F328286

General Info

Members Datasets Scaffolds Average Seq Length
217 161 434 331

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10001354|JGI25407J50210_100013544
Length 379
Sequence MDLVQLEQRLAARGEPGFRARQVWEWAARGAGSYGVMTNLPRQLRERLSEELPFSSLQPVRGALASDGTEKALFMTADGRPLEAVLMRYRDGRRSLCLSSQSGCPLTCTFCATGRMRFGRNLTVSEILDQALHFRRREAVNHAVFMGMGEPLMNLDAVLGACERLPDVGIAHSNIGVSTVGWIPGIDRMASEGPPVRLALSVHAADEALRSELMPVNDRYPLRDVLDACLRWHDRRRRQVFIEYLMLDGVNDRYEQALALAGLLQPRHAFKVNLIPYNPTDAPYRGSGRQAILAFRSALEERGLRTTVRVTRGRDIDAACGQLAAMDSTXXVKXSRXXCGGRPSPGAWDGXRSFARXRXSPRXXACRSRGRQSASSSSA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 10.14
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001354 3300003373 Bacteria 5533
2 JGI24740J21852_10008774 3300001979 Bacteria 4009
3 JGI24748J21848_1000525 3300002074 Bacteria 4183
4 JGI24034J26672_10000223 3300002239 Bacteria 7459
5 JGI24742J22300_10001124 3300002244 Bacteria 4147
6 Ga0070676_10120617 3300005328 Bacteria 1645
7 Ga0070666_10050112 3300005335 Bacteria 2808
8 Ga0070680_100014741 3300005336 Bacteria 6114
9 Ga0070660_100009725 3300005339 Bacteria 6777
10 Ga0070691_10003684 3300005341 Bacteria 6922
11 Ga0070661_100078126 3300005344 Bacteria 2441
12 Ga0070668_100016308 3300005347 Bacteria 5555
13 Ga0070674_100000001 3300005356 Bacteria 277173
14 Ga0070659_100054639 3300005366 Bacteria 3145
15 Ga0070659_100062383 3300005366 Bacteria 2946
16 Ga0070667_100020328 3300005367 Bacteria 5511
17 Ga0070714_100296272 3300005435 Bacteria 1507
18 Ga0070713_100073917 3300005436 Bacteria 2887
19 Ga0070713_100254299 3300005436 Bacteria 1603
20 Ga0070711_100088038 3300005439 Bacteria 2231
21 Ga0070700_100021749 3300005441 Bacteria 3732
22 Ga0070681_10003720 3300005458 Bacteria 14315
23 Ga0068867_100000454 3300005459 Bacteria 27165
24 Ga0070685_10050754 3300005466 Bacteria 2397
25 Ga0070679_100000365 3300005530 Bacteria 38496
26 Ga0070679_100076150 3300005530 Bacteria 3345
27 Ga0070684_100023154 3300005535 Bacteria 5189
28 Ga0070684_100062195 3300005535 Bacteria 3270
29 Ga0070704_100152858 3300005549 Bacteria 1816
30 Ga0068857_100137598 3300005577 Bacteria 2206
31 Ga0068856_100026696 3300005614 Bacteria 5631
32 Ga0068852_100006908 3300005616 Bacteria 8253
33 Ga0068852_100124213 3300005616 Bacteria 2367
34 Ga0068861_100002823 3300005719 Bacteria 11419
35 Ga0068861_100154161 3300005719 Bacteria 1888
36 Ga0068851_10106377 3300005834 Bacteria 1494
37 Ga0081455_10045369 3300005937 Bacteria 3824
38 Ga0081455_10054045 3300005937 Bacteria 3426
39 Ga0081455_10208636 3300005937 Bacteria 1457
40 Ga0081538_10000386 3300005981 Bacteria 50093
41 Ga0081538_10001446 3300005981 Bacteria 24414
42 Ga0081538_10018097 3300005981 Bacteria 5313
43 Ga0081538_10025327 3300005981 Bacteria 4187
44 Ga0081538_10078053 3300005981 Bacteria 1779
45 Ga0081538_10109498 3300005981 Bacteria 1361
46 Ga0081539_10002710 3300005985 Bacteria 24018
47 Ga0070717_10127699 3300006028 Bacteria 2184
48 Ga0075364_10049991 3300006051 Bacteria 2728
49 Ga0070712_100003544 3300006175 Bacteria 9611
50 Ga0075428_100008397 3300006844 Bacteria 11449
51 Ga0075428_100015609 3300006844 Bacteria 8419
52 Ga0075428_100467008 3300006844 Bacteria 1351
53 Ga0075430_100002217 3300006846 Bacteria 16112
