F328680

General Info

Members Datasets Scaffolds Average Seq Length
217 152 434 164

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000001|Ga0105251_10000001334
Length 186
Sequence MFTQSGSPGTISDFQATEELQVTQQEIRIDSYAPGDEQGIVELIVPIQREEFGIAITAQDQPDLLAIPSFYQTGTGDFWVARHDGVVIGSIALKDIGNGDAALRKMFVATAWRGREFGVARRLLECLIEAARARGVRRIFLGTTAKFLAAHRFYEKHGFTLVDQQELPPAFPLMVVDTRFYAIELG

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
36 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
59 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
60 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
61 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
62 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
63 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
64 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
65 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
68 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
69 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
137 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
141 2516143018 Ensifer sp. BR816 Isolate Nodule
142 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
143 2738541278 Niastella sp. CF465 Isolate Unclassified
144 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
145 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
146 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
147 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
148 2855730933 Achromobacter sp. HZ28 Isolate Nodule
149 2855767633 Achromobacter sp. HZ34 Isolate Nodule
150 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
151 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
152 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.01
Metatranscriptomes 0
Isolates 5.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.12
Nodule 2.3
Rhizoplane 2.76
Rhizosphere 59.45
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10000001 3300009011 Bacteria 466643
2 JGI25150J39212_1000046 3300002774 Bacteria 78180
3 JGI25153J46596_10000099 3300003215 Bacteria 100036
4 rootH1_10031870 3300003316 Unclassified 2331
5 rootL2_10070832 3300003322 Unclassified 3220
6 rootL2_10075980 3300003322 Bacteria 3086
7 rootH1_10003203 3300003323 Bacteria 20511
8 rootH1_10057735 3300003323 Bacteria 4900
9 rootH1_10068431 3300003323 Bacteria 12390
10 Ga0055538_1000002 3300003751 Bacteria 999437
11 Ga0055539_1000002 3300003752 Bacteria 999437
12 Ga0055533_1000004 3300003756 Bacteria 999437
13 Ga0055525_1000002 3300003759 Bacteria 999437
14 Ga0055526_1003932 3300003771 Bacteria 9175
15 Ga0055526_1044272 3300003771 Bacteria 1076
16 Ga0055537_1007286 3300003773 Bacteria 2684
17 Ga0055536_1020372 3300003781 Bacteria 2049
18 Ga0055530_10008901 3300003791 Bacteria 3944
19 Ga0055540_1001420 3300003792 Bacteria 14268
20 Ga0055531_10037895 3300003794 Bacteria 1457
21 Ga0055531_10037902 3300003794 Bacteria 1457
22 Ga0055541_1000002 3300003841 Bacteria 896405
23 Ga0065165_1034061 3300005262 Bacteria 1579
24 Ga0070662_100366490 3300005457 Bacteria 1183
