F328693

General Info

Members Datasets Scaffolds Average Seq Length
217 159 432 255

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10092487|Ga0105240_100924871
Length 282
Sequence MDLSYGTCYGCGLCYTYLELSKQQKMKIALFSDIHANLPALEAFFASIEEQKPDAIYCLGDLVGYNTWPNEVINAIRGRGIPTIAGNYDFGVGRNSDDCGCAYKTEQEQANGAVSISYTNRVVGEEQRAYLRTLPAHIRVEFRLNTEPLNLLLVHGSPRRINEYLFEDREEKSLMRIMHDADADILCFGHTHKPYHRVLADGGGGSERYRHAVNIGSVGKPKDGDARGCYVLLHLFDNSSVLVKDSIRVEFVRFAYDIEKAARAVEDSPLPKAFAEALRIAK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
137 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
147 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 2738541278 Niastella sp. CF465 Isolate Unclassified
154 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
155 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
156 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
157 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
158 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
159 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.21
Nodule 0
Rhizoplane 0.92
Rhizosphere 72.81
Stem 0
Stem Tuber 0
Unclassified 7.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10092487 3300009093 Bacteria 3693
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 JGI25154J39366_1000016 3300002738 Bacteria 255057
4 JGI25157J39369_1006096 3300002741 Bacteria 1876
5 JGI25153J46596_10005236 3300003215 Bacteria 6823
6 rootH2_10001201 3300003320 Bacteria 26611
7 rootH2_10150023 3300003320 Unclassified 1743
8 rootH2_10226751 3300003320 Bacteria 2594
9 rootH2_10325803 3300003320 Bacteria 1179
10 rootH1_10027082 3300003323 Bacteria 3745
11 JGI25160J50197_1001714 3300003354 Bacteria 10638
12 Ga0055526_1005853 3300003771 Bacteria 6902
13 Ga0055526_1008112 3300003771 Bacteria 5296
14 Ga0055528_1000610 3300003790 Bacteria 26690
15 Ga0065165_1000232 3300005262 Bacteria 97117
16 Ga0065704_10070140 3300005289 Bacteria 482257
17 Ga0065704_10163530 3300005289 Bacteria 1338
18 Ga0065712_10171102 3300005290 Bacteria 1243
19 Ga0065715_10221826 3300005293 Bacteria 1269
20 Ga0070677_10005107 3300005333 Unclassified 4314
21 Ga0070669_100159191 3300005353 Bacteria 1753
22 Ga0070675_100156552 3300005354 Unclassified 1956
23 Ga0070674_100226461 3300005356 Bacteria 1457
24 Ga0070659_100001238 3300005366 Bacteria 18539
25 Ga0070681_10164399 3300005458 Bacteria 2142
26 Ga0070681_10322895 3300005458 Bacteria 1453
27 Ga0070698_100062591 3300005471 Bacteria 3754
28 Ga0070679_100042383 3300005530 Bacteria 4532
29 Ga0070679_100060507 3300005530 Bacteria 3774
30 Ga0070672_100049156 3300005543 Bacteria 3279
31 Ga0070665_100000189 3300005548 Bacteria 109948
32 Ga0068855_100004200 3300005563 Bacteria 17576
33 Ga0068855_100042754 3300005563 Bacteria 5369
34 Ga0068855_100185422 3300005563 Bacteria 2350
35 Ga0068855_100274577 3300005563 Bacteria 1873
36 Ga0068857_100153860 3300005577 Bacteria 2085
37 Ga0068856_100011868 3300005614 Bacteria 8439
