F328820

General Info

Members Datasets Scaffolds Average Seq Length
217 167 210 334

Family's Representative Sequence

Representative Sequence 3300025298|Ga0209050_1016712|Ga0209050_10167122
Length 341
Sequence MRRRSELNAPAGRIEQIWIDSKAVADNLLGDPARRRVDVYIPAGHDGRGLPLLVDVVGFTAGGPAHTNWKNHGETVPERADRLIASGAMKPVMIAFPDCFTRLGGNQYVNSPVMGRWEDFLIEEMLPAVEGKYGCGGTGKRGIFGKSSGGYGAIYHALRHGGTVWNAASCHSGDMGFGLLYSPGDWGGVLRTLAKHQFDIAKFVESFETAVKSDDKSWHAIMFLAQAASFDPDPTSPLGVRLPVTTDTCQIIADRWANWLAFDPLSIVEDTDAQENLKAMKTLYIDCGDIDQYNLVYGARLLNRRLVDLGIEHQYEEFPDTHSGVDYRMDISLPILAAALS

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2738541337 Pelomonas sp. BT06 Isolate Unclassified
5 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
6 2831864461 Roseateles noduli HZ7 Isolate Nodule
7 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
115 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 0.46
Rhizoplane 0
Rhizosphere 80.18
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000064 3300002705 Bacteria 83982
2 JGI25154J39366_1000954 3300002738 Bacteria 11962
3 JGI25157J39369_1000083 3300002741 Bacteria 84002
4 rootH1_10050971 3300003323 Bacteria 6578
5 Ga0055539_1000433 3300003752 Bacteria 14820
6 Ga0055535_1006788 3300003761 Bacteria 2270
7 Ga0055526_1004220 3300003771 Bacteria 8727
8 Ga0055536_1010034 3300003781 Bacteria 3824
9 Ga0055531_10000004 3300003794 Bacteria 265288
10 Ga0055543_1002348 3300004625 Bacteria 6332
11 Ga0055543_1011457 3300004625 Bacteria 1814
12 Ga0065165_1000248 3300005262 Bacteria 93216
13 Ga0065165_1000851 3300005262 Bacteria 39990
14 Ga0070658_10043846 3300005327 Bacteria 3614
15 Ga0070658_10259836 3300005327 Bacteria 1474
16 Ga0068868_100001788 3300005338 Bacteria 14746
17 Ga0068868_100077876 3300005338 Bacteria 2653
18 Ga0070660_100029526 3300005339 Bacteria 4110
19 Ga0070661_100294358 3300005344 Bacteria 1262
20 Ga0070671_100364277 3300005355 Bacteria 1234
21 Ga0070673_100014824 3300005364 Bacteria 5450
22 Ga0070659_100059819 3300005366 Bacteria 3008
23 Ga0070659_100344109 3300005366 Bacteria 1250
24 Ga0070709_10223426 3300005434 Bacteria 1344
25 Ga0070713_100037117 3300005436 Bacteria 3938
26 Ga0070710_10023752 3300005437 Bacteria 3226
27 Ga0070697_100075502 3300005536 Unclassified 2771
28 Ga0070665_100036324 3300005548 Bacteria 4957
29 Ga0068855_100028653 3300005563 Bacteria 6663
30 Ga0068855_100031419 3300005563 Bacteria 6341
31 Ga0068857_100001019 3300005577 Bacteria 21620
32 Ga0068854_100020346 3300005578 Bacteria 4488
33 Ga0068856_100000510 3300005614 Bacteria 42987
34 Ga0068856_100160278 3300005614 Bacteria 2260
35 Ga0068852_100062925 3300005616 Bacteria 3229
36 Ga0068860_100193645 3300005843 Bacteria 1968
37 Ga0081540_1012314 3300005983 Bacteria 5644
38 Ga0070717_10110968 3300006028 Bacteria 2339
39 Ga0070717_10254638 3300006028 Bacteria 1552
40 Ga0070717_10312707 3300006028 Bacteria 1398
41 Ga0075365_10016589 3300006038 Bacteria 4484
42 Ga0070712_100019504 3300006175 Bacteria 4424
43 Ga0070712_100019839 3300006175 Unclassified 4393
44 Ga0075370_10090516 3300006353 Bacteria 1765
45 Ga0105240_10007987 3300009093 Bacteria 15259
46 Ga0105245_10024588 3300009098 Bacteria 5291
47 Ga0105241_10021766 3300009174 Bacteria 4743
48 Ga0105241_10040287 3300009174 Bacteria 3526
