F328304

General Info

Members Datasets Scaffolds Average Seq Length
217 140 206 383

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10010124|Ga0055530_100101242
Length 455
Sequence MNSGPRELGGRLSTVPREWTIAPHIIATECPQTAGQADCRSCTLPHVGLAQPHAMAGQTAPEVLQKIFMNVEHSFPSDTDTAASPSALSQWIKKRRWFIVFVIVPTALAALYYGLFASDIYVSESRFVIKSPDQKRSQLSSLANLIQTTGLSGGQEQANEVLDFVRSRDALKALEKTPGFRARYASHEVDYLSRFPQPLNDDSFEDLYKFYGKQVDAQLDTETGTSIIKVKAFTAQDAYVVNRRLLELSEGLVNRLNDRIRTRAISEAQRQVDLATNRAKAARVALAQYRNSQELIDPAKQAGGVLEISNGLIAQRAALQAQLDQMRRVAPGNPSIPALQNRVNAISGQIGAQDSRVVGSKGGIASKLGGYENLLVEQEFATENLNVANAALVQSRADAQRQQYYLERVVEPNLPDMPLLPRRLLDIIIVAAVATCLYFIGWMLVVGILEHAPDE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
3 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
4 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
5 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
6 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
9 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
10 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
11 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
12 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
133 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
138 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.46
Isolates 5.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 6.45
Rhizosphere 74.19
Stem 0
Stem Tuber 0
Unclassified 15.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2292987 2162886007 Bacteria 31145
2 SwRhRL2b_contig_3090221 2162886007 Bacteria 17808
3 SwRhRL2b_contig_3383716 2162886007 Bacteria 3656
4 JGI24752J21851_1000086 3300001976 Bacteria 12364
5 JGI24739J22299_10001840 3300001989 Bacteria 8088
6 JGI24737J22298_10009183 3300001990 Bacteria 3295
7 JGI24034J26672_10002186 3300002239 Bacteria 2665
8 Ga0055530_10010124 3300003791 Bacteria 3529
9 Ga0065704_10000277 3300005289 Bacteria 104842
10 Ga0065704_10001247 3300005289 Bacteria 22290
11 Ga0065704_10070346 3300005289 Bacteria 31193
12 Ga0065704_10073718 3300005289 Bacteria 6846
13 Ga0065707_10149917 3300005295 Bacteria 1670
14 Ga0070658_10000196 3300005327 Bacteria 53378
15 Ga0070658_10165777 3300005327 Unclassified 1855
16 Ga0070670_100000215 3300005331 Bacteria 53387
17 Ga0070666_10013523 3300005335 Bacteria 5180
18 Ga0070660_100000883 3300005339 Bacteria 20045
19 Ga0070668_100007830 3300005347 Bacteria 7935
20 Ga0070669_100000039 3300005353 Bacteria 135033
21 Ga0070671_100007512 3300005355 Bacteria 8713
22 Ga0070674_100000123 3300005356 Bacteria 35400
23 Ga0070659_100016215 3300005366 Bacteria 5591
24 Ga0070667_100000311 3300005367 Bacteria 54491
25 Ga0070667_100000719 3300005367 Bacteria 31865
26 Ga0070662_100054361 3300005457 Bacteria 2901
27 Ga0068853_100000755 3300005539 Bacteria 22437
28 Ga0068853_100002488 3300005539 Bacteria 13807
29 Ga0070665_100003111 3300005548 Bacteria 17877
30 Ga0068855_100050067 3300005563 Plasmid 4924
31 Ga0068857_100000856 3300005577 Bacteria 22822
32 Ga0068854_100001288 3300005578 Bacteria 15095
33 Ga0068854_100120350 3300005578 Bacteria 1992
34 Ga0068852_100068911 3300005616 Bacteria 3098
35 Ga0068852_100161410 3300005616 Unclassified 2093
36 Ga0068859_100421230 3300005617 Unclassified 1431
37 Ga0068864_100000080 3300005618 Bacteria 102508
38 Ga0068851_10065255 3300005834 Bacteria 1873