38 Ga0068856_100254464 3300005614 Bacteria 1771
39 Ga0068861_100446968 3300005719 Bacteria 1157
40 Ga0068860_100000005 3300005843 Bacteria 472349
41 Ga0068860_100051825 3300005843 Bacteria 3904
42 Ga0081540_1061318 3300005983 Bacteria 1793
43 Ga0075366_10044763 3300006195 Bacteria 2623
44 Ga0075428_100127381 3300006844 Unclassified 2770
45 Ga0075431_100008453 3300006847 Bacteria 10309
46 Ga0075429_100120411 3300006880 Unclassified 2294
47 Ga0068865_100483584 3300006881 Bacteria 1029
48 Ga0105240_10000023 3300009093 Bacteria 385028
49 Ga0105240_10000833 3300009093 Bacteria 55556
50 Ga0105240_10002592 3300009093 Bacteria 28936
51 Ga0114129_10098406 3300009147 Unclassified 4049
52 Ga0105237_10002503 3300009545 Bacteria 22768
53 Ga0105237_10026390 3300009545 Bacteria 5937
54 Ga0105238_10031339 3300009551 Bacteria 5412
55 Ga0105238_10361293 3300009551 Unclassified 1441
56 Ga0105239_10000267 3300010375 Bacteria 77181
57 Ga0105239_10001651 3300010375 Bacteria 29415
58 Ga0105239_10003037 3300010375 Bacteria 20874
59 Ga0105239_10068134 3300010375 Bacteria 3911
60 Ga0157371_10012811 3300013102 Bacteria 6393
61 Ga0157371_10049742 3300013102 Bacteria 2977
62 Ga0157370_10098961 3300013104 Bacteria 2734
63 Ga0157370_10140471 3300013104 Bacteria 2250
64 Ga0157369_10076857 3300013105 Bacteria 3579
65 Ga0157374_10000003 3300013296 Bacteria 854471
66 Ga0157378_10005828 3300013297 Bacteria 10800
67 Ga0157378_10230909 3300013297 Bacteria 1763
68 Ga0157378_10383206 3300013297 Bacteria 1381
69 Ga0163162_10001420 3300013306 Bacteria 22262
70 Ga0157372_10007012 3300013307 Bacteria 12004
71 Ga0157372_10014136 3300013307 Bacteria 8528
72 Ga0157372_10016648 3300013307 Bacteria 7891
73 Ga0157372_10046901 3300013307 Unclassified 4798
74 Ga0157372_10204494 3300013307 Bacteria 2288
75 Ga0157372_10236405 3300013307 Bacteria 2119
76 Ga0163163_10185717 3300014325 Bacteria 2127
77 Ga0157376_10000580 3300014969 Bacteria 23607
78 Ga0157376_10422493 3300014969 Bacteria 1294
79 Ga0163161_10002279 3300017792 Bacteria 13770
80 Ga0209258_100234 3300025242 Bacteria 103648
81 Ga0209646_1000003 3300025246 Bacteria 1160860
82 Ga0209646_1004869 3300025246 Bacteria 2404
83 Ga0209026_1000202 3300025250 Bacteria 82517
84 Ga0209148_1000234 3300025254 Bacteria 90627
85 Ga0209673_1000166 3300025273 Bacteria 135260
86 Ga0209564_1001708 3300025295 Bacteria 20697
87 Ga0209564_1005882 3300025295 Bacteria 6806
88 Ga0209758_1001413 3300025297 Bacteria 28443
89 Ga0209758_1003452 3300025297 Bacteria 14342
90 Ga0209758_1026529 3300025297 Bacteria 2503
91 Ga0207426_1000364 3300025302 Bacteria 80671
92 Ga0207426_1000583 3300025302 Bacteria 48573
93 Ga0207426_1001181 3300025302 Bacteria 23338
94 Ga0209257_1003086 3300025304 Bacteria 14985
95 Ga0207705_10271771 3300025909 Bacteria 1296
96 Ga0207707_10136355 3300025912 Bacteria 2146
97 Ga0207695_10000016 3300025913 Bacteria 771991
98 Ga0207695_10000184 3300025913 Bacteria 181201