49 Ga0105248_10402041 3300009177 Bacteria 1542
50 Ga0105238_10004269 3300009551 Bacteria 14201
51 Ga0105249_10575808 3300009553 Bacteria 1179
52 Ga0105239_10040513 3300010375 Bacteria 5104
53 Ga0105239_10290249 3300010375 Bacteria 1842
54 Ga0157372_10127207 3300013307 Bacteria 2930
55 Ga0182008_10160912 3300014497 Bacteria 1130
56 Ga0157376_10000348 3300014969 Bacteria 30874
57 Ga0213872_10053148 3300021361 Bacteria 1837
58 Ga0209258_100880 3300025242 Bacteria 15817
59 Ga0209646_1000129 3300025246 Bacteria 129401
60 Ga0209026_1000059 3300025250 Bacteria 226652
61 Ga0209677_100126 3300025253 Bacteria 78655
62 Ga0209759_1000081 3300025256 Bacteria 169943
63 Ga0209759_1007236 3300025256 Bacteria 3601
64 Ga0209673_1020541 3300025273 Bacteria 2336
65 Ga0209676_1000300 3300025292 Bacteria 100399
66 Ga0209564_1000389 3300025295 Bacteria 79321
67 Ga0209050_1003089 3300025298 Bacteria 12797
68 Ga0209050_1016712 3300025298 Bacteria 2979
69 Ga0209051_1001799 3300025303 Bacteria 17001
70 Ga0209257_1000053 3300025304 Bacteria 425160
71 Ga0207684_10104597 3300025910 Bacteria 2421
72 Ga0207654_10022123 3300025911 Bacteria 3388
73 Ga0207695_10002736 3300025913 Bacteria 25714
74 Ga0207693_10005080 3300025915 Bacteria 11035
75 Ga0207693_10013451 3300025915 Bacteria 6598
76 Ga0207693_10128244 3300025915 Bacteria 1994
77 Ga0207657_10028374 3300025919 Bacteria 5106
78 Ga0207694_10002239 3300025924 Bacteria 15853
79 Ga0207700_10158732 3300025928 Bacteria 1876
80 Ga0207664_10122014 3300025929 Bacteria 2182
81 Ga0207664_10123328 3300025929 Bacteria 2172
82 Ga0207664_10319810 3300025929 Bacteria 1369
83 Ga0207690_10060590 3300025932 Bacteria 2569
84 Ga0207665_10118057 3300025939 Bacteria 1871
85 Ga0207689_10072596 3300025942 Bacteria 2827
86 Ga0207679_10240014 3300025945 Unclassified 1535
87 Ga0207667_10064902 3300025949 Bacteria 3809
88 Ga0207651_10009741 3300025960 Bacteria 5281
89 Ga0207640_10014806 3300025981 Bacteria 4498
90 Ga0207677_10107100 3300026023 Bacteria 2073
91 Ga0207639_10245645 3300026041 Bacteria 1559
92 Ga0207702_10000656 3300026078 Bacteria 37662
93 Ga0207702_10086829 3300026078 Bacteria 2729
94 Ga0207674_10003425 3300026116 Bacteria 19419
95 Ga0207698_10383133 3300026142 Bacteria 1338
96 Ga0268264_10307725 3300028381 Bacteria 1494
97 Ga0265337_1000796 3300028556 Bacteria 16604
98 Ga0265318_10000025 3300028577 Bacteria 159237
99 Ga0265336_10000003 3300028666 Bacteria 423158
100 Ga0265338_10017816 3300028800 Bacteria 7638
101 Ga0265324_10000129 3300029957 Bacteria 59672
102 Ga0265320_10000209 3300031240 Bacteria 47757
103 Ga0265325_10009469 3300031241 Bacteria 5685
104 Ga0265331_10024083 3300031250 Bacteria 3085
105 Ga0307408_100191015 3300031548 Bacteria 1650
106 Ga0265314_10000727 3300031711 Bacteria 39795
107 Ga0265314_10009402 3300031711 Bacteria 8249
108 Ga0307516_10003736 3300031730 Bacteria 19353
109 Ga0373936_0021352 3300035113 Bacteria 2518
110 Ga0373953_0004027 3300035117 Bacteria 4642
111 Ga0373954_0022979 3300035118 Bacteria 2832
112 Ga0373954_0042763 3300035118 Bacteria 2113
113 Ga0373957_0023980 3300035120 Bacteria 2187
114 Ga0373943_0012746 3300035170 Bacteria 3790
115 Ga0373955_0178272 3300035172 Bacteria 1260