54 Ga0075430_100176253 3300006846 Bacteria 1779
55 Ga0075431_100003273 3300006847 Bacteria 15676
56 Ga0105240_10245106 3300009093 Bacteria 2075
57 Ga0111539_10006256 3300009094 Bacteria 15368
58 Ga0111539_10399886 3300009094 Bacteria 1600
59 Ga0105245_10005283 3300009098 Bacteria 11343
60 Ga0105247_10000369 3300009101 Bacteria 38254
61 Ga0114129_10000941 3300009147 Bacteria 38048
62 Ga0114129_10001284 3300009147 Bacteria 33454
63 Ga0105243_10093027 3300009148 Bacteria 2487
64 Ga0105242_10004096 3300009176 Bacteria 11332
65 Ga0105242_10062585 3300009176 Bacteria 3062
66 Ga0105237_10043315 3300009545 Bacteria 4535
67 Ga0105238_10073626 3300009551 Bacteria 3410
68 Ga0105239_10037595 3300010375 Bacteria 5304
69 Ga0105239_10206739 3300010375 Bacteria 2200
70 Ga0157370_10059482 3300013104 Bacteria 3631
71 Ga0157369_10019004 3300013105 Bacteria 7695
72 Ga0157378_10088642 3300013297 Bacteria 2808
73 Ga0163162_10485860 3300013306 Bacteria 1366
74 Ga0157372_10022669 3300013307 Bacteria 6796
75 Ga0157375_10000194 3300013308 Bacteria 56860
76 Ga0163161_10103533 3300017792 Bacteria 2121
77 Ga0163161_10144331 3300017792 Bacteria 1804
78 Ga0206356_10451311 3300020070 Bacteria 2085
79 Ga0206353_11215997 3300020082 Bacteria 9720
80 Ga0207642_10000066 3300025899 Bacteria 28858
81 Ga0207680_10006474 3300025903 Bacteria 5662
82 Ga0207680_10039094 3300025903 Bacteria 2750
83 Ga0207707_10249811 3300025912 Bacteria 1541
84 Ga0207695_10175275 3300025913 Bacteria 2067
85 Ga0207693_10000327 3300025915 Bacteria 43947
86 Ga0207660_10018926 3300025917 Bacteria 4599
87 Ga0207662_10079443 3300025918 Bacteria 1998
88 Ga0207657_10086591 3300025919 Bacteria 2622
89 Ga0207657_10175299 3300025919 Bacteria 1736
90 Ga0207652_10000536 3300025921 Bacteria 38532
91 Ga0207652_10004122 3300025921 Bacteria 11863
92 Ga0207694_10078361 3300025924 Bacteria 2590
93 Ga0207700_10111067 3300025928 Bacteria 2206
94 Ga0207700_10325410 3300025928 Bacteria 1333
95 Ga0207706_10001715 3300025933 Bacteria 21601
96 Ga0207686_10002926 3300025934 Bacteria 9198
97 Ga0207686_10034027 3300025934 Bacteria 3047
98 Ga0207669_10000002 3300025937 Bacteria 377651
99 Ga0207689_10356857 3300025942 Bacteria 1215
100 Ga0207679_10116395 3300025945 Bacteria 2119
101 Ga0207712_10045306 3300025961 Bacteria 3045
102 Ga0207668_10011009 3300025972 Bacteria 5485
103 Ga0207640_10000669 3300025981 Bacteria 19997
104 Ga0207640_10199284 3300025981 Bacteria 1516
105 Ga0207658_10131603 3300025986 Bacteria 2010
106 Ga0207639_10011058 3300026041 Bacteria 6260
107 Ga0207708_10031129 3300026075 Bacteria 4049
108 Ga0207702_10028772 3300026078 Bacteria 4621
109 Ga0207648_10009090 3300026089 Bacteria 9553
110 Ga0207648_10036925 3300026089 Bacteria 4304
111 Ga0207674_10069889 3300026116 Bacteria 3530
112 Ga0207675_100000091 3300026118 Bacteria 70559
113 Ga0207675_100201502 3300026118 Bacteria 1912
114 Ga0207428_10073977 3300027907 Bacteria 2672
115 Ga0268266_10001842 3300028379 Bacteria 23945
116 Ga0265322_10022851 3300028654 Bacteria 1789
117 Ga0265338_10005918 3300028800 Bacteria 15760
118 Ga0307405_10072357 3300031731 Bacteria 2222
119 Ga0307410_10027225 3300031852 Bacteria 3611
120 Ga0307407_10273219 3300031903 Bacteria 1167
121 Ga0307412_10219000 3300031911 Bacteria 1458