99 Ga0207695_10000645 3300025913 Bacteria 69294
100 Ga0207695_10063601 3300025913 Bacteria 3803
101 Ga0207671_10001942 3300025914 Bacteria 22821
102 Ga0207660_10021044 3300025917 Bacteria 4383
103 Ga0207652_10000278 3300025921 Bacteria 53117
104 Ga0207652_10013779 3300025921 Bacteria 6539
105 Ga0207694_10382396 3300025924 Bacteria 1169
106 Ga0207650_10148853 3300025925 Bacteria 1846
107 Ga0207690_10000943 3300025932 Bacteria 18615
108 Ga0207669_10164440 3300025937 Bacteria 1572
109 Ga0207704_10692909 3300025938 Bacteria 843
110 Ga0207691_10012734 3300025940 Bacteria 8056
111 Ga0207667_10003030 3300025949 Bacteria 20857
112 Ga0207667_10132017 3300025949 Bacteria 2572
113 Ga0207651_10127508 3300025960 Bacteria 1942
114 Ga0207639_10055324 3300026041 Bacteria 3036
115 Ga0207678_10160987 3300026067 Bacteria 1917
116 Ga0207702_10008170 3300026078 Bacteria 8848
117 Ga0207702_10052178 3300026078 Bacteria 3459
118 Ga0207683_10627782 3300026121 Unclassified 995
119 Ga0268266_10000180 3300028379 Bacteria 112295
120 Ga0268264_10000012 3300028381 Bacteria 521740
121 Ga0268264_10063985 3300028381 Unclassified 3095
122 Ga0307517_10017476 3300028786 Bacteria 9348
123 Ga0307517_10049828 3300028786 Bacteria 4274
124 Ga0307511_10000367 3300030521 Bacteria 48024
125 Ga0265327_10000351 3300031251 Bacteria 87732
126 Ga0265327_10035519 3300031251 Bacteria 2753
127 Ga0307509_10085194 3300031507 Bacteria 3253
128 Ga0307408_100000650 3300031548 Bacteria 29170
129 Ga0307516_10000956 3300031730 Bacteria 39870
130 Ga0307516_10006597 3300031730 Bacteria 13564
131 Ga0307407_10000001 3300031903 Bacteria 570048
132 Ga0307416_100000026 3300032002 Bacteria 172622
133 Ga0307414_10080650 3300032004 Bacteria 2380
134 Ga0307510_10001340 3300033180 Bacteria 26855
135 Ga0373955_0203985 3300035172 Bacteria 1178
136 Ga0373937_0191487 3300036401 Bacteria 1922
137 Ga0373937_0447052 3300036401 Unclassified 1227
138 Ga0395899_0014129 3300037312 Bacteria 6094
139 Ga0395900_0018985 3300037418 Bacteria 7013
140 Ga0395898_0034113 3300037466 Bacteria 5074
141 Ga0395901_0023413 3300038443 Bacteria 6331
142 Ga0439439_0041099 3300041406 Bacteria 1199
143 Ga0451853_2966421 3300041512 Unclassified 1726
144 Ga0439431_0004005 3300041997 Bacteria 3242
145 Ga0439431_0015152 3300041997 Bacteria 1793
146 Ga0439449_0008015 3300042007 Bacteria 4012
147 Ga0450898_003244 3300042134 Bacteria 2328
148 Ga0439434_0010224 3300042435 Bacteria 2766
149 Ga0466972_0000027 3300044658 Bacteria 174082
150 Ga0466972_0000139 3300044658 Bacteria 59557
151 Ga0466972_0028069 3300044658 Bacteria 2780
152 Ga0466965_0061789 3300044683 Bacteria 1873
153 Ga0466961_0101298 3300044693 Unclassified 1814
154 Ga0453684_0054362 3300044712 Bacteria 5216
155 Ga0466971_0006251 3300044719 Bacteria 5177
156 Ga0466970_0006622 3300044765 Bacteria 5794
157 Ga0466957_0014862 3300044842 Bacteria 4539
158 Ga0466957_0418964 3300044842 Unclassified 918