25 Ga0068867_100108491 3300005459 Unclassified 2129
26 Ga0070685_10091738 3300005466 Bacteria 1840
27 Ga0070698_101079126 3300005471 Bacteria 751
28 Ga0075436_100754825 3300006914 Bacteria 723
29 Ga0099794_10204498 3300007265 Bacteria 1012
30 Ga0114129_10005536 3300009147 Bacteria 17864
31 Ga0105242_10440317 3300009176 Unclassified 1226
32 Ga0105237_10140284 3300009545 Bacteria 2411
33 Ga0157373_10084920 3300013100 Bacteria 2231
34 Ga0157375_12106353 3300013308 Bacteria 671
35 Ga0213872_10140187 3300021361 Bacteria 1061
36 Ga0209784_100002 3300025224 Bacteria 1753105
37 Ga0209566_100003 3300025225 Bacteria 1753105
38 Ga0209674_100004 3300025226 Bacteria 1753105
39 Ga0209563_100006 3300025230 Bacteria 1753105
40 Ga0207425_1000020 3300025245 Bacteria 372623
41 Ga0209677_100003 3300025253 Bacteria 1753105
42 Ga0209129_1003578 3300025258 Bacteria 6655
43 Ga0209565_1000151 3300025263 Bacteria 93781
44 Ga0209676_1009799 3300025292 Bacteria 4080
45 Ga0209676_1022183 3300025292 Bacteria 2109
46 Ga0209025_1000366 3300025294 Bacteria 95707
47 Ga0209564_1001216 3300025295 Bacteria 29241
48 Ga0209564_1004923 3300025295 Bacteria 7898
49 Ga0209758_1000004 3300025297 Bacteria 1375322
50 Ga0209050_1000001 3300025298 Bacteria 3563507
51 Ga0209050_1000585 3300025298 Bacteria 59049
52 Ga0209050_1014501 3300025298 Bacteria 3388
53 Ga0207426_1016748 3300025302 Bacteria 2621
54 Ga0209051_1000251 3300025303 Bacteria 90973
55 Ga0209257_1003746 3300025304 Bacteria 12588
56 Ga0209257_1007074 3300025304 Bacteria 6930
57 Ga0207713_1000929 3300025735 Bacteria 26289
58 Ga0207706_10409681 3300025933 Bacteria 1175
59 Ga0207669_10646575 3300025937 Bacteria 864
60 Ga0207667_10000032 3300025949 Bacteria 322253
61 Ga0207678_10352084 3300026067 Bacteria 1270
62 Ga0207648_10368734 3300026089 Bacteria 1297
63 Ga0265338_10006910 3300028800 Bacteria 14280
64 Ga0265338_10246847 3300028800 Bacteria 1319
65 Ga0265327_10000166 3300031251 Bacteria 141539
66 Ga0307509_10125244 3300031507 Bacteria 2537
67 Ga0307509_10187462 3300031507 Bacteria 1924
68 Ga0307516_10000006 3300031730 Bacteria 298586
69 Ga0307510_10251751 3300033180 Bacteria 1254
70 Ga0400484_37015 3300038725 Bacteria 1318
71 Ga0400490_39920 3300038726 Bacteria 7565
72 Ga0400491_27930 3300038727 Bacteria 6929
73 Ga0400485_19928 3300038735 Bacteria 8127
74 Ga0400488_61634 3300038741 Bacteria 3021
75 Ga0400486_12733 3300038742 Bacteria 4599
76 Ga0400489_45490 3300039093 Bacteria 1180
77 Ga0400489_50966 3300039093 Bacteria 2414
78 Ga0400487_36968 3300039110 Bacteria 4752
79 Ga0436361_1014091 3300039447 Bacteria 2391
80 Ga0436361_1203849 3300039447 Bacteria 3316
81 Ga0436361_1220721 3300039447 Bacteria 3975
82 Ga0451793_0603725 3300041452 Bacteria 1242
83 Ga0451800_0485307 3300041459 Bacteria 586
84 Ga0451802_1694308 3300041460 Bacteria 762
85 Ga0451849_0008738 3300041505 Bacteria 1652
86 Ga0439432_070982 3300042006 Bacteria 1062
87 Ga0439457_009554 3300042014 Unclassified 2254
88 Ga0451577_0316882 3300042876 Bacteria 1414