122 Ga0307409_100026398 3300031995 Bacteria 4095
123 Ga0307416_100020479 3300032002 Bacteria 4722
124 Ga0307415_100093353 3300032126 Bacteria 2185
125 Ga0307415_100293407 3300032126 Bacteria 1343
126 Ga0373924_0080502 3300035410 Bacteria 1385
127 Ga0395900_0003892 3300037418 Bacteria 15948
128 Ga0395898_0001796 3300037466 Bacteria 27829
129 Ga0395898_0100773 3300037466 Bacteria 2774
130 Ga0395901_0033915 3300038443 Bacteria 5271
131 Ga0436362_0853693 3300039453 Bacteria 2084
132 Ga0466961_0024768 3300044693 Bacteria 3860
133 Ga0466963_0000051 3300044694 Bacteria 39254
134 Ga0466963_0019839 3300044694 Bacteria 4222
135 Ga0466963_0041992 3300044694 Bacteria 3001
136 Ga0466963_0045456 3300044694 Bacteria 2892
137 Ga0466971_0006539 3300044719 Bacteria 5066
138 Ga0466957_0030348 3300044842 Bacteria 3227
139 Ga0466959_0077039 3300045049 Bacteria 2407
140 Ga0466958_0002352 3300045836 Bacteria 9457
141 Ga0466958_0052948 3300045836 Bacteria 2461
142 Ga0466958_0201336 3300045836 Bacteria 1267
143 Ga0495651_0037630 3300046462 Bacteria 3767
144 Ga0495653_0009192 3300046463 Bacteria 8081
145 Ga0495582_0000002 3300046473 Bacteria 219909
146 Ga0495594_0000001 3300046499 Bacteria 293051
147 Ga0495608_0011579 3300046511 Bacteria 6136
148 Ga0495608_0016368 3300046511 Bacteria 5130
149 Ga0495628_0020204 3300046516 Bacteria 5497
150 Ga0495628_0142600 3300046516 Bacteria 1828
151 Ga0495632_0106864 3300046519 Bacteria 1316
152 Ga0495652_0038557 3300046529 Bacteria 4139
153 Ga0495652_0144314 3300046529 Bacteria 1868
154 Ga0495586_0001516 3300046535 Bacteria 12833
155 Ga0495587_0073396 3300046536 Bacteria 1988
156 Ga0495645_0145201 3300046543 Bacteria 1653
157 Ga0495622_0000033 3300046557 Bacteria 124162
158 Ga0495634_0001282 3300046642 Bacteria 23024
159 Ga0495635_0014166 3300046663 Bacteria 5580
160 Ga0495657_0030734 3300046675 Bacteria 3758
161 Ga0495658_0000001 3300046683 Bacteria 385362
162 Ga0495600_0007842 3300046809 Bacteria 6538
163 Ga0495604_0008147 3300047317 Bacteria 8295
164 Ga0495680_0027210 3300047322 Bacteria 4701
165 Ga0495675_0116957 3300047444 Bacteria 1662
166 Ga0495686_0002378 3300047472 Bacteria 17896
167 Ga0495602_0011926 3300048088 Bacteria 8961
168 Ga0495602_0239281 3300048088 Bacteria 1359
169 Ga0496100_0109839 3300048903 Bacteria 1914
170 Ga0496101_0039256 3300048904 Bacteria 3366
171 Ga0496104_0025996 3300048907 Bacteria 5399
172 Ga0496104_0036029 3300048907 Bacteria 4622
173 Ga0496105_0003630 3300048908 Bacteria 11467
174 Ga0496105_0082947 3300048908 Bacteria 2648
175 Ga0496107_0048319 3300048910 Bacteria 3065
176 Ga0496107_0082946 3300048910 Bacteria 2337
177 Ga0496108_0024430 3300048911 Bacteria 4975
178 Ga0496108_0246245 3300048911 Bacteria 1555
179 Ga0496108_0285490 3300048911 Bacteria 1437
180 Ga0496109_0000881 3300048912 Bacteria 25056
181 Ga0496109_0109420 3300048912 Bacteria 2568
182 Ga0496109_0460938 3300048912 Bacteria 1200
183 Ga0496110_0074472 3300048913 Bacteria 3015
184 Ga0496111_0005068 3300048914 Bacteria 8378
185 Ga0496112_0000641 3300048915 Bacteria 24272
186 Ga0496112_0010854 3300048915 Bacteria 8288
187 Ga0496112_0021332 3300048915 Bacteria 6159
188 Ga0496112_0084655 3300048915 Bacteria 3136
189 Ga0496112_0125145 3300048915 Bacteria 2541
