F329236

General Info

Members Datasets Scaffolds Average Seq Length
217 137 217 281

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0000094|Ga0501032_0000094_5164_6120
Length 318
Sequence MPLPNAPRHGDSKKIGRRKNEIRLARNRAGSQSRRMSFANPSFKGWTKPGPVPPGALGHGPALEPGETLDAISGYYRLFQLADGHRFSTDDVLTAWYGTLACPTAQTALDLGSGIGTVGMIAAWRLPGARFVTVEAQAESVRLARKSAAWNGLTDRYDIRHGDLRDPSILRPDETFDLVLGSPPYFPPGSGGESEHPQKLACRFELRGTVADYCATASRHLAPGGVFACVFPVDPEAQHARARAAARDAGLAIVRWRPIILRTGARPLLGLFAMMRAADLPAHLHAAPWEEPPLTIRTEAGAVTAEYTAIKLTFGFPP

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
91 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
92 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
93 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
94 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1000110 3300002155 Bacteria 11241
2 rootH2_10000452 3300003320 Bacteria 89382
3 Ga0070690_100022964 3300005330 Bacteria 3821
4 Ga0070670_100027109 3300005331 Bacteria 4928
5 Ga0070670_100354530 3300005331 Unclassified 1289
6 Ga0070677_10068537 3300005333 Bacteria 1485
7 Ga0070680_100262536 3300005336 Bacteria 1461
8 Ga0070660_100331489 3300005339 Bacteria 1251
9 Ga0070689_100004516 3300005340 Bacteria 9424
10 Ga0070689_100047228 3300005340 Bacteria 3319
11 Ga0070691_10026658 3300005341 Bacteria 2695
12 Ga0070691_10058599 3300005341 Unclassified 1849
13 Ga0070687_100286788 3300005343 Unclassified 1039
14 Ga0070661_100002044 3300005344 Bacteria 13912
15 Ga0070692_10017759 3300005345 Bacteria 3409
16 Ga0070668_100067691 3300005347 Bacteria 2775
17 Ga0070669_100001115 3300005353 Bacteria 19624
18 Ga0070669_100097055 3300005353 Bacteria 2218
19 Ga0070669_100107671 3300005353 Bacteria 2112
20 Ga0070669_100338109 3300005353 Unclassified 1219
21 Ga0070675_100003437 3300005354 Bacteria 12002
22 Ga0070675_100064880 3300005354 Bacteria 3019
23 Ga0070675_100239028 3300005354 Bacteria 1587
24 Ga0070674_100102457 3300005356 Bacteria 2088
25 Ga0070688_100008837 3300005365 Bacteria 5483
26 Ga0070688_100083375 3300005365 Bacteria 2074
27 Ga0070688_100256053 3300005365 Unclassified 1248
28 Ga0070701_10040961 3300005438 Bacteria 2358
29 Ga0070705_100000348 3300005440 Bacteria 27304
30 Ga0070705_100005509 3300005440 Bacteria 6173
31 Ga0070705_100216533 3300005440 Bacteria 1323
32 Ga0070694_100000451 3300005444 Bacteria 22467
33 Ga0070694_100001389 3300005444 Bacteria 14158
34 Ga0070694_100316713 3300005444 Bacteria 1199
35 Ga0068867_100001573 3300005459 Bacteria 15866
36 Ga0068867_100319273 3300005459 Unclassified 1286
37 Ga0070706_100594110 3300005467 Unclassified 1029
38 Ga0070707_100461414 3300005468 Bacteria 1231
39 Ga0070698_100004008 3300005471 Bacteria 16211
40 Ga0070699_100020775 3300005518 Bacteria 5662
41 Ga0070699_100044475 3300005518 Bacteria 3844
42 Ga0070699_100099714 3300005518 Bacteria 2545
43 Ga0070679_100423318 3300005530 Bacteria 1277
44 Ga0070684_100069172 3300005535 Bacteria 3105
45 Ga0070697_100153853 3300005536 Bacteria 1940
46 Ga0070686_100021310 3300005544 Unclassified 3850
47 Ga0070686_100076434 3300005544 Bacteria 2205