116 Ga0373933_0015720 3300035724 Bacteria 4221
117 Ga0373933_0031977 3300035724 Unclassified 3056
118 Ga0373933_0060518 3300035724 Bacteria 2283
119 Ga0373947_0068866 3300035725 Bacteria 2165
120 Ga0373937_0002712 3300036401 Bacteria 14779
121 Ga0373937_0008397 3300036401 Bacteria 8974
122 Ga0373937_0012426 3300036401 Bacteria 7488
123 Ga0373937_0019469 3300036401 Bacteria 6076
124 Ga0373925_0013703 3300037068 Bacteria 5870
125 Ga0373925_0016762 3300037068 Bacteria 5306
126 Ga0373925_0025719 3300037068 Bacteria 4304
127 Ga0395900_0000355 3300037418 Bacteria 66598
128 Ga0395898_0000758 3300037466 Bacteria 56394
129 Ga0395898_0070441 3300037466 Bacteria 3380
130 Ga0395905_0014754 3300037471 Bacteria 7449
131 Ga0395905_0025882 3300037471 Bacteria 5529
132 Ga0395905_0032604 3300037471 Bacteria 4899
133 Ga0395901_0245693 3300038443 Bacteria 1865
134 Ga0436360_1013858 3300039438 Bacteria 1657
135 Ga0436360_1329314 3300039438 Bacteria 1151
136 Ga0436361_0553366 3300039447 Bacteria 2783
137 Ga0436361_1146454 3300039447 Unclassified 2217
138 Ga0436363_1507612 3300039450 Bacteria 1397
139 Ga0436362_1133829 3300039453 Bacteria 2053
140 Ga0450890_007358 3300042127 Bacteria 1405
141 Ga0450891_005138 3300042129 Bacteria 1212
142 Ga0466969_0000039 3300044656 Bacteria 71961
143 Ga0466969_0003203 3300044656 Bacteria 8714
144 Ga0466965_0019211 3300044683 Bacteria 3281
145 Ga0466966_0000676 3300044684 Bacteria 21625
146 Ga0466966_0040480 3300044684 Bacteria 2999
147 Ga0466966_0098462 3300044684 Bacteria 1811
148 Ga0466961_0064035 3300044693 Bacteria 2336
149 Ga0466961_0093859 3300044693 Bacteria 1893
150 Ga0466964_0003241 3300044706 Bacteria 5924
151 Ga0466968_0083177 3300044735 Bacteria 1410
152 Ga0466970_0030575 3300044765 Bacteria 2840
153 Ga0466970_0091641 3300044765 Bacteria 1650
154 Ga0466960_0069346 3300044901 Bacteria 1751
155 Ga0466959_0000101 3300045049 Bacteria 54971
156 Ga0466959_0018679 3300045049 Bacteria 5091
157 Ga0466958_0172071 3300045836 Bacteria 1371
158 Ga0466967_0052924 3300045976 Bacteria 3566
159 Ga0495592_0022668 3300046454 Bacteria 4777
160 Ga0495638_0073961 3300046460 Bacteria 2079
161 Ga0495580_0118652 3300046472 Bacteria 1837
162 Ga0495582_0011673 3300046473 Bacteria 4840
163 Ga0495664_0002950 3300046477 Bacteria 9190
164 Ga0495608_0029655 3300046511 Bacteria 3709
165 Ga0495608_0054931 3300046511 Bacteria 2632
166 Ga0495628_0073203 3300046516 Bacteria 2670
167 Ga0495587_0123200 3300046536 Bacteria 1484
168 Ga0495587_0125738 3300046536 Unclassified 1467
169 Ga0495645_0002379 3300046543 Bacteria 12761
170 Ga0495667_0037331 3300046559 Bacteria 3239
171 Ga0495667_0055717 3300046559 Bacteria 2600
172 Ga0495634_0023101 3300046642 Bacteria 4376
173 Ga0495635_0083766 3300046663 Unclassified 2182
174 Ga0495657_0011071 3300046675 Bacteria 6764
175 Ga0495599_0169988 3300046678 Unclassified 1345
176 Ga0495658_0005181 3300046683 Bacteria 6410
177 Ga0495600_0074956 3300046809 Bacteria 2210
178 Ga0495600_0242114 3300046809 Unclassified 1149
179 Ga0495674_0021481 3300047319 Bacteria 5970
180 Ga0495680_0182733 3300047322 Unclassified 1512
181 Ga0495675_0038471 3300047444 Bacteria 3046
182 Ga0495684_0069663 3300047471 Bacteria 2674
183 Ga0495686_0008398 3300047472 Bacteria 7576