190 Ga0496113_0000002 3300048916 Bacteria 220193
191 Ga0496116_0000138 3300048919 Bacteria 151606
192 Ga0496119_0004068 3300048922 Bacteria 14751
193 Ga0496124_0076213 3300048927 Bacteria 2769
194 Ga0501031_0205677 3300049568 Bacteria 1284
195 Ga0501038_0189223 3300049574 Bacteria 1657
196 Ga0501042_0300625 3300049578 Bacteria 1159
197 Ga0501047_0033195 3300049581 Bacteria 4982
198 Ga0501069_0062413 3300049585 Bacteria 2081
199 Ga0501070_0024812 3300049586 Bacteria 5028
200 Ga0501072_0120854 3300049588 Bacteria 2087
201 Ga0501080_0278800 3300049742 Bacteria 1520
202 Ga0501083_0006427 3300049744 Bacteria 8334
203 nmdc:mga0yw44_180928_c1 3300050492 Bacteria 1387
204 nmdc:mga09592_296462_c1 3300050508 Bacteria 1402
205 nmdc:mga0qj67_112887_c1 3300050509 Bacteria 2194
206 nmdc:mga0qj67_20487_c1 3300050509 Bacteria 5064
207 nmdc:mga06r32_427173_c1 3300050510 Bacteria 1306
208 nmdc:mga06r32_4342_c1 3300050510 Bacteria 12687
209 nmdc:mga08y16_246104_c1 3300050511 Bacteria 1848
210 nmdc:mga08y16_328889_c1 3300050511 Bacteria 1573
211 nmdc:mga08y16_39151_c1 3300050511 Bacteria 4974
212 Ga0495601_0016346 3300053077 Bacteria 4496
213 Ga0495655_0001411 3300053083 Bacteria 3686
214 Ga0495619_0009001 3300053085 Bacteria 6300
215 Ga0495619_0253624 3300053085 Bacteria 1219
216 Ga0466962_0004305 3300061719 Bacteria 6825
217 Ga0530510_0018039 3300061734 Bacteria 5003
218 JGI25407J50210_10001354
219 JGI24740J21852_10008774
220 JGI24748J21848_1000525
221 JGI24034J26672_10000223
222 JGI24742J22300_10001124
223 Ga0070676_10120617
224 Ga0070666_10050112
225 Ga0070680_100014741
226 Ga0070660_100009725
227 Ga0070691_10003684
228 Ga0070661_100078126
229 Ga0070668_100016308
230 Ga0070674_100000001
231 Ga0070659_100054639
232 Ga0070659_100062383
233 Ga0070667_100020328
234 Ga0070714_100296272
235 Ga0070713_100073917
236 Ga0070713_100254299
237 Ga0070711_100088038
238 Ga0070700_100021749
239 Ga0070681_10003720
240 Ga0068867_100000454
241 Ga0070685_10050754
242 Ga0070679_100000365
243 Ga0070679_100076150
244 Ga0070684_100023154
245 Ga0070684_100062195
246 Ga0070704_100152858
247 Ga0068857_100137598
248 Ga0068856_100026696
249 Ga0068852_100006908
250 Ga0068852_100124213
251 Ga0068861_100002823
252 Ga0068861_100154161
253 Ga0068851_10106377
254 Ga0081455_10045369
255 Ga0081455_10054045
256 Ga0081455_10208636
257 Ga0081538_10000386
258 Ga0081538_10001446
259 Ga0081538_10018097
260 Ga0081538_10025327
261 Ga0081538_10078053
262 Ga0081538_10109498
263 Ga0081539_10002710
264 Ga0070717_10127699
265 Ga0075364_10049991
266 Ga0070712_100003544
267 Ga0075428_100008397
268 Ga0075428_100015609
269 Ga0075428_100467008
270 Ga0075430_100002217
271 Ga0075430_100176253
272 Ga0075431_100003273
273 Ga0105240_10245106
274 Ga0111539_10006256
275 Ga0111539_10399886
276 Ga0105245_10005283
277 Ga0105247_10000369
278 Ga0114129_10000941
279 Ga0114129_10001284
280 Ga0105243_10093027
281 Ga0105242_10004096
282 Ga0105242_10062585
283 Ga0105237_10043315
284 Ga0105238_10073626
285 Ga0105239_10037595
286 Ga0105239_10206739
287 Ga0157370_10059482
288 Ga0157369_10019004
289 Ga0157378_10088642
290 Ga0163162_10485860
291 Ga0157372_10022669
292 Ga0157375_10000194
293 Ga0163161_10103533
294 Ga0163161_10144331
295 Ga0206356_10451311