48 Ga0070695_100001840 3300005545 Bacteria 11962
49 Ga0070695_100062776 3300005545 Bacteria 2413
50 Ga0070704_100001875 3300005549 Bacteria 11579
51 Ga0070704_100024994 3300005549 Bacteria 3927
52 Ga0070704_100034271 3300005549 Bacteria 3441
53 Ga0070704_100123586 3300005549 Bacteria 1993
54 Ga0070664_100059235 3300005564 Bacteria 3257
55 Ga0068857_100003685 3300005577 Bacteria 12846
56 Ga0070702_100025025 3300005615 Bacteria 3193
57 Ga0068859_100006126 3300005617 Bacteria 12221
58 Ga0068864_100054735 3300005618 Bacteria 3444
59 Ga0068861_100003223 3300005719 Bacteria 10795
60 Ga0068862_100003823 3300005844 Bacteria 12823
61 Ga0068862_100537033 3300005844 Bacteria 1115
62 Ga0081539_10003889 3300005985 Bacteria 17416
63 Ga0081539_10004921 3300005985 Bacteria 14226
64 Ga0068871_100164178 3300006358 Bacteria 1900
65 Ga0075428_100001453 3300006844 Bacteria 25347
66 Ga0075428_100011164 3300006844 Bacteria 9995
67 Ga0075428_100034245 3300006844 Bacteria 5603
68 Ga0075428_100118677 3300006844 Bacteria 2881
69 Ga0075428_100289270 3300006844 Bacteria 1763
70 Ga0075433_10004299 3300006852 Bacteria 11065
71 Ga0075433_10080570 3300006852 Bacteria 2870
72 Ga0075433_10124901 3300006852 Bacteria 2285
73 Ga0075433_10171119 3300006852 Unclassified 1933
74 Ga0075433_10401952 3300006852 Unclassified 1208
75 Ga0075434_100002167 3300006871 Bacteria 17117
76 Ga0075434_100049924 3300006871 Bacteria 4155
77 Ga0075434_100209077 3300006871 Bacteria 1972
78 Ga0075434_100303878 3300006871 Bacteria 1616
79 Ga0075429_100113461 3300006880 Bacteria 2369
80 Ga0075429_100197224 3300006880 Bacteria 1763
81 Ga0075429_100350170 3300006880 Bacteria 1293
82 Ga0097620_100006127 3300006931 Bacteria 12221
83 Ga0075435_100025264 3300007076 Bacteria 4623
84 Ga0075435_100111181 3300007076 Bacteria 2279
85 Ga0111539_10003230 3300009094 Bacteria 21559
86 Ga0111539_10049223 3300009094 Bacteria 5027
87 Ga0111539_10144988 3300009094 Unclassified 2780
88 Ga0111539_10231481 3300009094 Unclassified 2152
89 Ga0111539_10297866 3300009094 Bacteria 1877
90 Ga0114129_10000309 3300009147 Bacteria 56974
91 Ga0114129_10002563 3300009147 Bacteria 25231
92 Ga0114129_10044331 3300009147 Bacteria 6257
93 Ga0114129_11162359 3300009147 Bacteria 963
94 Ga0105243_10073184 3300009148 Bacteria 2776
95 Ga0105243_10363339 3300009148 Unclassified 1333
96 Ga0105242_10074063 3300009176 Bacteria 2832
97 Ga0105249_10012526 3300009553 Bacteria 7475
98 Ga0157374_10017478 3300013296 Bacteria 6317
99 Ga0157375_10017782 3300013308 Bacteria 6428
100 Ga0157375_10197861 3300013308 Bacteria 2165
101 Ga0157380_10263303 3300014326 Unclassified 1567
102 Ga0157377_10022043 3300014745 Bacteria 3359
103 Ga0157376_10031523 3300014969 Bacteria 4247
104 Ga0157376_10154287 3300014969 Bacteria 2074
105 Ga0213876_10001739 3300021384 Bacteria 13215
106 Ga0207645_10193482 3300025907 Bacteria 1337
107 Ga0207643_10017183 3300025908 Bacteria 3952
108 Ga0207684_10185463 3300025910 Bacteria 1794
109 Ga0207662_10178873 3300025918 Bacteria 1364
110 Ga0207649_10000215 3300025920 Bacteria 47922