184 Ga0495602_0000230 3300048088 Bacteria 52313
185 Ga0496120_0177119 3300048923 Bacteria 1050
186 Ga0496124_0001876 3300048927 Bacteria 28920
187 Ga0496126_0000406 3300048929 Bacteria 87599
188 Ga0501033_0024115 3300049570 Bacteria 4591
189 Ga0501033_0156977 3300049570 Bacteria 1639
190 Ga0501037_0011674 3300049573 Bacteria 6467
191 Ga0501039_0413910 3300049575 Bacteria 1059
192 Ga0501047_0005566 3300049581 Bacteria 11860
193 Ga0501047_0132277 3300049581 Bacteria 2375
194 Ga0501070_0076347 3300049586 Bacteria 2774
195 Ga0501080_0128459 3300049742 Bacteria 2346
196 Ga0501035_0003863 3300049822 Bacteria 14287
197 Ga0501035_0012664 3300049822 Bacteria 7793
198 Ga0501035_0226102 3300049822 Bacteria 1596
199 Ga0501044_0002266 3300049823 Bacteria 21944
200 Ga0501044_0172380 3300049823 Bacteria 2134
201 Ga0495601_0002924 3300053077 Bacteria 9720
202 Ga0495601_0030609 3300053077 Unclassified 3342
203 Ga0495612_0003938 3300053078 Bacteria 6163
204 Ga0500635_0000219 3300053080 Bacteria 26686
205 Ga0495595_0049855 3300053084 Bacteria 1937
206 Ga0495619_0045984 3300053085 Bacteria 2869
207 Ga0495619_0101665 3300053085 Bacteria 1957
208 Ga0500559_0008778 3300053136 Bacteria 4406
209 Ga0500622_0014679 3300053156 Bacteria 4199
210 Ga0501084_0113063 3300054114 Bacteria 2282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0156977 Ga0501033_0156977_769_1620 283
2 3300039453 Ga0436362_1133829 Ga0436362_1133829_23_892 287
3 3300005434 Ga0070709_10223426 Ga0070709_102234261 308
4 3300039438 Ga0436360_1329314 Ga0436360_1329314_181_1116 308
5 3300009177 Ga0105248_10402041 Ga0105248_104020412 309
6 3300046809 Ga0495600_0242114 Ga0495600_0242114_196_1131 309
7 3300049581 Ga0501047_0005566 Ga0501047_0005566_1132_2142 318
8 3300054114 Ga0501084_0113063 Ga0501084_0113063_21_1031 318
9 3300028800 Ga0265338_10017816 Ga0265338_100178166 319
10 3300045836 Ga0466958_0172071 Ga0466958_0172071_371_1330 319
11 3300049586 Ga0501070_0076347 Ga0501070_0076347_322_1332 319
12 3300046536 Ga0495587_0125738 Ga0495587_0125738_14_1000 326
13 iso_pu_bacteria 3002141150 3002143982 329
14 iso_pu_bacteria 2524023250 2524611590 330
15 iso_pu_bacteria 2643221639 2644220120 330
16 iso_pu_bacteria 2643221646 2644261133 330
17 iso_pu_bacteria 2738541337 2739053936 330
18 iso_pu_bacteria 2821443989 2821446162 330
19 iso_pu_bacteria 2831864461 2831867113 330
20 3300009553 Ga0105249_10575808 Ga0105249_105758081 332
21 3300003781 Ga0055536_1010034 Ga0055536_10100342 333
22 3300005355 Ga0070671_100364277 Ga0070671_1003642771 333
23 3300005436 Ga0070713_100037117 Ga0070713_1000371174 333
24 3300005437 Ga0070710_10023752 Ga0070710_100237523 333
25 3300005536 Ga0070697_100075502 Ga0070697_1000755023 333
26 3300005548 Ga0070665_100036324 Ga0070665_1000363243 333
27 3300005983 Ga0081540_1012314 Ga0081540_10123143 333
28 3300006028 Ga0070717_10110968 Ga0070717_101109682 333
29 3300006028 Ga0070717_10254638 Ga0070717_102546382 333
30 3300006028 Ga0070717_10312707 Ga0070717_103127072 333
31 3300006175 Ga0070712_100019504 Ga0070712_1000195044 333
32 3300006175 Ga0070712_100019839 Ga0070712_1000198395 333
33 3300014497 Ga0182008_10160912 Ga0182008_101609121 333
34 3300025292 Ga0209676_1000300 Ga0209676_100030092 333