39 Ga0068863_100000087 3300005841 Bacteria 102508
40 Ga0068860_100029026 3300005843 Bacteria 5322
41 Ga0068862_100000101 3300005844 Bacteria 102508
42 Ga0068862_100010781 3300005844 Bacteria 7547
43 Ga0068862_100032334 3300005844 Bacteria 4420
44 Ga0075364_10053367 3300006051 Bacteria 2643
45 Ga0075364_10148852 3300006051 Bacteria 1577
46 Ga0097620_100421241 3300006931 Unclassified 1431
47 Ga0105251_10000248 3300009011 Bacteria 54567
48 Ga0105251_10001909 3300009011 Bacteria 17104
49 Ga0105251_10002935 3300009011 Bacteria 12782
50 Ga0105251_10013886 3300009011 Bacteria 4480
51 Ga0105250_10000748 3300009092 Bacteria 19742
52 Ga0105250_10001477 3300009092 Bacteria 12717
53 Ga0105250_10006791 3300009092 Bacteria 4970
54 Ga0105240_10062135 3300009093 Bacteria 4651
55 Ga0105240_10101719 3300009093 Bacteria 3494
56 Ga0105240_10131228 3300009093 Bacteria 3005
57 Ga0105248_10015635 3300009177 Bacteria 8365
58 Ga0105237_10009761 3300009545 Bacteria 10267
59 Ga0105238_10015201 3300009551 Bacteria 7794
60 Ga0105238_10028914 3300009551 Bacteria 5646
61 Ga0105238_10034514 3300009551 Bacteria 5146
62 Ga0105249_10000024 3300009553 Bacteria 232947
63 Ga0157373_10028050 3300013100 Bacteria 4062
64 Ga0157371_10003592 3300013102 Bacteria 13972
65 Ga0157371_10040325 3300013102 Bacteria 3335
66 Ga0157370_10010150 3300013104 Bacteria 9947
67 Ga0157370_10068120 3300013104 Bacteria 3364
68 Ga0157370_10164526 3300013104 Bacteria 2063
69 Ga0157369_10010023 3300013105 Bacteria 10823
70 Ga0157369_10116490 3300013105 Bacteria 2837
71 Ga0163162_10029816 3300013306 Bacteria 5401
72 Ga0157372_10007486 3300013307 Bacteria 11609
73 Ga0157379_10033358 3300014968 Bacteria 4591
74 Ga0163161_10007575 3300017792 Bacteria 7506
75 Ga0163161_10104995 3300017792 Unclassified 2107
76 Ga0163161_10210950 3300017792 Bacteria 1500
77 Ga0209050_1000860 3300025298 Bacteria 41075
78 Ga0207656_10001317 3300025321 Bacteria 8172
79 Ga0207656_10081919 3300025321 Unclassified 1452
80 Ga0207696_1001183 3300025711 Bacteria 14868
81 Ga0207696_1001475 3300025711 Bacteria 12725
82 Ga0207696_1005967 3300025711 Bacteria 4974
83 Ga0207713_1001574 3300025735 Bacteria 17889
84 Ga0207713_1002585 3300025735 Bacteria 13073
85 Ga0207713_1002972 3300025735 Bacteria 11847
86 Ga0207713_1004528 3300025735 Bacteria 8998
87 Ga0207680_10058241 3300025903 Bacteria 2341
88 Ga0207705_10000183 3300025909 Bacteria 65457
89 Ga0207705_10003164 3300025909 Bacteria 12524
90 Ga0207695_10039107 3300025913 Bacteria 5101
91 Ga0207695_10097702 3300025913 Bacteria 2937
92 Ga0207657_10000783 3300025919 Bacteria 33822
93 Ga0207681_10000144 3300025923 Bacteria 59200
94 Ga0207694_10019613 3300025924 Bacteria 5114
95 Ga0207694_10023835 3300025924 Bacteria 4647
96 Ga0207694_10206697 3300025924 Bacteria 1599
97 Ga0207650_10000261 3300025925 Bacteria 56610
98 Ga0207664_10079679 3300025929 Bacteria 2660
99 Ga0207644_10000640 3300025931 Bacteria 22180
100 Ga0207706_10002940 3300025933 Bacteria 16464
101 Ga0207706_10014667 3300025933 Bacteria 7096
102 Ga0207669_10000155 3300025937 Bacteria 32382
103 Ga0207667_10038970 3300025949 Bacteria 5067
104 Ga0207712_10000034 3300025961 Bacteria 202320
105 Ga0207640_10000660 3300025981 Bacteria 20197
106 Ga0207658_10000216 3300025986 Bacteria 60563