111 Ga0207649_10250248 3300025920 Bacteria 1276
112 Ga0207652_10591490 3300025921 Unclassified 995
113 Ga0207646_10425339 3300025922 Bacteria 1199
114 Ga0207681_10078576 3300025923 Bacteria 2322
115 Ga0207681_10161135 3300025923 Bacteria 1691
116 Ga0207681_10325367 3300025923 Unclassified 1224
117 Ga0207681_10389823 3300025923 Bacteria 1123
118 Ga0207650_10017580 3300025925 Bacteria 5008
119 Ga0207659_10005782 3300025926 Bacteria 7536
120 Ga0207706_10063187 3300025933 Bacteria 3260
121 Ga0207686_10547119 3300025934 Unclassified 904
122 Ga0207709_10021649 3300025935 Bacteria 3640
123 Ga0207670_10035247 3300025936 Bacteria 3243
124 Ga0207669_10131531 3300025937 Bacteria 1720
125 Ga0207669_10176728 3300025937 Unclassified 1526
126 Ga0207651_10027861 3300025960 Bacteria 3556
127 Ga0207651_10165024 3300025960 Bacteria 1740
128 Ga0207651_10202642 3300025960 Bacteria 1591
129 Ga0207708_10019858 3300026075 Bacteria 5065
130 Ga0207648_10000280 3300026089 Bacteria 55313
131 Ga0207676_10093455 3300026095 Bacteria 2476
132 Ga0207674_10017958 3300026116 Bacteria 7708
133 Ga0207674_10187167 3300026116 Bacteria 2020
134 Ga0207675_100009140 3300026118 Bacteria 9295
135 Ga0207675_100110757 3300026118 Unclassified 2590
136 Ga0207683_10075187 3300026121 Bacteria 2990
137 Ga0207683_10166167 3300026121 Bacteria 1997
138 Ga0207683_10357349 3300026121 Unclassified 1341
139 Ga0207428_10001397 3300027907 Bacteria 25490
140 Ga0268265_10002747 3300028380 Bacteria 12988
141 Ga0265338_10034972 3300028800 Bacteria 4841
142 Ga0265339_10011082 3300031249 Bacteria 5567
143 Ga0265316_10090070 3300031344 Bacteria 2341
144 Ga0307410_10379225 3300031852 Unclassified 1137
145 Ga0307407_10023639 3300031903 Bacteria 3209
146 Ga0307409_100170507 3300031995 Bacteria 1915
147 Ga0307414_10243594 3300032004 Bacteria 1490
148 Ga0307411_10432849 3300032005 Unclassified 1096
149 Ga0373930_0000360 3300034816 Bacteria 5953
150 Ga0373950_0003305 3300034818 Bacteria 2296
151 Ga0373959_0032539 3300034820 Bacteria 1060
152 Ga0373928_0000004 3300035084 Bacteria 45792
153 Ga0373929_0001855 3300035085 Bacteria 3962
154 Ga0373944_0000599 3300035089 Bacteria 8565
155 Ga0373951_0001415 3300035091 Bacteria 6299
156 Ga0373932_0000001 3300035112 Bacteria 1459067
157 Ga0373939_0030459 3300035114 Bacteria 1552
158 Ga0373946_0011383 3300035171 Bacteria 3319
159 Ga0373962_0000077 3300035242 Bacteria 21547
160 Ga0373931_0000002 3300035691 Bacteria 599830
161 Ga0373935_0155412 3300035692 Bacteria 1555
162 Ga0373947_0008733 3300035725 Bacteria 5826
163 Ga0373925_0000077 3300037068 Bacteria 105383
164 Ga0436365_1282409 3300039437 Bacteria 17174
165 Ga0451793_0926000 3300041452 Bacteria 961
166 Ga0451845_0860812 3300041501 Bacteria 1080
167 Ga0451577_0006180 3300042876 Bacteria 12035
168 Ga0451577_0057007 3300042876 Bacteria 3484
169 Ga0453683_0088124 3300044673 Bacteria 1945
170 Ga0453684_0002113 3300044712 Bacteria 50156
171 Ga0451576_0052066 3300045051 Bacteria 4290
172 Ga0451576_0058650 3300045051 Bacteria 4022
173 Ga0451576_0090065 3300045051 Bacteria 3191