35 3300025298 Ga0209050_1016712 Ga0209050_10167122 333
36 3300025910 Ga0207684_10104597 Ga0207684_101045972 333
37 3300025915 Ga0207693_10005080 Ga0207693_100050802 333
38 3300025915 Ga0207693_10013451 Ga0207693_100134515 333
39 3300025915 Ga0207693_10128244 Ga0207693_101282442 333
40 3300025928 Ga0207700_10158732 Ga0207700_101587321 333
41 3300025929 Ga0207664_10122014 Ga0207664_101220142 333
42 3300025929 Ga0207664_10123328 Ga0207664_101233282 333
43 3300025929 Ga0207664_10319810 Ga0207664_103198101 333
44 3300025939 Ga0207665_10118057 Ga0207665_101180573 333
45 3300025945 Ga0207679_10240014 Ga0207679_102400142 333
46 3300035113 Ga0373936_0021352 Ga0373936_0021352_789_1796 333
47 3300035117 Ga0373953_0004027 Ga0373953_0004027_2215_3222 333
48 3300035118 Ga0373954_0022979 Ga0373954_0022979_1737_2744 333
49 3300035118 Ga0373954_0042763 Ga0373954_0042763_552_1559 333
50 3300035120 Ga0373957_0023980 Ga0373957_0023980_1089_2096 333
51 3300035724 Ga0373933_0015720 Ga0373933_0015720_2883_3890 333
52 3300035724 Ga0373933_0031977 Ga0373933_0031977_446_1528 333
53 3300035724 Ga0373933_0060518 Ga0373933_0060518_739_1746 333
54 3300035725 Ga0373947_0068866 Ga0373947_0068866_243_1250 333
55 3300036401 Ga0373937_0002712 Ga0373937_0002712_9273_10355 333
56 3300036401 Ga0373937_0008397 Ga0373937_0008397_4258_5265 333
57 3300036401 Ga0373937_0012426 Ga0373937_0012426_3199_4206 333
58 3300036401 Ga0373937_0019469 Ga0373937_0019469_347_1354 333
59 3300037068 Ga0373925_0013703 Ga0373925_0013703_143_1162 333
60 3300037068 Ga0373925_0025719 Ga0373925_0025719_2669_3676 333
61 3300039438 Ga0436360_1013858 Ga0436360_1013858_257_1264 333
62 3300039447 Ga0436361_1146454 Ga0436361_1146454_543_1550 333
63 3300039450 Ga0436363_1507612 Ga0436363_1507612_304_1311 333
64 3300046454 Ga0495592_0022668 Ga0495592_0022668_2620_3627 333
65 3300046472 Ga0495580_0118652 Ga0495580_0118652_774_1781 333
66 3300046477 Ga0495664_0002950 Ga0495664_0002950_2467_3474 333
67 3300046511 Ga0495608_0029655 Ga0495608_0029655_2022_3029 333
68 3300046511 Ga0495608_0054931 Ga0495608_0054931_327_1334 333
69 3300046516 Ga0495628_0073203 Ga0495628_0073203_1091_2098 333
70 3300046536 Ga0495587_0123200 Ga0495587_0123200_207_1214 333
71 3300046543 Ga0495645_0002379 Ga0495645_0002379_8036_9043 333
72 3300046559 Ga0495667_0037331 Ga0495667_0037331_504_1511 333
73 3300046559 Ga0495667_0055717 Ga0495667_0055717_608_1615 333
74 3300046642 Ga0495634_0023101 Ga0495634_0023101_793_1800 333
75 3300046663 Ga0495635_0083766 Ga0495635_0083766_208_1215 333
76 3300046675 Ga0495657_0011071 Ga0495657_0011071_2046_3053 333
77 3300046678 Ga0495599_0169988 Ga0495599_0169988_205_1287 333
78 3300046809 Ga0495600_0074956 Ga0495600_0074956_727_1734 333
79 3300047319 Ga0495674_0021481 Ga0495674_0021481_469_1476 333
80 3300047322 Ga0495680_0182733 Ga0495680_0182733_182_1201 333
81 3300047444 Ga0495675_0038471 Ga0495675_0038471_854_1861 333
82 3300047471 Ga0495684_0069663 Ga0495684_0069663_1548_2555 333
83 3300048088 Ga0495602_0000230 Ga0495602_0000230_43131_44138 333
84 3300049575 Ga0501039_0413910 Ga0501039_0413910_30_1037 333
85 3300053077 Ga0495601_0002924 Ga0495601_0002924_3681_4688 333
86 3300053077 Ga0495601_0030609 Ga0495601_0030609_239_1246 333