89 Ga0466972_0013820 3300044658 Bacteria 4052
90 Ga0466965_0002568 3300044683 Bacteria 7757
91 Ga0453684_0012340 3300044712 Bacteria 14130
92 Ga0466968_0004965 3300044735 Bacteria 4985
93 Ga0466957_0004302 3300044842 Bacteria 7904
94 Ga0466960_0001586 3300044901 Bacteria 8318
95 Ga0451576_0003312 3300045051 Bacteria 22336
96 Ga0495617_008362 3300046452 Bacteria 3570
97 Ga0495627_001012 3300046453 Bacteria 18873
98 Ga0495627_116983 3300046453 Bacteria 754
99 Ga0495590_0017619 3300046457 Bacteria 2568
100 Ga0495591_004020 3300046458 Bacteria 7358
101 Ga0495591_014999 3300046458 Bacteria 2755
102 Ga0495638_0095194 3300046460 Unclassified 1789
103 Ga0495650_0000293 3300046471 Bacteria 91661
104 Ga0495605_0001085 3300046474 Bacteria 18130
105 Ga0495605_0164178 3300046474 Bacteria 984
106 Ga0495584_0020884 3300046491 Bacteria 3324
107 Ga0495584_0066481 3300046491 Unclassified 1813
108 Ga0495585_0013188 3300046492 Bacteria 4842
109 Ga0495596_0000343 3300046500 Bacteria 30182
110 Ga0495596_0028857 3300046500 Bacteria 2225
111 Ga0495607_0000047 3300046501 Bacteria 121696
112 Ga0495607_0003448 3300046501 Bacteria 12109
113 Ga0495607_0016727 3300046501 Bacteria 4729
114 Ga0495583_0000850 3300046506 Bacteria 37186
115 Ga0495583_0005161 3300046506 Bacteria 8992
116 Ga0495606_0000171 3300046507 Bacteria 114960
117 Ga0495606_0004718 3300046507 Bacteria 13435
118 Ga0495606_0084212 3300046507 Bacteria 1970
119 Ga0495610_0005199 3300046512 Bacteria 9321
120 Ga0495610_0133719 3300046512 Bacteria 1074
121 Ga0495616_0005599 3300046513 Bacteria 7688
122 Ga0495616_0014463 3300046513 Bacteria 4416
123 Ga0495620_0012961 3300046515 Bacteria 4283
124 Ga0495631_0001156 3300046518 Bacteria 16332
125 Ga0495631_0001538 3300046518 Bacteria 13870
126 Ga0495631_0005030 3300046518 Bacteria 6960
127 Ga0495632_0025835 3300046519 Bacteria 3100
128 Ga0495632_0031177 3300046519 Unclassified 2759
129 Ga0495632_0036583 3300046519 Bacteria 2496
130 Ga0495632_0037258 3300046519 Bacteria 2468
131 Ga0495632_0285804 3300046519 Bacteria 733
132 Ga0495632_0292624 3300046519 Unclassified 723
133 Ga0495637_0000015 3300046520 Bacteria 228949
134 Ga0495637_0000063 3300046520 Bacteria 93270
135 Ga0495643_0008767 3300046522 Bacteria 6374
136 Ga0495644_0001679 3300046523 Bacteria 8986
137 Ga0495648_0000255 3300046524 Bacteria 60610
138 Ga0495648_0149946 3300046524 Bacteria 1217
139 Ga0495648_0150120 3300046524 Unclassified 1216
140 Ga0495654_0005130 3300046530 Bacteria 7650
141 Ga0495654_0007038 3300046530 Bacteria 6331
142 Ga0495654_0046560 3300046530 Bacteria 2135
143 Ga0495654_0072036 3300046530 Bacteria 1636
144 Ga0495609_0000107 3300046538 Bacteria 97734
145 Ga0495597_0163237 3300046542 Bacteria 908
146 Ga0495622_0114844 3300046557 Bacteria 1231
147 Ga0495668_0026723 3300046616 Bacteria 3273
148 Ga0495668_0036047 3300046616 Bacteria 2772
149 Ga0495668_0124590 3300046616 Unclassified 1410
150 Ga0495611_0001123 3300046648 Bacteria 14049
151 Ga0495611_0007017 3300046648 Bacteria 4787
152 Ga0495625_0000004 3300046660 Bacteria 611314