174 Ga0495603_0004490 3300046455 Bacteria 8325
175 Ga0495580_0222791 3300046472 Bacteria 1296
176 Ga0495580_0351659 3300046472 Unclassified 998
177 Ga0495584_0151100 3300046491 Bacteria 1180
178 Ga0495584_0216961 3300046491 Bacteria 972
179 Ga0495642_0003535 3300046528 Bacteria 6159
180 Ga0495598_0075798 3300046537 Unclassified 1069
181 Ga0495609_0067133 3300046538 Bacteria 1580
182 Ga0495621_0000307 3300046539 Bacteria 11836
183 Ga0495621_0008532 3300046539 Unclassified 3078
184 Ga0495621_0058143 3300046539 Bacteria 1398
185 Ga0495659_0003960 3300046664 Unclassified 4689
186 Ga0495659_0016716 3300046664 Bacteria 2423
187 Ga0495659_0044680 3300046664 Bacteria 1594
188 Ga0495647_0179849 3300046681 Bacteria 920
189 Ga0495658_0005844 3300046683 Bacteria 6041
190 Ga0495669_0017400 3300046684 Bacteria 3086
191 Ga0495677_0119910 3300047445 Unclassified 1003
192 Ga0501032_0000094 3300049569 Bacteria 76448
193 Ga0501033_0000002 3300049570 Bacteria 668574
194 Ga0501034_0214599 3300049571 Bacteria 1879
195 Ga0501034_0300121 3300049571 Bacteria 1543
196 Ga0501038_0000370 3300049574 Bacteria 38795
197 Ga0501067_0063204 3300049583 Bacteria 2050
198 Ga0501067_0068098 3300049583 Bacteria 1971
199 Ga0501068_0095949 3300049584 Bacteria 1834
200 Ga0501083_0000919 3300049744 Bacteria 19524
201 nmdc:mga05p37_11462_c1 3300050507 Bacteria 10560
202 nmdc:mga05p37_13511_c1 3300050507 Bacteria 9786
203 nmdc:mga09592_187918_c1 3300050508 Bacteria 1788
204 nmdc:mga09592_87342_c1 3300050508 Bacteria 1599
205 nmdc:mga0qj67_157073_c1 3300050509 Bacteria 1846
206 nmdc:mga08y16_23595_c1 3300050511 Bacteria 6497
207 nmdc:mga08y16_351009_c1 3300050511 Unclassified 1515
208 nmdc:mga0n895_364719_c1 3300050512 Bacteria 1463
209 nmdc:mga0n895_4796_c1 3300050512 Bacteria 11195
210 nmdc:mga0n895_64284_c1 3300050512 Bacteria 3629
211 nmdc:mga0rr50_352316_c1 3300050513 Bacteria 1238
212 nmdc:mga0rr50_4512_c1 3300050513 Bacteria 8198
213 nmdc:mga0a205_161634_c1 3300050515 Bacteria 2136
214 nmdc:mga0a205_18761_c1 3300050515 Bacteria 6511
215 nmdc:mga0a205_332613_c1 3300050515 Unclassified 1389
216 nmdc:mga0a205_41253_c1 3300050515 Bacteria 4444
217 nmdc:mga0a205_60232_c1 3300050515 Bacteria 3667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100003437 Ga0070675_1000034374 252
2 3300005844 Ga0068862_100537033 Ga0068862_1005370332 252
3 3300025923 Ga0207681_10389823 Ga0207681_103898231 252
4 3300050511 nmdc:mga08y16_351009_c1 nmdc:mga08y16_351009_c1_106_876 256
5 3300005440 Ga0070705_100005509 Ga0070705_1000055092 257
6 3300005444 Ga0070694_100001389 Ga0070694_1000013895 257
7 3300005471 Ga0070698_100004008 Ga0070698_1000040087 257
8 3300005518 Ga0070699_100020775 Ga0070699_1000207753 257
9 3300006852 Ga0075433_10080570 Ga0075433_100805702 257
10 3300050515 nmdc:mga0a205_18761_c1 nmdc:mga0a205_18761_c1_4960_5814 257
11 3300026121 Ga0207683_10075187 Ga0207683_100751872 258
12 3300005549 Ga0070704_100034271 Ga0070704_1000342711 259
13 3300005353 Ga0070669_100097055 Ga0070669_1000970553 261
14 3300005354 Ga0070675_100064880 Ga0070675_1000648803 261
