
114 3300009147 Ga0114129_10043167 Ga0114129_100431673 173
115 3300025911 Ga0207654_10272245 Ga0207654_102722452 173
116 3300025935 Ga0207709_10048087 Ga0207709_100480874 173
117 3300025937 Ga0207669_10295537 Ga0207669_102955372 173
118 3300025961 Ga0207712_10213420 Ga0207712_102134202 173
119 3300025981 Ga0207640_10845585 Ga0207640_108455852 173
120 3300026089 Ga0207648_10165029 Ga0207648_101650292 173
121 3300026118 Ga0207675_100029695 Ga0207675_1000296955 173
122 3300028380 Ga0268265_10075636 Ga0268265_100756363 173
123 3300035085 Ga0373929_0069202 Ga0373929_0069202_194_715 173
124 3300035398 Ga0316574_0079447 Ga0316574_0079447_569_1093 173
125 3300036647 Ga0316582_0004554 Ga0316582_0004554_4480_5004 173
126 3300036712 Ga0316584_0000644 Ga0316584_0000644_12575_13099 173
127 3300037588 Ga0316581_0000290 Ga0316581_0000290_7592_8116 173
128 3300042436 Ga0439435_0055266 Ga0439435_0055266_473_994 173
129 3300046517 Ga0495630_0424437 Ga0495630_0424437_440_964 173
130 3300048916 Ga0496113_0231393 Ga0496113_0231393_352_876 173
131 3300050507 nmdc:mga05p37_424716_c1 nmdc:mga05p37_424716_c1_727_1248 173
132 3300050515 nmdc:mga0a205_94799_c2 nmdc:mga0a205_94799_c2_90_611 173
133 iso_pu_bacteria 8055632911 8055635101 173
134 3300005367 Ga0070667_100686538 Ga0070667_1006865381 174
135 3300009147 Ga0114129_10931968 Ga0114129_109319682 175
136 3300031727 Ga0316576_10000047 Ga0316576_100000478 175
137 3300031727 Ga0316576_10006863 Ga0316576_100068636 175
138 3300031727 Ga0316576_10789140 Ga0316576_107891401 175
139 3300031728 Ga0316578_10000940 Ga0316578_100009407 175
140 3300031728 Ga0316578_10297546 Ga0316578_102975462 175
141 3300031733 Ga0316577_10028248 Ga0316577_100282483 175
142 3300032133 Ga0316583_10001644 Ga0316583_100016443 175
143 3300032137 Ga0316585_10001443 Ga0316585_100014432 175
144 3300032139 Ga0316580_10003623 Ga0316580_100036233 175
145 3300044842 Ga0466957_0006416 Ga0466957_0006416_1318_1890 175
146 3300045836 Ga0466958_0104732 Ga0466958_0104732_647_1219 175
147 3300049653 Ga0501206_045506 Ga0501206_045506_122_655 175
148 3300050507 nmdc:mga05p37_405203_c1 nmdc:mga05p37_405203_c1_481_1008 175
149 3300050509 nmdc:mga0qj67_141710_c1 nmdc:mga0qj67_141710_c1_965_1510 175
150 3300050510 nmdc:mga06r32_122458_c1 nmdc:mga06r32_122458_c1_580_1125 175
151 3300050512 nmdc:mga0n895_3186_c1 nmdc:mga0n895_3186_c1_4834_5361 175
152 3300005293 Ga0065715_10183175 Ga0065715_101831752 176
153 3300005331 Ga0070670_100349363 Ga0070670_1003493632 176
154 3300005335 Ga0070666_10457968 Ga0070666_104579682 176
155 3300005337 Ga0070682_100037904 Ga0070682_1000379042 176
156 3300005364 Ga0070673_100564929 Ga0070673_1005649292 176
157 3300005445 Ga0070708_100385217 Ga0070708_1003852172 176
158 3300005549 Ga0070704_100398749 Ga0070704_1003987492 176
159 3300005719 Ga0068861_100291669 Ga0068861_1002916692 176
160 3300005840 Ga0068870_10228039 Ga0068870_102280392 176
161 3300005937 Ga0081455_10000773 Ga0081455_100007735 176
162 3300006844 Ga0075428_100901862 Ga0075428_1009018622 176
163 3300014326 Ga0157380_10975762 Ga0157380_109757622 176
164 3300025908 Ga0207643_10170552 Ga0207643_101705522 176
165 3300025923 Ga0207681_10486879 Ga0207681_104868791 176
166 3300025925 Ga0207650_10542010 Ga0207650_105420102 176
167 3300030742 Ga0316183_1087843 Ga0316183_10878433 176
168 3300030744 Ga0316181_1037279 Ga0316181_10372792 176
169 3300030745 Ga0316182_1092058 Ga0316182_10920582 176
170 3300031727 Ga0316576_10414476 Ga0316576_104144762 176
171 3300041413 Ga0439465_0190778 Ga0439465_0190778_112_693 176
172 3300041486 Ga0451807_2335560 Ga0451807_2335560_18_593 176
173 3300042004 Ga0439445_0008169 Ga0439445_0008169_899_1492 176
174 3300042004 Ga0439445_0026401 Ga0439445_0026401_866_1459 176
175 3300042006 Ga0439432_016822 Ga0439432_016822_1087_1680 176
176 3300042156 Ga0439446_0106578 Ga0439446_0106578_32_613 176
177 3300048905 Ga0496102_1328949 Ga0496102_1328949_72_602 176