153 Ga0495625_0040390 3300046660 Bacteria 3403
154 Ga0495661_0000006 3300046665 Bacteria 427288
155 Ga0495661_0005342 3300046665 Bacteria 9131
156 Ga0495670_0222404 3300046691 Bacteria 1003
157 Ga0495671_0004843 3300046692 Bacteria 7956
158 Ga0495671_0011433 3300046692 Bacteria 4883
159 Ga0495671_0035191 3300046692 Bacteria 2544
160 Ga0495671_0046877 3300046692 Bacteria 2160
161 Ga0495671_0064284 3300046692 Bacteria 1806
162 Ga0495671_0103567 3300046692 Unclassified 1390
163 Ga0495649_0056943 3300046694 Bacteria 2108
164 Ga0495660_0018906 3300046810 Bacteria 3954
165 Ga0495660_0047566 3300046810 Bacteria 2348
166 Ga0495660_0139527 3300046810 Bacteria 1207
167 Ga0495672_0003542 3300047320 Bacteria 13296
168 Ga0495672_0009617 3300047320 Bacteria 6978
169 Ga0495676_0000004 3300047321 Bacteria 313696
170 Ga0495683_0028425 3300047323 Bacteria 2859
171 Ga0495679_000015 3300047446 Bacteria 287256
172 Ga0495679_031258 3300047446 Bacteria 1718
173 Ga0495673_0002281 3300047469 Bacteria 13753
174 Ga0495673_0002617 3300047469 Bacteria 12476
175 Ga0495673_0005928 3300047469 Bacteria 7284
176 Ga0495673_0006527 3300047469 Bacteria 6847
177 Ga0495681_0000164 3300047470 Bacteria 55469
178 Ga0495686_0008215 3300047472 Bacteria 7697
179 Ga0495686_0022296 3300047472 Bacteria 4192
180 Ga0495626_0000012 3300048091 Bacteria 258483
181 Ga0495626_0000403 3300048091 Bacteria 44195
182 Ga0496100_0170499 3300048903 Bacteria 1567
183 Ga0496103_0435711 3300048906 Bacteria 841
184 Ga0496116_0266538 3300048919 Bacteria 840
185 Ga0496121_0031372 3300048924 Bacteria 4856
186 Ga0496123_0231147 3300048926 Bacteria 925
187 Ga0495678_000043 3300049459 Bacteria 172593
188 Ga0495678_004285 3300049459 Bacteria 8324
189 Ga0495678_020265 3300049459 Bacteria 2949
190 Ga0495678_115062 3300049459 Bacteria 911
191 Ga0501257_008665 3300049686 Unclassified 2290
192 Ga0501225_0001687 3300049705 Bacteria 6902
193 nmdc:mga00v17_198053_c1 3300050491 Bacteria 1298
194 nmdc:mga05p37_4096_c1 3300050507 Bacteria 17035
195 Ga0500583_0000081 3300053092 Bacteria 55682
196 Ga0500583_0001039 3300053092 Bacteria 7923
197 Ga0500594_0062129 3300053118 Bacteria 1080
198 Ga0500642_0185866 3300053130 Unclassified 971
199 Ga0500642_0372054 3300053130 Bacteria 630
200 Ga0500658_0201631 3300053134 Bacteria 910
201 Ga0500586_216234 3300053145 Bacteria 620
202 Ga0500616_0072890 3300053153 Unclassified 1745
203 Ga0500622_0057213 3300053156 Bacteria 1995
204 Ga0500622_0066037 3300053156 Bacteria 1837
205 2511387092 2511231026 Bacteria 5225445
206 2516208642 2516143018 Bacteria 6951533
207 2601624142 2600255283 Bacteria 6061572
208 2738729931 2738541278 Bacteria 9755573
209 2765569651 2765235838 Bacteria 5445269
210 2776913059 2775507049 Bacteria 6284736
211 2792638581 2791355094 Bacteria 7011481
212 2839097429 2839094727 Bacteria 5534556
213 2855733134 2855730933 Bacteria 7047938
214 2855771886 2855767633 Bacteria 7049357
215 2881415932 2881412998 Bacteria 6492157
216 2919046972 2919046199 Bacteria 5567169