15 3300005356 Ga0070674_100102457 Ga0070674_1001024572 261
16 3300025923 Ga0207681_10161135 Ga0207681_101611351 261
17 3300025926 Ga0207659_10005782 Ga0207659_100057822 261
18 3300025937 Ga0207669_10131531 Ga0207669_101315312 261
19 3300009094 Ga0111539_10297866 Ga0111539_102978663 262
20 3300006852 Ga0075433_10004299 Ga0075433_100042991 263
21 3300006880 Ga0075429_100113461 Ga0075429_1001134612 263
22 3300034820 Ga0373959_0032539 Ga0373959_0032539_19_852 263
23 3300046472 Ga0495580_0351659 Ga0495580_0351659_101_892 263
24 3300046681 Ga0495647_0179849 Ga0495647_0179849_37_828 263
25 3300050508 nmdc:mga09592_87342_c1 nmdc:mga09592_87342_c1_153_995 263
26 3300050515 nmdc:mga0a205_60232_c1 nmdc:mga0a205_60232_c1_1161_1952 263
27 3300045051 Ga0451576_0052066 Ga0451576_0052066_3192_4043 264
28 3300006844 Ga0075428_100289270 Ga0075428_1002892701 265
29 3300013308 Ga0157375_10017782 Ga0157375_100177821 265
30 3300025933 Ga0207706_10063187 Ga0207706_100631872 265
31 3300025960 Ga0207651_10165024 Ga0207651_101650241 265
32 3300005985 Ga0081539_10003889 Ga0081539_1000388915 266
33 3300025923 Ga0207681_10078576 Ga0207681_100785762 266
34 3300026121 Ga0207683_10357349 Ga0207683_103573492 266
35 3300046537 Ga0495598_0075798 Ga0495598_0075798_152_994 266
36 3300046539 Ga0495621_0008532 Ga0495621_0008532_2194_3036 266
37 3300005615 Ga0070702_100025025 Ga0070702_1000250252 267
38 3300005985 Ga0081539_10004921 Ga0081539_100049213 267
39 3300031852 Ga0307410_10379225 Ga0307410_103792251 267
40 3300031903 Ga0307407_10023639 Ga0307407_100236393 267
41 3300032004 Ga0307414_10243594 Ga0307414_102435942 267
42 3300032005 Ga0307411_10432849 Ga0307411_104328491 267
43 3300046491 Ga0495584_0216961 Ga0495584_0216961_151_954 267
44 3300046528 Ga0495642_0003535 Ga0495642_0003535_2126_2929 267
45 3300025960 Ga0207651_10202642 Ga0207651_102026422 268
46 3300050513 nmdc:mga0rr50_352316_c1 nmdc:mga0rr50_352316_c1_14_820 268
47 3300014326 Ga0157380_10263303 Ga0157380_102633031 269
48 3300021384 Ga0213876_10001739 Ga0213876_100017394 273
49 3300039437 Ga0436365_1282409 Ga0436365_1282409_1990_2829 273
50 3300005468 Ga0070707_100461414 Ga0070707_1004614142 274
51 3300005544 Ga0070686_100021310 Ga0070686_1000213102 274
52 3300025922 Ga0207646_10425339 Ga0207646_104253392 274
53 3300031344 Ga0265316_10090070 Ga0265316_100900703 274
54 3300005535 Ga0070684_100069172 Ga0070684_1000691722 275
55 3300005564 Ga0070664_100059235 Ga0070664_1000592352 275
56 3300006871 Ga0075434_100049924 Ga0075434_1000499242 275
57 3300007076 Ga0075435_100025264 Ga0075435_1000252642 275
58 3300041452 Ga0451793_0926000 Ga0451793_0926000_10_843 275
59 3300046538 Ga0495609_0067133 Ga0495609_0067133_87_914 275
60 3300046664 Ga0495659_0003960 Ga0495659_0003960_3003_3830 275
61 3300046684 Ga0495669_0017400 Ga0495669_0017400_1263_2090 275
62 3300047445 Ga0495677_0119910 Ga0495677_0119910_28_855 275
63 3300050512 nmdc:mga0n895_4796_c1 nmdc:mga0n895_4796_c1_1419_2246 275
64 3300050513 nmdc:mga0rr50_4512_c1 nmdc:mga0rr50_4512_c1_1045_1872 275
65 3300005331 Ga0070670_100354530 Ga0070670_1003545302 276