159 Ga0466959_0001248 3300045049 Bacteria 15359
160 Ga0451576_0000002 3300045051 Bacteria 1670975
161 Ga0495627_004166 3300046453 Bacteria 6131
162 Ga0495629_0068102 3300046459 Bacteria 2484
163 Ga0495585_0000477 3300046492 Bacteria 38276
164 Ga0495583_0121018 3300046506 Bacteria 1102
165 Ga0495632_0051185 3300046519 Bacteria 2034
166 Ga0495648_0007084 3300046524 Bacteria 9028
167 Ga0495587_0230115 3300046536 Bacteria 1045
168 Ga0495609_0006151 3300046538 Bacteria 6174
169 Ga0495622_0076587 3300046557 Bacteria 1541
170 Ga0495633_0000154 3300046558 Bacteria 90209
171 Ga0495668_0000121 3300046616 Bacteria 116234
172 Ga0495668_0003336 3300046616 Bacteria 12103
173 Ga0495611_0000057 3300046648 Bacteria 80239
174 Ga0495625_0003507 3300046660 Bacteria 15548
175 Ga0495625_0356968 3300046660 Unclassified 922
176 Ga0495661_0013486 3300046665 Bacteria 5487
177 Ga0495658_0022505 3300046683 Bacteria 3334
178 Ga0495660_0069215 3300046810 Bacteria 1876
179 Ga0495614_0008696 3300048089 Bacteria 4515
180 Ga0496114_0003996 3300048917 Bacteria 11388
181 Ga0496115_0024899 3300048918 Unclassified 4655
182 Ga0496125_0000586 3300048928 Bacteria 62077
183 Ga0496126_0013166 3300048929 Bacteria 8436
184 Ga0501034_0003261 3300049571 Bacteria 18539
185 Ga0501034_0472970 3300049571 Bacteria 1169
186 Ga0501037_0037043 3300049573 Bacteria 3595
187 Ga0501043_0038806 3300049579 Bacteria 3745
188 Ga0501047_0066988 3300049581 Bacteria 3461
189 Ga0501070_0001260 3300049586 Bacteria 22710
190 Ga0501219_000015 3300049703 Bacteria 26451
191 Ga0501241_000617 3300049758 Bacteria 7641
192 Ga0501241_009774 3300049758 Bacteria 1746
193 Ga0501044_0003358 3300049823 Bacteria 18047
194 Ga0501284_00001 3300050005 Bacteria 261916
195 nmdc:mga0k408_37624_c1 3300050493 Bacteria 2778
196 nmdc:mga0k408_41411_c1 3300050493 Bacteria 2651
197 nmdc:mga09592_10367_c1 3300050508 Bacteria 7582
198 Ga0500578_0087360 3300053086 Bacteria 1981
199 Ga0500644_0000222 3300053088 Bacteria 32776
200 Ga0500651_0069880 3300053093 Bacteria 2186
201 Ga0500556_0087877 3300053104 Bacteria 1184
202 Ga0500569_007222 3300053109 Bacteria 2481
203 Ga0500614_047832 3300053123 Bacteria 1112
204 Ga0500652_005034 3300053131 Bacteria 4132
205 Ga0500559_0051817 3300053136 Bacteria 1813
206 Ga0500561_0004123 3300053137 Bacteria 2600
207 Ga0500561_0010640 3300053137 Bacteria 1909
208 Ga0500577_0015841 3300053142 Bacteria 2364
209 Ga0500616_0040817 3300053153 Bacteria 2494
210 2738728534 2738541278 Bacteria 9755573
211 2839990987 2839989709 Bacteria 3773432
212 2852624241 2852623160 Bacteria 4376875
213 2852630079 2852627209 Bacteria 5896285
214 2896345282 2896344016 Bacteria 3811746
215 2929925832 2929921140 Bacteria 8649150
216 8003156546 8003151029 Bacteria 8187759
217 Ga0105240_10092487
218 SwRhRL2b_contig_1663050
219 JGI25154J39366_1000016
220 JGI25157J39369_1006096
221 JGI25153J46596_10005236
222 rootH2_10001201
223 rootH2_10150023
224 rootH2_10226751
225 rootH2_10325803