107 Ga0207658_10000239 3300025986 Bacteria 57662
108 Ga0207639_10000621 3300026041 Bacteria 24436
109 Ga0207639_10000721 3300026041 Bacteria 22595
110 Ga0207641_10000010 3300026088 Bacteria 402193
111 Ga0207676_10000036 3300026095 Bacteria 198447
112 Ga0207674_10001997 3300026116 Bacteria 25875
113 Ga0207698_10025849 3300026142 Bacteria 4144
114 Ga0207698_10284200 3300026142 Bacteria 1532
115 Ga0268266_10001825 3300028379 Bacteria 24081
116 Ga0268265_10000059 3300028380 Bacteria 152531
117 Ga0268265_10004977 3300028380 Bacteria 9124
118 Ga0268265_10017098 3300028380 Bacteria 4997
119 Ga0268264_10115345 3300028381 Bacteria 2360
120 Ga0307405_10000174 3300031731 Bacteria 23496
121 Ga0307406_10004487 3300031901 Bacteria 7600
122 Ga0307412_10000500 3300031911 Bacteria 23370
123 Ga0307414_10000935 3300032004 Bacteria 14921
124 Ga0395899_0037168 3300037312 Plasmid 3651
125 Ga0395900_0012806 3300037418 Bacteria 8573
126 Ga0395900_0015611 3300037418 Bacteria 7741
127 Ga0395900_0093843 3300037418 Unclassified 3082
128 Ga0395898_0045237 3300037466 Bacteria 4327
129 Ga0395898_0071789 3300037466 Plasmid 3345
130 Ga0395905_0013174 3300037471 Bacteria 7936
131 Ga0395905_0032999 3300037471 Plasmid 4867
132 Ga0395905_0236448 3300037471 Bacteria 1707
133 Ga0395901_0010596 3300038443 Bacteria 9339
134 Ga0395901_0019394 3300038443 Bacteria 6953
135 Ga0395901_0037743 3300038443 Plasmid 4996
136 Ga0466966_0001338 3300044684 Bacteria 15828
137 Ga0466971_0051672 3300044719 Unclassified 1850
138 Ga0466957_0116705 3300044842 Unclassified 1698
139 Ga0466959_0001553 3300045049 Bacteria 14121
140 Ga0495617_027562 3300046452 Bacteria 1911
141 Ga0495610_0000082 3300046512 Bacteria 113066
142 Ga0495610_0000243 3300046512 Bacteria 57521
143 Ga0495620_0003625 3300046515 Bacteria 8813
144 Ga0495620_0006903 3300046515 Bacteria 6204
145 Ga0495632_0005949 3300046519 Bacteria 7949
146 Ga0495633_0001488 3300046558 Bacteria 18170
147 Ga0495625_0000832 3300046660 Bacteria 42398
148 Ga0495625_0005992 3300046660 Bacteria 10923
149 Ga0495625_0022047 3300046660 Bacteria 4890
150 Ga0495671_0033259 3300046692 Bacteria 2628
151 Ga0495672_0038842 3300047320 Bacteria 2900
152 Ga0495683_0005724 3300047323 Bacteria 6855
153 Ga0495626_0001225 3300048091 Bacteria 21121
154 Ga0496100_0001143 3300048903 Bacteria 12894
155 Ga0496101_0004565 3300048904 Bacteria 8746
156 Ga0496101_0118565 3300048904 Unclassified 1999
157 Ga0496102_0000698 3300048905 Bacteria 33409
158 Ga0496103_0000258 3300048906 Bacteria 50941
159 Ga0496103_0019957 3300048906 Bacteria 4025
160 Ga0496104_0000675 3300048907 Bacteria 29310
161 Ga0496104_0017956 3300048907 Bacteria 6449
162 Ga0496105_0000184 3300048908 Bacteria 41790
163 Ga0496105_0003801 3300048908 Bacteria 11263
164 Ga0496108_0008596 3300048911 Bacteria 8279
165 Ga0496109_0040130 3300048912 Bacteria 4239
166 Ga0496112_0015723 3300048915 Bacteria 7068
167 Ga0496113_0001048 3300048916 Bacteria 14914
168 Ga0496116_0001606 3300048919 Bacteria 24832
169 Ga0496116_0004390 3300048919 Bacteria 13490
170 Ga0496116_0022738 3300048919 Bacteria 4689
171 Ga0496117_0001983 3300048920 Bacteria 27190
172 Ga0496117_0002815 3300048920 Bacteria 21183
173 Ga0496118_0000335 3300048921 Bacteria 80253
174 Ga0496118_0002186 3300048921 Bacteria 27190