217 2928131727 2928130867 Bacteria 5467269
218 Ga0105251_10000001
219 JGI25150J39212_1000046
220 JGI25153J46596_10000099
221 rootH1_10031870
222 rootL2_10070832
223 rootL2_10075980
224 rootH1_10003203
225 rootH1_10057735
226 rootH1_10068431
227 Ga0055538_1000002
228 Ga0055539_1000002
229 Ga0055533_1000004
230 Ga0055525_1000002
231 Ga0055526_1003932
232 Ga0055526_1044272
233 Ga0055537_1007286
234 Ga0055536_1020372
235 Ga0055530_10008901
236 Ga0055540_1001420
237 Ga0055531_10037895
238 Ga0055531_10037902
239 Ga0055541_1000002
240 Ga0065165_1034061
241 Ga0070662_100366490
242 Ga0068867_100108491
243 Ga0070685_10091738
244 Ga0070698_101079126
245 Ga0075436_100754825
246 Ga0099794_10204498
247 Ga0114129_10005536
248 Ga0105242_10440317
249 Ga0105237_10140284
250 Ga0157373_10084920
251 Ga0157375_12106353
252 Ga0213872_10140187
253 Ga0209784_100002
254 Ga0209566_100003
255 Ga0209674_100004
256 Ga0209563_100006
257 Ga0207425_1000020
258 Ga0209677_100003
259 Ga0209129_1003578
260 Ga0209565_1000151
261 Ga0209676_1009799
262 Ga0209676_1022183
263 Ga0209025_1000366
264 Ga0209564_1001216
265 Ga0209564_1004923
266 Ga0209758_1000004
267 Ga0209050_1000001
268 Ga0209050_1000585
269 Ga0209050_1014501
270 Ga0207426_1016748
271 Ga0209051_1000251
272 Ga0209257_1003746
273 Ga0209257_1007074
274 Ga0207713_1000929
275 Ga0207706_10409681
276 Ga0207669_10646575
277 Ga0207667_10000032
278 Ga0207678_10352084
279 Ga0207648_10368734
280 Ga0265338_10006910
281 Ga0265338_10246847
282 Ga0265327_10000166
283 Ga0307509_10125244
284 Ga0307509_10187462
285 Ga0307516_10000006
286 Ga0307510_10251751
287 Ga0400484_37015
288 Ga0400490_39920
289 Ga0400491_27930
290 Ga0400485_19928
291 Ga0400488_61634
292 Ga0400486_12733
293 Ga0400489_45490
294 Ga0400489_50966
295 Ga0400487_36968
296 Ga0436361_1014091
297 Ga0436361_1203849
298 Ga0436361_1220721
299 Ga0451793_0603725
300 Ga0451800_0485307
301 Ga0451802_1694308
302 Ga0451849_0008738
303 Ga0439432_070982
304 Ga0439457_009554
305 Ga0451577_0316882
306 Ga0466972_0013820
307 Ga0466965_0002568
308 Ga0453684_0012340
309 Ga0466968_0004965
310 Ga0466957_0004302
311 Ga0466960_0001586
312 Ga0451576_0003312
313 Ga0495617_008362
314 Ga0495627_001012
315 Ga0495627_116983
316 Ga0495590_0017619
317 Ga0495591_004020
318 Ga0495591_014999
319 Ga0495638_0095194
320 Ga0495650_0000293
321 Ga0495605_0001085
322 Ga0495605_0164178
323 Ga0495584_0020884
324 Ga0495584_0066481
325 Ga0495585_0013188
326 Ga0495596_0000343
327 Ga0495596_0028857
328 Ga0495607_0000047
329 Ga0495607_0003448
330 Ga0495607_0016727
331 Ga0495583_0000850
332 Ga0495583_0005161
333 Ga0495606_0000171
334 Ga0495606_0004718
335 Ga0495606_0084212
336 Ga0495610_0005199
337 Ga0495610_0133719
338 Ga0495616_0005599
339 Ga0495616_0014463
340 Ga0495620_0012961
341 Ga0495631_0001156
342 Ga0495631_0001538
343 Ga0495631_0005030
344 Ga0495632_0025835
345 Ga0495632_0031177
346 Ga0495632_0036583
347 Ga0495632_0037258
348 Ga0495632_0285804
349 Ga0495632_0292624
350 Ga0495637_0000015
351 Ga0495637_0000063
352 Ga0495643_0008767
353 Ga0495644_0001679