226 rootH1_10027082
227 JGI25160J50197_1001714
228 Ga0055526_1005853
229 Ga0055526_1008112
230 Ga0055528_1000610
231 Ga0065165_1000232
232 Ga0065704_10070140
233 Ga0065704_10163530
234 Ga0065712_10171102
235 Ga0065715_10221826
236 Ga0070677_10005107
237 Ga0070669_100159191
238 Ga0070675_100156552
239 Ga0070674_100226461
240 Ga0070659_100001238
241 Ga0070681_10164399
242 Ga0070681_10322895
243 Ga0070698_100062591
244 Ga0070679_100042383
245 Ga0070679_100060507
246 Ga0070672_100049156
247 Ga0070665_100000189
248 Ga0068855_100004200
249 Ga0068855_100042754
250 Ga0068855_100185422
251 Ga0068855_100274577
252 Ga0068857_100153860
253 Ga0068856_100011868
254 Ga0068856_100254464
255 Ga0068861_100446968
256 Ga0068860_100000005
257 Ga0068860_100051825
258 Ga0081540_1061318
259 Ga0075366_10044763
260 Ga0075428_100127381
261 Ga0075431_100008453
262 Ga0075429_100120411
263 Ga0068865_100483584
264 Ga0105240_10000023
265 Ga0105240_10000833
266 Ga0105240_10002592
267 Ga0114129_10098406
268 Ga0105237_10002503
269 Ga0105237_10026390
270 Ga0105238_10031339
271 Ga0105238_10361293
272 Ga0105239_10000267
273 Ga0105239_10001651
274 Ga0105239_10003037
275 Ga0105239_10068134
276 Ga0157371_10012811
277 Ga0157371_10049742
278 Ga0157370_10098961
279 Ga0157370_10140471
280 Ga0157369_10076857
281 Ga0157374_10000003
282 Ga0157378_10005828
283 Ga0157378_10230909
284 Ga0157378_10383206
285 Ga0163162_10001420
286 Ga0157372_10007012
287 Ga0157372_10014136
288 Ga0157372_10016648
289 Ga0157372_10046901
290 Ga0157372_10204494
291 Ga0157372_10236405
292 Ga0163163_10185717
293 Ga0157376_10000580
294 Ga0157376_10422493
295 Ga0163161_10002279
296 Ga0209258_100234
297 Ga0209646_1000003
298 Ga0209646_1004869
299 Ga0209026_1000202
300 Ga0209148_1000234
301 Ga0209673_1000166
302 Ga0209564_1001708
303 Ga0209564_1005882
304 Ga0209758_1001413
305 Ga0209758_1003452
306 Ga0209758_1026529
307 Ga0207426_1000364
308 Ga0207426_1000583
309 Ga0207426_1001181
310 Ga0209257_1003086
311 Ga0207705_10271771
312 Ga0207707_10136355
313 Ga0207695_10000016
314 Ga0207695_10000184
315 Ga0207695_10000645
316 Ga0207695_10063601
317 Ga0207671_10001942
318 Ga0207660_10021044
319 Ga0207652_10000278
320 Ga0207652_10013779
321 Ga0207694_10382396
322 Ga0207650_10148853
323 Ga0207690_10000943
324 Ga0207669_10164440
325 Ga0207704_10692909
326 Ga0207691_10012734
327 Ga0207667_10003030
328 Ga0207667_10132017
329 Ga0207651_10127508
330 Ga0207639_10055324
331 Ga0207678_10160987
332 Ga0207702_10008170
333 Ga0207702_10052178
334 Ga0207683_10627782
335 Ga0268266_10000180
336 Ga0268264_10000012
337 Ga0268264_10063985
338 Ga0307517_10017476
339 Ga0307517_10049828
340 Ga0307511_10000367
341 Ga0265327_10000351
342 Ga0265327_10035519
343 Ga0307509_10085194
344 Ga0307408_100000650
345 Ga0307516_10000956
346 Ga0307516_10006597
347 Ga0307407_10000001
348 Ga0307416_100000026
349 Ga0307414_10080650
350 Ga0307510_10001340
351 Ga0373955_0203985
352 Ga0373937_0191487