175 Ga0496118_0071673 3300048921 Bacteria 2493
176 Ga0496118_0162308 3300048921 Unclassified 1379
177 Ga0496119_0001028 3300048922 Bacteria 35759
178 Ga0496120_0000961 3300048923 Bacteria 39309
179 Ga0496121_0006115 3300048924 Bacteria 15131
180 Ga0496121_0011024 3300048924 Bacteria 10087
181 Ga0496121_0012699 3300048924 Bacteria 9138
182 Ga0496122_0001573 3300048925 Bacteria 35934
183 Ga0496122_0002945 3300048925 Bacteria 23213
184 Ga0496122_0018975 3300048925 Bacteria 6310
185 Ga0496123_0000428 3300048926 Bacteria 75893
186 Ga0496123_0003956 3300048926 Bacteria 16060
187 Ga0496124_0001488 3300048927 Bacteria 34405
188 Ga0496124_0002149 3300048927 Bacteria 26478
189 Ga0496124_0014032 3300048927 Bacteria 7773
190 Ga0496125_0003189 3300048928 Bacteria 20284
191 Ga0496125_0004588 3300048928 Bacteria 15796
192 Ga0496125_0068786 3300048928 Bacteria 2783
193 Ga0496126_0000158 3300048929 Bacteria 156032
194 Ga0496126_0001697 3300048929 Bacteria 32726
195 Ga0496126_0225330 3300048929 Unclassified 1573
196 Ga0501335_000249 3300049551 Bacteria 3110
197 Ga0501034_0096797 3300049571 Bacteria 2947
198 Ga0501206_000989 3300049653 Bacteria 3538
199 Ga0501211_001069 3300049658 Bacteria 2893
200 Ga0501235_000092 3300049669 Bacteria 14201
201 Ga0501225_0002260 3300049705 Bacteria 5957
202 nmdc:mga00v17_133297_c1 3300050491 Bacteria 1589
203 nmdc:mga00v17_19848_c1 3300050491 Bacteria 3843
204 Ga0500624_000225 3300053157 Bacteria 20735
205 Ga0500636_0000126 3300053177 Bacteria 39974
206 Ga0466962_0033253 3300061719 Bacteria 2467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028381 Ga0268264_10115345 Ga0268264_101153453 316
2 3300009011 Ga0105251_10002935 Ga0105251_100029353 359
3 3300009092 Ga0105250_10001477 Ga0105250_100014779 359
4 3300025711 Ga0207696_1001475 Ga0207696_10014759 359
5 3300025735 Ga0207713_1002585 Ga0207713_10025859 359
6 3300049571 Ga0501034_0096797 Ga0501034_0096797_414_1598 359
7 3300005327 Ga0070658_10000196 Ga0070658_1000019611 361
8 3300005356 Ga0070674_100000123 Ga0070674_1000001239 361
9 3300005539 Ga0068853_100000755 Ga0068853_10000075514 361
10 3300005578 Ga0068854_100120350 Ga0068854_1001203502 361
11 3300026041 Ga0207639_10000721 Ga0207639_100007214 361
12 3300046660 Ga0495625_0000832 Ga0495625_0000832_30755_31924 361
13 3300047323 Ga0495683_0005724 Ga0495683_0005724_1603_2769 361
14 3300009545 Ga0105237_10009761 Ga0105237_100097614 363
15 3300025909 Ga0207705_10000183 Ga0207705_1000018315 363
16 3300025937 Ga0207669_10000155 Ga0207669_1000015524 363
17 3300013104 Ga0157370_10164526 Ga0157370_101645263 364
18 3300044684 Ga0466966_0001338 Ga0466966_0001338_5436_6599 364
19 3300045049 Ga0466959_0001553 Ga0466959_0001553_7142_8305 364
20 3300048091 Ga0495626_0001225 Ga0495626_0001225_9264_10427 366
21 3300048929 Ga0496126_0225330 Ga0496126_0225330_24_1184 366
22 3300002239 JGI24034J26672_10002186 JGI24034J26672_100021863 368
23 3300005289 Ga0065704_10000277 Ga0065704_1000027738 368
24 3300005335 Ga0070666_10013523 Ga0070666_100135232 368
25 3300005347 Ga0070668_100007830 Ga0070668_1000078305 368
26 3300005353 Ga0070669_100000039 Ga0070669_10000003978 368
27 3300005355 Ga0070671_100007512 Ga0070671_1000075124 368
28 3300005367 Ga0070667_100000719 Ga0070667_10000071924 368
29 3300005548 Ga0070665_100003111 Ga0070665_1000031116 368