87 3300053078 Ga0495612_0003938 Ga0495612_0003938_3697_4704 333
88 3300053084 Ga0495595_0049855 Ga0495595_0049855_559_1566 333
89 3300053085 Ga0495619_0045984 Ga0495619_0045984_1408_2415 333
90 3300053085 Ga0495619_0101665 Ga0495619_0101665_741_1748 333
91 3300002705 JGI25156J39149_1000064 JGI25156J39149_100006426 334
92 3300002738 JGI25154J39366_1000954 JGI25154J39366_10009545 334
93 3300002741 JGI25157J39369_1000083 JGI25157J39369_100008326 334
94 3300003323 rootH1_10050971 rootH1_100509717 334
95 3300003752 Ga0055539_1000433 Ga0055539_10004336 334
96 3300003761 Ga0055535_1006788 Ga0055535_10067883 334
97 3300003771 Ga0055526_1004220 Ga0055526_10042204 334
98 3300003794 Ga0055531_10000004 Ga0055531_1000000489 334
99 3300004625 Ga0055543_1002348 Ga0055543_10023488 334
100 3300004625 Ga0055543_1011457 Ga0055543_10114572 334
101 3300005262 Ga0065165_1000248 Ga0065165_100024853 334
102 3300005262 Ga0065165_1000851 Ga0065165_100085135 334
103 3300005327 Ga0070658_10043846 Ga0070658_100438461 334
104 3300005327 Ga0070658_10259836 Ga0070658_102598361 334
105 3300005338 Ga0068868_100001788 Ga0068868_1000017882 334
106 3300005338 Ga0068868_100077876 Ga0068868_1000778762 334
107 3300005339 Ga0070660_100029526 Ga0070660_1000295262 334
108 3300005344 Ga0070661_100294358 Ga0070661_1002943581 334
109 3300005364 Ga0070673_100014824 Ga0070673_1000148242 334
110 3300005366 Ga0070659_100059819 Ga0070659_1000598192 334
111 3300005366 Ga0070659_100344109 Ga0070659_1003441092 334
112 3300005563 Ga0068855_100028653 Ga0068855_1000286533 334
113 3300005563 Ga0068855_100031419 Ga0068855_1000314197 334
114 3300005577 Ga0068857_100001019 Ga0068857_10000101910 334
115 3300005578 Ga0068854_100020346 Ga0068854_1000203462 334
116 3300005614 Ga0068856_100000510 Ga0068856_10000051021 334
117 3300005614 Ga0068856_100160278 Ga0068856_1001602782 334
118 3300005616 Ga0068852_100062925 Ga0068852_1000629253 334
119 3300005843 Ga0068860_100193645 Ga0068860_1001936451 334
120 3300006038 Ga0075365_10016589 Ga0075365_100165894 334
121 3300006353 Ga0075370_10090516 Ga0075370_100905162 334
122 3300009093 Ga0105240_10007987 Ga0105240_100079877 334
123 3300009098 Ga0105245_10024588 Ga0105245_100245886 334
124 3300009174 Ga0105241_10021766 Ga0105241_100217661 334
125 3300009174 Ga0105241_10040287 Ga0105241_100402872 334
126 3300009551 Ga0105238_10004269 Ga0105238_100042694 334
127 3300010375 Ga0105239_10040513 Ga0105239_100405132 334
128 3300010375 Ga0105239_10290249 Ga0105239_102902492 334
129 3300013307 Ga0157372_10127207 Ga0157372_101272072 334
130 3300014969 Ga0157376_10000348 Ga0157376_1000034818 334
131 3300021361 Ga0213872_10053148 Ga0213872_100531482 334
132 3300025242 Ga0209258_100880 Ga0209258_1008806 334
133 3300025246 Ga0209646_1000129 Ga0209646_100012970 334
134 3300025250 Ga0209026_1000059 Ga0209026_100005940 334
135 3300025253 Ga0209677_100126 Ga0209677_10012625 334
136 3300025256 Ga0209759_1000081 Ga0209759_1000081114 334
137 3300025256 Ga0209759_1007236 Ga0209759_10072362 334
138 3300025273 Ga0209673_1020541 Ga0209673_10205412 334
139 3300025295 Ga0209564_1000389 Ga0209564_100038959 334
140 3300025298 Ga0209050_1003089 Ga0209050_10030893 334
141 3300025303 Ga0209051_1001799 Ga0209051_100179914 334