66 3300005353 Ga0070669_100107671 Ga0070669_1001076711 276
67 3300005444 Ga0070694_100316713 Ga0070694_1003167131 276
68 3300005459 Ga0068867_100319273 Ga0068867_1003192732 276
69 3300005545 Ga0070695_100062776 Ga0070695_1000627763 276
70 3300006844 Ga0075428_100001453 Ga0075428_10000145313 276
71 3300009094 Ga0111539_10003230 Ga0111539_1000323016 276
72 3300013308 Ga0157375_10197861 Ga0157375_101978612 276
73 3300028800 Ga0265338_10034972 Ga0265338_100349723 276
74 3300031995 Ga0307409_100170507 Ga0307409_1001705071 276
75 3300042876 Ga0451577_0057007 Ga0451577_0057007_708_1586 276
76 3300044673 Ga0453683_0088124 Ga0453683_0088124_751_1611 276
77 3300005330 Ga0070690_100022964 Ga0070690_1000229642 277
78 3300006880 Ga0075429_100197224 Ga0075429_1001972242 277
79 3300009147 Ga0114129_10044331 Ga0114129_100443316 277
80 3300025934 Ga0207686_10547119 Ga0207686_105471191 277
81 3300025960 Ga0207651_10027861 Ga0207651_100278612 277
82 3300034816 Ga0373930_0000360 Ga0373930_0000360_4450_5331 277
83 3300034818 Ga0373950_0003305 Ga0373950_0003305_624_1505 277
84 3300035084 Ga0373928_0000004 Ga0373928_0000004_29706_30587 277
85 3300035085 Ga0373929_0001855 Ga0373929_0001855_1154_2035 277
86 3300035089 Ga0373944_0000599 Ga0373944_0000599_4072_4953 277
87 3300035091 Ga0373951_0001415 Ga0373951_0001415_5349_6230 277
88 3300035112 Ga0373932_0000001 Ga0373932_0000001_896208_897089 277
89 3300035171 Ga0373946_0011383 Ga0373946_0011383_1743_2624 277
90 3300035242 Ga0373962_0000077 Ga0373962_0000077_19962_20843 277
91 3300035691 Ga0373931_0000002 Ga0373931_0000002_598309_599190 277
92 3300035692 Ga0373935_0155412 Ga0373935_0155412_105_986 277
93 3300035725 Ga0373947_0008733 Ga0373947_0008733_1079_1960 277
94 3300037068 Ga0373925_0000077 Ga0373925_0000077_36889_37770 277
95 3300005331 Ga0070670_100027109 Ga0070670_1000271092 278
96 3300005336 Ga0070680_100262536 Ga0070680_1002625362 278
97 3300005340 Ga0070689_100047228 Ga0070689_1000472282 278
98 3300005343 Ga0070687_100286788 Ga0070687_1002867882 278
99 3300005347 Ga0070668_100067691 Ga0070668_1000676912 278
100 3300005353 Ga0070669_100001115 Ga0070669_1000011157 278
101 3300005354 Ga0070675_100239028 Ga0070675_1002390282 278
102 3300005365 Ga0070688_100083375 Ga0070688_1000833752 278
103 3300005459 Ga0068867_100001573 Ga0068867_1000015732 278
104 3300005467 Ga0070706_100594110 Ga0070706_1005941101 278
105 3300005518 Ga0070699_100099714 Ga0070699_1000997142 278
106 3300005530 Ga0070679_100423318 Ga0070679_1004233182 278
107 3300005536 Ga0070697_100153853 Ga0070697_1001538532 278
108 3300005544 Ga0070686_100076434 Ga0070686_1000764342 278
109 3300005549 Ga0070704_100001875 Ga0070704_10000187510 278
110 3300005577 Ga0068857_100003685 Ga0068857_1000036854 278
111 3300005617 Ga0068859_100006126 Ga0068859_10000612611 278
112 3300005618 Ga0068864_100054735 Ga0068864_1000547352 278
113 3300005719 Ga0068861_100003223 Ga0068861_1000032238 278
114 3300005844 Ga0068862_100003823 Ga0068862_1000038232 278
115 3300006358 Ga0068871_100164178 Ga0068871_1001641782 278