296 Ga0206353_11215997
297 Ga0207642_10000066
298 Ga0207680_10006474
299 Ga0207680_10039094
300 Ga0207707_10249811
301 Ga0207695_10175275
302 Ga0207693_10000327
303 Ga0207660_10018926
304 Ga0207662_10079443
305 Ga0207657_10086591
306 Ga0207657_10175299
307 Ga0207652_10000536
308 Ga0207652_10004122
309 Ga0207694_10078361
310 Ga0207700_10111067
311 Ga0207700_10325410
312 Ga0207706_10001715
313 Ga0207686_10002926
314 Ga0207686_10034027
315 Ga0207669_10000002
316 Ga0207689_10356857
317 Ga0207679_10116395
318 Ga0207712_10045306
319 Ga0207668_10011009
320 Ga0207640_10000669
321 Ga0207640_10199284
322 Ga0207658_10131603
323 Ga0207639_10011058
324 Ga0207708_10031129
325 Ga0207702_10028772
326 Ga0207648_10009090
327 Ga0207648_10036925
328 Ga0207674_10069889
329 Ga0207675_100000091
330 Ga0207675_100201502
331 Ga0207428_10073977
332 Ga0268266_10001842
333 Ga0265322_10022851
334 Ga0265338_10005918
335 Ga0307405_10072357
336 Ga0307410_10027225
337 Ga0307407_10273219
338 Ga0307412_10219000
339 Ga0307409_100026398
340 Ga0307416_100020479
341 Ga0307415_100093353
342 Ga0307415_100293407
343 Ga0373924_0080502
344 Ga0395900_0003892
345 Ga0395898_0001796
346 Ga0395898_0100773
347 Ga0395901_0033915
348 Ga0436362_0853693
349 Ga0466961_0024768
350 Ga0466963_0000051
351 Ga0466963_0019839
352 Ga0466963_0041992
353 Ga0466963_0045456
354 Ga0466971_0006539
355 Ga0466957_0030348
356 Ga0466959_0077039
357 Ga0466958_0002352
358 Ga0466958_0052948
359 Ga0466958_0201336
360 Ga0495651_0037630
361 Ga0495653_0009192
362 Ga0495582_0000002
363 Ga0495594_0000001
364 Ga0495608_0011579
365 Ga0495608_0016368
366 Ga0495628_0020204
367 Ga0495628_0142600
368 Ga0495632_0106864
369 Ga0495652_0038557
370 Ga0495652_0144314
371 Ga0495586_0001516
372 Ga0495587_0073396
373 Ga0495645_0145201
374 Ga0495622_0000033
375 Ga0495634_0001282
376 Ga0495635_0014166
377 Ga0495657_0030734
378 Ga0495658_0000001
379 Ga0495600_0007842
380 Ga0495604_0008147
381 Ga0495680_0027210
382 Ga0495675_0116957
383 Ga0495686_0002378
384 Ga0495602_0011926
385 Ga0495602_0239281
386 Ga0496100_0109839
387 Ga0496101_0039256
388 Ga0496104_0025996
389 Ga0496104_0036029
390 Ga0496105_0003630
391 Ga0496105_0082947
392 Ga0496107_0048319
393 Ga0496107_0082946
394 Ga0496108_0024430
395 Ga0496108_0246245
396 Ga0496108_0285490
397 Ga0496109_0000881
398 Ga0496109_0109420
399 Ga0496109_0460938
400 Ga0496110_0074472
401 Ga0496111_0005068
402 Ga0496112_0000641
403 Ga0496112_0010854
404 Ga0496112_0021332
405 Ga0496112_0084655
406 Ga0496112_0125145
407 Ga0496113_0000002
408 Ga0496116_0000138
409 Ga0496119_0004068
410 Ga0496124_0076213
411 Ga0501031_0205677
412 Ga0501038_0189223
413 Ga0501042_0300625
414 Ga0501047_0033195
415 Ga0501069_0062413
416 Ga0501070_0024812
417 Ga0501072_0120854
418 Ga0501080_0278800
419 Ga0501083_0006427
420 nmdc:mga0yw44_180928_c1
421 nmdc:mga09592_296462_c1
422 nmdc:mga0qj67_112887_c1
423 nmdc:mga0qj67_20487_c1
424 nmdc:mga06r32_427173_c1
425 nmdc:mga06r32_4342_c1
426 nmdc:mga08y16_246104_c1
427 nmdc:mga08y16_328889_c1
428 nmdc:mga08y16_39151_c1
429 Ga0495601_0016346
430 Ga0495655_0001411
431 Ga0495619_0009001
432 Ga0495619_0253624
433 Ga0466962_0004305
434 Ga0530510_0018039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21016