142 3300025304 Ga0209257_1000053 Ga0209257_1000053282 334
143 3300025911 Ga0207654_10022123 Ga0207654_100221232 334
144 3300025913 Ga0207695_10002736 Ga0207695_100027367 334
145 3300025919 Ga0207657_10028374 Ga0207657_100283744 334
146 3300025924 Ga0207694_10002239 Ga0207694_100022394 334
147 3300025932 Ga0207690_10060590 Ga0207690_100605902 334
148 3300025942 Ga0207689_10072596 Ga0207689_100725963 334
149 3300025949 Ga0207667_10064902 Ga0207667_100649023 334
150 3300025960 Ga0207651_10009741 Ga0207651_100097417 334
151 3300025981 Ga0207640_10014806 Ga0207640_100148063 334
152 3300026023 Ga0207677_10107100 Ga0207677_101071002 334
153 3300026041 Ga0207639_10245645 Ga0207639_102456452 334
154 3300026078 Ga0207702_10000656 Ga0207702_1000065619 334
155 3300026078 Ga0207702_10086829 Ga0207702_100868293 334
156 3300026116 Ga0207674_10003425 Ga0207674_1000342512 334
157 3300026142 Ga0207698_10383133 Ga0207698_103831331 334
158 3300028381 Ga0268264_10307725 Ga0268264_103077251 334
159 3300028556 Ga0265337_1000796 Ga0265337_100079615 334
160 3300028577 Ga0265318_10000025 Ga0265318_10000025160 334
161 3300028666 Ga0265336_10000003 Ga0265336_10000003124 334
162 3300029957 Ga0265324_10000129 Ga0265324_1000012911 334
163 3300031240 Ga0265320_10000209 Ga0265320_100002094 334
164 3300031241 Ga0265325_10009469 Ga0265325_100094692 334
165 3300031250 Ga0265331_10024083 Ga0265331_100240832 334
166 3300031548 Ga0307408_100191015 Ga0307408_1001910152 334
167 3300031711 Ga0265314_10000727 Ga0265314_1000072731 334
168 3300031711 Ga0265314_10009402 Ga0265314_100094023 334
169 3300031730 Ga0307516_10003736 Ga0307516_1000373616 334
170 3300035170 Ga0373943_0012746 Ga0373943_0012746_2754_3761 334
171 3300035172 Ga0373955_0178272 Ga0373955_0178272_224_1234 334
172 3300037068 Ga0373925_0016762 Ga0373925_0016762_3524_4531 334
173 3300037418 Ga0395900_0000355 Ga0395900_0000355_48470_49474 334
174 3300037466 Ga0395898_0000758 Ga0395898_0000758_37528_38532 334
175 3300037466 Ga0395898_0070441 Ga0395898_0070441_2331_3335 334
176 3300037471 Ga0395905_0014754 Ga0395905_0014754_3741_4751 334
177 3300037471 Ga0395905_0025882 Ga0395905_0025882_3131_4135 334
178 3300037471 Ga0395905_0032604 Ga0395905_0032604_1196_2200 334
179 3300038443 Ga0395901_0245693 Ga0395901_0245693_535_1539 334
180 3300039447 Ga0436361_0553366 Ga0436361_0553366_637_1692 334
181 3300042127 Ga0450890_007358 Ga0450890_007358_157_1161 334
182 3300042129 Ga0450891_005138 Ga0450891_005138_22_1026 334
183 3300044656 Ga0466969_0000039 Ga0466969_0000039_56989_57993 334
184 3300044656 Ga0466969_0003203 Ga0466969_0003203_6411_7415 334
185 3300044683 Ga0466965_0019211 Ga0466965_0019211_1349_2377 334
186 3300044684 Ga0466966_0000676 Ga0466966_0000676_4112_5116 334
187 3300044684 Ga0466966_0040480 Ga0466966_0040480_1488_2516 334
188 3300044684 Ga0466966_0098462 Ga0466966_0098462_284_1288 334
189 3300044693 Ga0466961_0064035 Ga0466961_0064035_1076_2104 334
190 3300044693 Ga0466961_0093859 Ga0466961_0093859_10_1068 334
191 3300044706 Ga0466964_0003241 Ga0466964_0003241_3708_4736 334
192 3300044735 Ga0466968_0083177 Ga0466968_0083177_22_1047 334
193 3300044765 Ga0466970_0030575 Ga0466970_0030575_541_1599 334