30 3300005563 Ga0068855_100050067 Ga0068855_1000500675 368
31 3300005843 Ga0068860_100029026 Ga0068860_1000290263 368
32 3300005844 Ga0068862_100032334 Ga0068862_1000323343 368
33 3300025711 Ga0207696_1005967 Ga0207696_10059675 368
34 3300025735 Ga0207713_1002972 Ga0207713_10029728 368
35 3300025903 Ga0207680_10058241 Ga0207680_100582412 368
36 3300025923 Ga0207681_10000144 Ga0207681_1000014420 368
37 3300025931 Ga0207644_10000640 Ga0207644_100006407 368
38 3300025949 Ga0207667_10038970 Ga0207667_100389705 368
39 3300025986 Ga0207658_10000216 Ga0207658_1000021624 368
40 3300028379 Ga0268266_10001825 Ga0268266_100018258 368
41 3300028380 Ga0268265_10017098 Ga0268265_100170982 368
42 3300031731 Ga0307405_10000174 Ga0307405_1000017410 368
43 3300031901 Ga0307406_10004487 Ga0307406_100044874 368
44 3300031911 Ga0307412_10000500 Ga0307412_1000050014 368
45 3300046692 Ga0495671_0033259 Ga0495671_0033259_1389_2552 368
46 3300032004 Ga0307414_10000935 Ga0307414_1000093513 369
47 3300037312 Ga0395899_0037168 Ga0395899_0037168_2384_3547 370
48 3300037418 Ga0395900_0093843 Ga0395900_0093843_1710_2873 370
49 3300037466 Ga0395898_0071789 Ga0395898_0071789_841_2004 370
50 3300037471 Ga0395905_0032999 Ga0395905_0032999_2970_4133 370
51 3300038443 Ga0395901_0037743 Ga0395901_0037743_3099_4262 370
52 3300048907 Ga0496104_0017956 Ga0496104_0017956_431_1543 370
53 3300048908 Ga0496105_0003801 Ga0496105_0003801_9962_11074 370
54 3300048921 Ga0496118_0071673 Ga0496118_0071673_1359_2471 370
55 3300048924 Ga0496121_0012699 Ga0496121_0012699_4083_5195 370
56 3300025321 Ga0207656_10001317 Ga0207656_1000131711 371
57 3300005327 Ga0070658_10165777 Ga0070658_101657772 372
58 3300005616 Ga0068852_100068911 Ga0068852_1000689114 375
59 3300026142 Ga0207698_10025849 Ga0207698_100258491 375
60 3300047320 Ga0495672_0038842 Ga0495672_0038842_1731_2858 375
61 3300048912 Ga0496109_0040130 Ga0496109_0040130_1556_2719 375
62 iso_pu_bacteria 2738541275 2738711091 376
63 iso_pu_bacteria 2738541301 2738849516 376
64 iso_pu_bacteria 2738541304 2738865245 376
65 iso_pu_bacteria 2738543022 2739297763 376
66 iso_pu_bacteria 2738543033 2739359441 376
67 3300046558 Ga0495633_0001488 Ga0495633_0001488_6684_7847 379
68 3300005539 Ga0068853_100002488 Ga0068853_1000024882 380
69 3300005577 Ga0068857_100000856 Ga0068857_1000008568 380
70 3300009551 Ga0105238_10028914 Ga0105238_100289143 380
71 3300025924 Ga0207694_10206697 Ga0207694_102066972 380
72 3300026041 Ga0207639_10000621 Ga0207639_100006218 380
73 3300026116 Ga0207674_10001997 Ga0207674_100019978 380
74 3300046660 Ga0495625_0005992 Ga0495625_0005992_9471_10703 380
75 3300009093 Ga0105240_10101719 Ga0105240_101017194 381
76 3300013104 Ga0157370_10068120 Ga0157370_100681204 381
77 3300013105 Ga0157369_10010023 Ga0157369_1001002310 381
78 3300025913 Ga0207695_10039107 Ga0207695_100391074 381
79 3300025929 Ga0207664_10079679 Ga0207664_100796791 381
80 3300037466 Ga0395898_0045237 Ga0395898_0045237_2655_3818 381
81 3300037471 Ga0395905_0236448 Ga0395905_0236448_532_1695 381
82 3300038443 Ga0395901_0010596 Ga0395901_0010596_169_1332 381
83 3300037418 Ga0395900_0015611 Ga0395900_0015611_5595_6755 382
84 3300037471 Ga0395905_0013174 Ga0395905_0013174_3871_5031 382
85 3300038443 Ga0395901_0019394 Ga0395901_0019394_860_2020 382