353 Ga0373937_0447052
354 Ga0395899_0014129
355 Ga0395900_0018985
356 Ga0395898_0034113
357 Ga0395901_0023413
358 Ga0439439_0041099
359 Ga0451853_2966421
360 Ga0439431_0004005
361 Ga0439431_0015152
362 Ga0439449_0008015
363 Ga0450898_003244
364 Ga0439434_0010224
365 Ga0466972_0000027
366 Ga0466972_0000139
367 Ga0466972_0028069
368 Ga0466965_0061789
369 Ga0466961_0101298
370 Ga0453684_0054362
371 Ga0466971_0006251
372 Ga0466970_0006622
373 Ga0466957_0014862
374 Ga0466957_0418964
375 Ga0466959_0001248
376 Ga0451576_0000002
377 Ga0495627_004166
378 Ga0495629_0068102
379 Ga0495585_0000477
380 Ga0495583_0121018
381 Ga0495632_0051185
382 Ga0495648_0007084
383 Ga0495587_0230115
384 Ga0495609_0006151
385 Ga0495622_0076587
386 Ga0495633_0000154
387 Ga0495668_0000121
388 Ga0495668_0003336
389 Ga0495611_0000057
390 Ga0495625_0003507
391 Ga0495625_0356968
392 Ga0495661_0013486
393 Ga0495658_0022505
394 Ga0495660_0069215
395 Ga0495614_0008696
396 Ga0496114_0003996
397 Ga0496115_0024899
398 Ga0496125_0000586
399 Ga0496126_0013166
400 Ga0501034_0003261
401 Ga0501034_0472970
402 Ga0501037_0037043
403 Ga0501043_0038806
404 Ga0501047_0066988
405 Ga0501070_0001260
406 Ga0501219_000015
407 Ga0501241_000617
408 Ga0501241_009774
409 Ga0501044_0003358
410 Ga0501284_00001
411 nmdc:mga0k408_37624_c1
412 nmdc:mga0k408_41411_c1
413 nmdc:mga09592_10367_c1
414 Ga0500578_0087360
415 Ga0500644_0000222
416 Ga0500651_0069880
417 Ga0500556_0087877
418 Ga0500569_007222
419 Ga0500614_047832
420 Ga0500652_005034
421 Ga0500559_0051817
422 Ga0500561_0004123
423 Ga0500561_0010640
424 Ga0500577_0015841
425 Ga0500616_0040817
426 2738728534
427 2839990987
428 2852624241
429 2852630079
430 2896345282
431 2929925832
432 8003156546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

26

238

0.82

PF00149

Metallophos

Calcineurin-like phosphoesterase

26

194

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8029 1 257
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.797 1 257
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7916 2 257
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.778 1 257
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7776 2 257
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8048 3 257 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8029 1 257 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7984 3 257 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.797 1 257 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7927 2 257 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A4Q3C0Z2-F1-model_v4 deleted 0.9975 1 172
AF-A0A7J2QXW9-F1-model_v4 Metallophosphoesterase 0.9952 1 169 GO:0005737
GO:0016791
AF-A0A7X9FYJ0-F1-model_v4 Metallophosphoesterase 0.9949 1 105 GO:0005737
GO:0016791
AF-A0A4Q6AP07-F1-model_v4 YfcE family phosphodiesterase 0.9921 40 257
AF-L8JWF1-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9903 1 257 GO:0005737
GO:0016791

Map