178 3300049571 Ga0501034_0010551 Ga0501034_0010551_6146_6676 176
179 3300050510 nmdc:mga06r32_1586206_c1 nmdc:mga06r32_1586206_c1_30_575 176
180 iso_pu_bacteria 2925326138 2925326927 176
181 3300005367 Ga0070667_100463722 Ga0070667_1004637222 177
182 3300025986 Ga0207658_10166187 Ga0207658_101661873 177
183 3300041452 Ga0451793_1458501 Ga0451793_1458501_840_1391 177
184 3300041491 Ga0451833_0736545 Ga0451833_0736545_2798_3349 177
185 3300041494 Ga0451837_1116111 Ga0451837_1116111_274_825 177
186 3300041496 Ga0451839_0440467 Ga0451839_0440467_433_984 177
187 3300042006 Ga0439432_139011 Ga0439432_139011_44_640 177
188 3300046461 Ga0495641_0195350 Ga0495641_0195350_46_621 177
189 3300047319 Ga0495674_0593581 Ga0495674_0593581_68_643 177
190 3300048907 Ga0496104_0344585 Ga0496104_0344585_28_603 177
191 3300048908 Ga0496105_0132243 Ga0496105_0132243_1215_1790 177
192 3300048912 Ga0496109_0044270 Ga0496109_0044270_2058_2645 177
193 3300048913 Ga0496110_0032613 Ga0496110_0032613_1341_1928 177
194 3300049586 Ga0501070_0302871 Ga0501070_0302871_558_1160 177
195 3300050512 nmdc:mga0n895_1120929_c1 nmdc:mga0n895_1120929_c1_76_657 177
196 iso_pu_bacteria 2643221962 2645726711 177
197 3300005471 Ga0070698_100009315 Ga0070698_1000093156 178
198 3300005616 Ga0068852_100199225 Ga0068852_1001992253 178
199 3300005843 Ga0068860_101353993 Ga0068860_1013539931 178
200 3300005844 Ga0068862_100039218 Ga0068862_1000392184 178
201 3300006844 Ga0075428_100000215 Ga0075428_1000002157 178
202 3300025944 Ga0207661_10155904 Ga0207661_101559042 178
203 3300026142 Ga0207698_10325555 Ga0207698_103255552 178
204 3300028380 Ga0268265_10017135 Ga0268265_100171352 178
205 3300041443 Ga0451789_0936328 Ga0451789_0936328_237_830 178
206 3300046683 Ga0495658_0315908 Ga0495658_0315908_98_709 178
207 3300049576 Ga0501040_0372533 Ga0501040_0372533_210_803 178
208 iso_pu_bacteria 2515154155 2515851125 178
209 iso_pu_bacteria 2675903058 2676474966 178
210 iso_pu_bacteria 2827628540 2827630866 178
211 3300006847 Ga0075431_100412098 Ga0075431_1004120981 179
212 3300006852 Ga0075433_10208739 Ga0075433_102087392 179
213 3300006871 Ga0075434_100091815 Ga0075434_1000918153 179
214 3300005459 Ga0068867_100656366 Ga0068867_1006563662 180
215 3300006852 Ga0075433_10719708 Ga0075433_107197081 181
216 3300005293 Ga0065715_10130182 Ga0065715_101301822 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

23

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.9574 1 183
1xz8-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, nucleotide-bound form 0.9519 2 183
4p81-assembly1.cif.gz_C structure of ancestral pyrr protein (ancorangepyrr) 0.9495 3 183
1ufr-assembly2.cif.gz_D crystal structure of tt1027 from thermus thermophilus hb8 0.9405 1 183
4p81-assembly1.cif.gz_D structure of ancestral pyrr protein (ancorangepyrr) 0.9359 1 183
ID Description Score Start End Superfamily
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9034 1 183 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8956 2 181 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8934 1 183 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8451 2 181 3.40.50.2020
5ipfC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8192 3 158 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3N5P8R1-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9725 1 185 GO:0004845
GO:0006355
AF-A0A522T6L2-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9675 1 183 GO:0004845
GO:0006355
AF-A0A3N5P8R1-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9672 1 185 GO:0004845
GO:0006355
AF-A0A6A7L5P5-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9663 2 186 GO:0004845
GO:0006355
AF-A0A328FGI6-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9654 2 181 GO:0004845
GO:0006355

Feature Viewer

pLDDT pTM Quality
85.62 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map