86 3300044719 Ga0466971_0051672 Ga0466971_0051672_535_1698 382
87 3300044842 Ga0466957_0116705 Ga0466957_0116705_345_1508 382
88 3300061719 Ga0466962_0033253 Ga0466962_0033253_421_1584 382
89 iso_pu_bacteria 2919138771 2919138881 382
90 iso_pu_bacteria 2928100450 2928103703 382
91 iso_pu_bacteria 2928959182 2928961283 382
92 iso_pu_bacteria 8057101203 8057105142 382
93 iso_pu_bacteria 2808606404 2809081370 383
94 iso_pu_bacteria 2879163058 2879163649 383
95 3300017792 Ga0163161_10007575 Ga0163161_100075754 384
96 3300046512 Ga0495610_0000243 Ga0495610_0000243_36086_37249 384
97 3300046515 Ga0495620_0003625 Ga0495620_0003625_3769_4932 384
98 3300005339 Ga0070660_100000883 Ga0070660_10000088320 385
99 3300005366 Ga0070659_100016215 Ga0070659_1000162156 385
100 3300005457 Ga0070662_100054361 Ga0070662_1000543613 385
101 3300005616 Ga0068852_100161410 Ga0068852_1001614102 385
102 3300005834 Ga0068851_10065255 Ga0068851_100652552 385
103 3300006051 Ga0075364_10053367 Ga0075364_100533672 385
104 3300013100 Ga0157373_10028050 Ga0157373_100280504 385
105 3300025321 Ga0207656_10081919 Ga0207656_100819192 385
106 3300025909 Ga0207705_10003164 Ga0207705_100031648 385
107 3300025919 Ga0207657_10000783 Ga0207657_1000078311 385
108 3300025933 Ga0207706_10002940 Ga0207706_1000294012 385
109 3300026142 Ga0207698_10284200 Ga0207698_102842001 385
110 2162886007 SwRhRL2b_contig_3090221 SwRhRL2b_0145.00007650 386
111 3300005844 Ga0068862_100010781 Ga0068862_1000107813 386
112 3300006051 Ga0075364_10148852 Ga0075364_101488522 386
113 3300009011 Ga0105251_10001909 Ga0105251_100019099 386
114 3300009011 Ga0105251_10013886 Ga0105251_100138863 386
115 3300009092 Ga0105250_10000748 Ga0105250_100007489 386
116 3300009092 Ga0105250_10006791 Ga0105250_100067915 386
117 3300009177 Ga0105248_10015635 Ga0105248_100156356 386
118 3300013306 Ga0163162_10029816 Ga0163162_100298163 386
119 3300025711 Ga0207696_1001183 Ga0207696_10011835 386
120 3300025735 Ga0207713_1001574 Ga0207713_100157410 386
121 3300028380 Ga0268265_10004977 Ga0268265_100049779 386
122 3300048903 Ga0496100_0001143 Ga0496100_0001143_5660_6820 386
123 3300048904 Ga0496101_0004565 Ga0496101_0004565_2283_3443 386
124 3300048904 Ga0496101_0118565 Ga0496101_0118565_278_1438 386
125 3300048905 Ga0496102_0000698 Ga0496102_0000698_18707_19867 386
126 3300048906 Ga0496103_0000258 Ga0496103_0000258_36239_37399 386
127 3300048907 Ga0496104_0000675 Ga0496104_0000675_11560_12720 386
128 3300048908 Ga0496105_0000184 Ga0496105_0000184_11577_12737 386
129 3300048915 Ga0496112_0015723 Ga0496112_0015723_2837_3997 386
130 3300048916 Ga0496113_0001048 Ga0496113_0001048_7781_8941 386
131 3300048919 Ga0496116_0004390 Ga0496116_0004390_4168_5328 386
132 3300048919 Ga0496116_0022738 Ga0496116_0022738_2808_3968 386
133 3300048920 Ga0496117_0001983 Ga0496117_0001983_12488_13648 386
134 3300048921 Ga0496118_0002186 Ga0496118_0002186_12488_13648 386
135 3300048921 Ga0496118_0162308 Ga0496118_0162308_61_1221 386
136 3300048922 Ga0496119_0001028 Ga0496119_0001028_23014_24174 386
137 3300048923 Ga0496120_0000961 Ga0496120_0000961_31137_32297 386
138 3300048924 Ga0496121_0006115 Ga0496121_0006115_1525_2685 386
139 3300048924 Ga0496121_0011024 Ga0496121_0011024_1511_2671 386