116 3300006844 Ga0075428_100118677 Ga0075428_1001186772 278
117 3300006852 Ga0075433_10171119 Ga0075433_101711192 278
118 3300006871 Ga0075434_100209077 Ga0075434_1002090772 278
119 3300006871 Ga0075434_100303878 Ga0075434_1003038782 278
120 3300006880 Ga0075429_100350170 Ga0075429_1003501702 278
121 3300006931 Ga0097620_100006127 Ga0097620_1000061272 278
122 3300009147 Ga0114129_10000309 Ga0114129_1000030940 278
123 3300009147 Ga0114129_11162359 Ga0114129_111623591 278
124 3300009553 Ga0105249_10012526 Ga0105249_100125269 278
125 3300014745 Ga0157377_10022043 Ga0157377_100220433 278
126 3300014969 Ga0157376_10031523 Ga0157376_100315232 278
127 3300014969 Ga0157376_10154287 Ga0157376_101542872 278
128 3300025907 Ga0207645_10193482 Ga0207645_101934822 278
129 3300025908 Ga0207643_10017183 Ga0207643_100171832 278
130 3300025910 Ga0207684_10185463 Ga0207684_101854632 278
131 3300025918 Ga0207662_10178873 Ga0207662_101788732 278
132 3300025920 Ga0207649_10250248 Ga0207649_102502482 278
133 3300025921 Ga0207652_10591490 Ga0207652_105914901 278
134 3300025925 Ga0207650_10017580 Ga0207650_100175802 278
135 3300025937 Ga0207669_10176728 Ga0207669_101767282 278
136 3300026075 Ga0207708_10019858 Ga0207708_100198582 278
137 3300026089 Ga0207648_10000280 Ga0207648_1000028032 278
138 3300026095 Ga0207676_10093455 Ga0207676_100934553 278
139 3300026116 Ga0207674_10017958 Ga0207674_100179584 278
140 3300026116 Ga0207674_10187167 Ga0207674_101871672 278
141 3300026118 Ga0207675_100009140 Ga0207675_1000091402 278
142 3300026118 Ga0207675_100110757 Ga0207675_1001107572 278
143 3300027907 Ga0207428_10001397 Ga0207428_1000139722 278
144 3300028380 Ga0268265_10002747 Ga0268265_100027472 278
145 3300035114 Ga0373939_0030459 Ga0373939_0030459_303_1283 278
146 3300041501 Ga0451845_0860812 Ga0451845_0860812_31_873 278
147 3300045051 Ga0451576_0058650 Ga0451576_0058650_2196_3176 278
148 3300046491 Ga0495584_0151100 Ga0495584_0151100_227_1069 278
149 3300046664 Ga0495659_0016716 Ga0495659_0016716_386_1228 278
150 3300049583 Ga0501067_0068098 Ga0501067_0068098_590_1432 278
151 3300049584 Ga0501068_0095949 Ga0501068_0095949_76_918 278
152 3300050507 nmdc:mga05p37_11462_c1 nmdc:mga05p37_11462_c1_9227_10069 278
153 3300050512 nmdc:mga0n895_64284_c1 nmdc:mga0n895_64284_c1_783_1694 278
154 3300050515 nmdc:mga0a205_161634_c1 nmdc:mga0a205_161634_c1_1082_1924 278
155 3300005341 Ga0070691_10026658 Ga0070691_100266582 279
156 3300005341 Ga0070691_10058599 Ga0070691_100585992 279
157 3300005345 Ga0070692_10017759 Ga0070692_100177592 279
158 3300005438 Ga0070701_10040961 Ga0070701_100409612 279
159 3300005440 Ga0070705_100000348 Ga0070705_10000034823 279
160 3300005444 Ga0070694_100000451 Ga0070694_10000045123 279
161 3300005518 Ga0070699_100044475 Ga0070699_1000444752 279
162 3300005545 Ga0070695_100001840 Ga0070695_1000018407 279
163 3300005549 Ga0070704_100024994 Ga0070704_1000249946 279
164 3300005549 Ga0070704_100123586 Ga0070704_1001235862 279
165 3300006844 Ga0075428_100011164 Ga0075428_1000111647 279
166 3300006852 Ga0075433_10124901 Ga0075433_101249012 279