354 Ga0495648_0000255
355 Ga0495648_0149946
356 Ga0495648_0150120
357 Ga0495654_0005130
358 Ga0495654_0007038
359 Ga0495654_0046560
360 Ga0495654_0072036
361 Ga0495609_0000107
362 Ga0495597_0163237
363 Ga0495622_0114844
364 Ga0495668_0026723
365 Ga0495668_0036047
366 Ga0495668_0124590
367 Ga0495611_0001123
368 Ga0495611_0007017
369 Ga0495625_0000004
370 Ga0495625_0040390
371 Ga0495661_0000006
372 Ga0495661_0005342
373 Ga0495670_0222404
374 Ga0495671_0004843
375 Ga0495671_0011433
376 Ga0495671_0035191
377 Ga0495671_0046877
378 Ga0495671_0064284
379 Ga0495671_0103567
380 Ga0495649_0056943
381 Ga0495660_0018906
382 Ga0495660_0047566
383 Ga0495660_0139527
384 Ga0495672_0003542
385 Ga0495672_0009617
386 Ga0495676_0000004
387 Ga0495683_0028425
388 Ga0495679_000015
389 Ga0495679_031258
390 Ga0495673_0002281
391 Ga0495673_0002617
392 Ga0495673_0005928
393 Ga0495673_0006527
394 Ga0495681_0000164
395 Ga0495686_0008215
396 Ga0495686_0022296
397 Ga0495626_0000012
398 Ga0495626_0000403
399 Ga0496100_0170499
400 Ga0496103_0435711
401 Ga0496116_0266538
402 Ga0496121_0031372
403 Ga0496123_0231147
404 Ga0495678_000043
405 Ga0495678_004285
406 Ga0495678_020265
407 Ga0495678_115062
408 Ga0501257_008665
409 Ga0501225_0001687
410 nmdc:mga00v17_198053_c1
411 nmdc:mga05p37_4096_c1
412 Ga0500583_0000081
413 Ga0500583_0001039
414 Ga0500594_0062129
415 Ga0500642_0185866
416 Ga0500642_0372054
417 Ga0500658_0201631
418 Ga0500586_216234
419 Ga0500616_0072890
420 Ga0500622_0057213
421 Ga0500622_0066037
422 2511387092
423 2516208642
424 2601624142
425 2738729931
426 2765569651
427 2776913059
428 2792638581
429 2839097429
430 2855733134
431 2855771886
432 2881415932
433 2919046972
434 2928131727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

50

167

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

41

159

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

74

161

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.954 4 161
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9466 4 161
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9308 4 161
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9239 4 161
2q7b-assembly1.cif.gz_A-2 crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution 0.9123 1 162
ID Description Score Start End Superfamily
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9486 4 161 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9251 4 161 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8997 5 162 3.40.630.30
af_Q6ES10_187_273_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8903 65 113 3.40.630.30
af_P39337_13_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8894 8 143 3.40.630.30
ID Description Score Start End GO Terms
AF-C2V1I4-F1-model_v4 deleted 0.9879 73 162
AF-C2MRZ2-F1-model_v4 deleted 0.9806 36 162
AF-A0A380KP53-F1-model_v4 GNAT family acetyltransferase 0.9802 62 161 GO:0008080
AF-C2S9T3-F1-model_v4 deleted 0.9789 43 162
AF-A0A1S1N3B5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9782 80 162 GO:0016747

Map