RlmN_N

Ribosomal RNA large subunit methyltransferase N-terminal domain

1

53

0.93

PF04055

Radical_SAM

Radical SAM superfamily

98

261

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fz6-assembly2.cif.gz_B crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus 0.8881 1 318
3rfa-assembly1.cif.gz_B x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.8634 3 320
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.8627 3 309
6fz6-assembly2.cif.gz_B crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus 0.8559 1 318
5hr6-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli 0.8556 7 318
ID Description Score Start End Superfamily
af_A0A0R0LFU5_57_140_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9643 194 261 3.20.20.70
af_A0A1D6FPJ6_15_105_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9539 163 247 3.20.20.70
af_Q2FZ66_80_363_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9148 54 325 3.20.20.70
af_F4IVY6_128_412_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9138 56 318 3.20.20.70
af_A0A1D6G0E0_114_393_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9078 55 318 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1LFG7-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN 0.9689 1 99 GO:0008168
GO:0030488
GO:0051539
GO:0070475
AF-A0A538CUA9-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN 0.9585 1 308 GO:0005737
GO:0008173
GO:0030488
GO:0046872
GO:0051539
GO:0070475
AF-A0A4U3AZC1-F1-model_v4 deleted 0.9571 154 271
AF-A0A2T4UD74-F1-model_v4 Probable dual-specificity RNA methyltransferase RlmN (EC 2.1.1.192) (23S rRNA (adenine(2503)-C(2))-methyltransferase) (23S rRNA m2A2503 methyltransferase) (Ribosomal RNA large subunit methyltransferase N) (tRNA (adenine(37)-C(2))-methyltransferase) (tRNA m2A37 methyltransferase) 0.9515 1 321 GO:0000049
GO:0002935
GO:0005737
GO:0019843
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A538CUA9-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN 0.9495 1 308 GO:0005737
GO:0008173
GO:0030488
GO:0046872
GO:0051539
GO:0070475

Map