140 3300048925 Ga0496122_0002945 Ga0496122_0002945_8509_9669 386
141 3300048926 Ga0496123_0003956 Ga0496123_0003956_9006_10166 386
142 3300048927 Ga0496124_0014032 Ga0496124_0014032_3544_4704 386
143 3300048928 Ga0496125_0004588 Ga0496125_0004588_6000_7160 386
144 3300048929 Ga0496126_0000158 Ga0496126_0000158_28138_29298 386
145 3300050491 nmdc:mga00v17_133297_c1 nmdc:mga00v17_133297_c1_300_1484 386
146 2162886007 SwRhRL2b_contig_2292987 SwRhRL2b_0423.00007090 387
147 2162886007 SwRhRL2b_contig_3383716 SwRhRL2b_0896.00004870 387
148 3300001976 JGI24752J21851_1000086 JGI24752J21851_10000862 387
149 3300001989 JGI24739J22299_10001840 JGI24739J22299_100018402 387
150 3300001990 JGI24737J22298_10009183 JGI24737J22298_100091832 387
151 3300003791 Ga0055530_10010124 Ga0055530_100101242 387
152 3300005289 Ga0065704_10001247 Ga0065704_1000124714 387
153 3300005289 Ga0065704_10070346 Ga0065704_1007034613 387
154 3300005289 Ga0065704_10073718 Ga0065704_100737189 387
155 3300005295 Ga0065707_10149917 Ga0065707_101499172 387
156 3300005331 Ga0070670_100000215 Ga0070670_1000002152 387
157 3300005367 Ga0070667_100000311 Ga0070667_1000003112 387
158 3300005578 Ga0068854_100001288 Ga0068854_1000012889 387
159 3300005617 Ga0068859_100421230 Ga0068859_1004212302 387
160 3300005618 Ga0068864_100000080 Ga0068864_10000008096 387
161 3300005841 Ga0068863_100000087 Ga0068863_10000008796 387
162 3300005844 Ga0068862_100000101 Ga0068862_10000010196 387
163 3300006931 Ga0097620_100421241 Ga0097620_1004212412 387
164 3300009011 Ga0105251_10000248 Ga0105251_1000024849 387
165 3300009093 Ga0105240_10062135 Ga0105240_100621354 387
166 3300009093 Ga0105240_10131228 Ga0105240_101312282 387
167 3300009551 Ga0105238_10015201 Ga0105238_100152016 387
168 3300009551 Ga0105238_10034514 Ga0105238_100345144 387
169 3300009553 Ga0105249_10000024 Ga0105249_10000024145 387
170 3300013102 Ga0157371_10003592 Ga0157371_100035925 387
171 3300013102 Ga0157371_10040325 Ga0157371_100403252 387
172 3300013104 Ga0157370_10010150 Ga0157370_100101504 387
173 3300013105 Ga0157369_10116490 Ga0157369_101164902 387
174 3300013307 Ga0157372_10007486 Ga0157372_100074867 387
175 3300014968 Ga0157379_10033358 Ga0157379_100333586 387
176 3300017792 Ga0163161_10104995 Ga0163161_101049952 387
177 3300017792 Ga0163161_10210950 Ga0163161_102109502 387
178 3300025298 Ga0209050_1000860 Ga0209050_100086023 387
179 3300025735 Ga0207713_1004528 Ga0207713_10045282 387
180 3300025913 Ga0207695_10097702 Ga0207695_100977022 387
181 3300025924 Ga0207694_10019613 Ga0207694_100196133 387
182 3300025924 Ga0207694_10023835 Ga0207694_100238354 387
183 3300025925 Ga0207650_10000261 Ga0207650_100002616 387
184 3300025933 Ga0207706_10014667 Ga0207706_100146675 387
185 3300025961 Ga0207712_10000034 Ga0207712_10000034145 387
186 3300025981 Ga0207640_10000660 Ga0207640_100006609 387
187 3300025986 Ga0207658_10000239 Ga0207658_100002396 387
188 3300026088 Ga0207641_10000010 Ga0207641_100000106 387
189 3300026095 Ga0207676_10000036 Ga0207676_1000003649 387
190 3300028380 Ga0268265_10000059 Ga0268265_100000592 387
191 3300037418 Ga0395900_0012806 Ga0395900_0012806_3648_4835 387
192 3300046452 Ga0495617_027562 Ga0495617_027562_675_1871 387
193 3300046512 Ga0495610_0000082 Ga0495610_0000082_106950_108113 387