194 3300044765 Ga0466970_0091641 Ga0466970_0091641_485_1489 334
195 3300044901 Ga0466960_0069346 Ga0466960_0069346_477_1502 334
196 3300045049 Ga0466959_0000101 Ga0466959_0000101_37611_38639 334
197 3300045049 Ga0466959_0018679 Ga0466959_0018679_272_1276 334
198 3300045976 Ga0466967_0052924 Ga0466967_0052924_1450_2478 334
199 3300046460 Ga0495638_0073961 Ga0495638_0073961_220_1224 334
200 3300046473 Ga0495582_0011673 Ga0495582_0011673_3176_4180 334
201 3300046683 Ga0495658_0005181 Ga0495658_0005181_2866_3870 334
202 3300047472 Ga0495686_0008398 Ga0495686_0008398_3040_4044 334
203 3300048923 Ga0496120_0177119 Ga0496120_0177119_12_1022 334
204 3300048927 Ga0496124_0001876 Ga0496124_0001876_18135_19139 334
205 3300048929 Ga0496126_0000406 Ga0496126_0000406_3526_4530 334
206 3300049570 Ga0501033_0024115 Ga0501033_0024115_205_1209 334
207 3300049573 Ga0501037_0011674 Ga0501037_0011674_2409_3413 334
208 3300049581 Ga0501047_0132277 Ga0501047_0132277_186_1199 334
209 3300049742 Ga0501080_0128459 Ga0501080_0128459_144_1148 334
210 3300049822 Ga0501035_0003863 Ga0501035_0003863_5748_6752 334
211 3300049822 Ga0501035_0012664 Ga0501035_0012664_2472_3476 334
212 3300049822 Ga0501035_0226102 Ga0501035_0226102_464_1471 334
213 3300049823 Ga0501044_0002266 Ga0501044_0002266_14291_15295 334
214 3300049823 Ga0501044_0172380 Ga0501044_0172380_1035_2039 334
215 3300053080 Ga0500635_0000219 Ga0500635_0000219_9944_10948 334
216 3300053136 Ga0500559_0008778 Ga0500559_0008778_3206_4210 334
217 3300053156 Ga0500622_0014679 Ga0500622_0014679_994_1998 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

32

333

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8037 35 331
1jt2-assembly1.cif.gz_A structural basis for the substrate specificity of the ferul domain of the cellulosomal xylanase z from c. thermocellum 0.7927 4 332
7b6b-assembly1.cif.gz_A the carbohydrate binding module family 48 (cbm48) and carboxy-terminal carbohydrate esterase family 1 (ce1) domains of the multidomain esterase dmce1b from dysgonomonas mossii in complex with methyl ferulate 0.7879 2 330
7b5v-assembly1.cif.gz_B the carbohydrate binding module family 48 (cbm48) and carboxy-terminal carbohydrate esterase family 1 (ce1) domains of the multidomain esterase dmce1b from dysgonomonas mossii 0.7871 2 332
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.777 35 331
ID Description Score Start End Superfamily
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8037 35 331 3.40.50.1820
1jt2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7927 4 332 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.777 35 331 3.40.50.1820
2uz0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7703 9 331 3.40.50.1820
1jt2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7375 4 332 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3C0MI37-F1-model_v4 Enterochelin esterase 0.9819 95 291
AF-A0A1H0E8W8-F1-model_v4 deleted 0.9691 1 334
AF-A0A2D8W6M8-F1-model_v4 deleted 0.9689 1 280
AF-A0A1I5D7G9-F1-model_v4 Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase 0.9688 1 333 GO:0016020
GO:0016757
AF-A0A2D8W6M8-F1-model_v4 deleted 0.9655 1 280

Feature Viewer

pLDDT pTM Quality
90.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map