194 3300046515 Ga0495620_0006903 Ga0495620_0006903_4973_6136 387
195 3300046519 Ga0495632_0005949 Ga0495632_0005949_3355_4518 387
196 3300046660 Ga0495625_0022047 Ga0495625_0022047_2858_4021 387
197 3300048906 Ga0496103_0019957 Ga0496103_0019957_1207_2370 387
198 3300048911 Ga0496108_0008596 Ga0496108_0008596_6359_7522 387
199 3300048919 Ga0496116_0001606 Ga0496116_0001606_11213_12376 387
200 3300048920 Ga0496117_0002815 Ga0496117_0002815_19487_20650 387
201 3300048921 Ga0496118_0000335 Ga0496118_0000335_17358_18521 387
202 3300048925 Ga0496122_0001573 Ga0496122_0001573_12567_13742 387
203 3300048925 Ga0496122_0018975 Ga0496122_0018975_20_1183 387
204 3300048926 Ga0496123_0000428 Ga0496123_0000428_62120_63295 387
205 3300048927 Ga0496124_0001488 Ga0496124_0001488_16388_17551 387
206 3300048927 Ga0496124_0002149 Ga0496124_0002149_20840_22003 387
207 3300048928 Ga0496125_0003189 Ga0496125_0003189_14644_15807 387
208 3300048928 Ga0496125_0068786 Ga0496125_0068786_929_2092 387
209 3300048929 Ga0496126_0001697 Ga0496126_0001697_16851_18014 387
210 3300049551 Ga0501335_000249 Ga0501335_000249_1777_2940 387
211 3300049653 Ga0501206_000989 Ga0501206_000989_1915_3078 387
212 3300049658 Ga0501211_001069 Ga0501211_001069_1146_2309 387
213 3300049669 Ga0501235_000092 Ga0501235_000092_1111_2274 387
214 3300049705 Ga0501225_0002260 Ga0501225_0002260_2692_3855 387
215 3300050491 nmdc:mga00v17_19848_c1 nmdc:mga00v17_19848_c1_1091_2254 387
216 3300053157 Ga0500624_000225 Ga0500624_000225_11132_12295 387
217 3300053177 Ga0500636_0000126 Ga0500636_0000126_6758_7921 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02706

Wzz

Chain length determinant protein

86

176

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wa9-assembly1.cif.gz_M structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.8655 233 289
6wa9-assembly1.cif.gz_M structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.7614 233 289
5j0k-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7273 232 318
5j0k-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7166 232 319
3rsm-assembly1.cif.gz_A crystal structure of s108c mutant of pmm/pgm 0.6718 146 184
ID Description Score Start End Superfamily
af_C0PJ39_412_507_3.30.70.2860 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.691 147 180 3.30.70.2860
af_Q8I250_5_112_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.644 206 310 1.20.58.90
af_A0A2R8QTR6_26_127_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6364 198 292 1.20.1280.290
3vkhB13 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6196 178 334 1.10.287.2610
af_A0A2R8QIU7_430_598_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.619 185 334 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A6P2KTG4-F1-model_v4 Capsule polysaccharide export protein 0.8448 1 385 GO:0004713
GO:0005886
AF-A0A7Y7IT50-F1-model_v4 Capsule biosynthesis protein 0.841 1 383 GO:0004713
GO:0005886
AF-A0A433B186-F1-model_v4 Capsule biosynthesis protein 0.8372 1 384 GO:0004713
GO:0005886
AF-A0A7Y7IT50-F1-model_v4 Capsule biosynthesis protein 0.8315 1 383 GO:0004713
GO:0005886
AF-A0A7W4NS48-F1-model_v4 Capsule biosynthesis protein 0.8312 29 383 GO:0004713
GO:0005886

Feature Viewer

pLDDT pTM Quality
77.89 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map