167 3300006852 Ga0075433_10401952 Ga0075433_104019522 279
168 3300006871 Ga0075434_100002167 Ga0075434_10000216715 279
169 3300007076 Ga0075435_100111181 Ga0075435_1001111812 279
170 3300009147 Ga0114129_10002563 Ga0114129_100025634 279
171 3300009148 Ga0105243_10073184 Ga0105243_100731843 279
172 3300009148 Ga0105243_10363339 Ga0105243_103633392 279
173 3300009176 Ga0105242_10074063 Ga0105242_100740632 279
174 3300025935 Ga0207709_10021649 Ga0207709_100216492 279
175 3300042876 Ga0451577_0006180 Ga0451577_0006180_7673_8521 279
176 3300044712 Ga0453684_0002113 Ga0453684_0002113_26735_27583 279
177 3300046455 Ga0495603_0004490 Ga0495603_0004490_3522_4373 279
178 3300046472 Ga0495580_0222791 Ga0495580_0222791_417_1268 279
179 3300046539 Ga0495621_0000307 Ga0495621_0000307_10677_11531 279
180 3300046539 Ga0495621_0058143 Ga0495621_0058143_422_1276 279
181 3300046664 Ga0495659_0044680 Ga0495659_0044680_540_1439 279
182 3300049571 Ga0501034_0300121 Ga0501034_0300121_181_1032 279
183 3300050507 nmdc:mga05p37_13511_c1 nmdc:mga05p37_13511_c1_4108_4962 279
184 3300050508 nmdc:mga09592_187918_c1 nmdc:mga09592_187918_c1_680_1564 279
185 3300050512 nmdc:mga0n895_364719_c1 nmdc:mga0n895_364719_c1_243_1094 279
186 3300050515 nmdc:mga0a205_332613_c1 nmdc:mga0a205_332613_c1_32_886 279
187 3300050515 nmdc:mga0a205_41253_c1 nmdc:mga0a205_41253_c1_2137_2988 279
188 3300005340 Ga0070689_100004516 Ga0070689_1000045168 280
189 3300005365 Ga0070688_100008837 Ga0070688_1000088371 280
190 3300025936 Ga0207670_10035247 Ga0207670_100352471 280
191 3300031249 Ga0265339_10011082 Ga0265339_100110823 280
192 3300049571 Ga0501034_0214599 Ga0501034_0214599_683_1525 280
193 3300003320 rootH2_10000452 rootH2_1000045266 281
194 3300049574 Ga0501038_0000370 Ga0501038_0000370_16845_17690 281
195 3300049583 Ga0501067_0063204 Ga0501067_0063204_929_1774 281
196 3300002155 JGI24033J26618_1000110 JGI24033J26618_10001104 283
197 3300005333 Ga0070677_10068537 Ga0070677_100685372 283
198 3300005339 Ga0070660_100331489 Ga0070660_1003314892 283
199 3300005344 Ga0070661_100002044 Ga0070661_10000204412 283
200 3300005353 Ga0070669_100338109 Ga0070669_1003381092 283
201 3300005365 Ga0070688_100256053 Ga0070688_1002560531 283
202 3300005440 Ga0070705_100216533 Ga0070705_1002165332 283
203 3300006844 Ga0075428_100034245 Ga0075428_1000342456 283
204 3300009094 Ga0111539_10049223 Ga0111539_100492236 283
205 3300009094 Ga0111539_10144988 Ga0111539_101449882 283
206 3300009094 Ga0111539_10231481 Ga0111539_102314811 283
207 3300013296 Ga0157374_10017478 Ga0157374_100174784 283
208 3300025920 Ga0207649_10000215 Ga0207649_1000021517 283
209 3300025923 Ga0207681_10325367 Ga0207681_103253672 283
210 3300026121 Ga0207683_10166167 Ga0207683_101661672 283
211 3300045051 Ga0451576_0090065 Ga0451576_0090065_218_1141 283
212 3300046683 Ga0495658_0005844 Ga0495658_0005844_1743_2594 283
213 3300049569 Ga0501032_0000094 Ga0501032_0000094_5164_6120 283
214 3300049570 Ga0501033_0000002 Ga0501033_0000002_596659_597615 283
215 3300049744 Ga0501083_0000919 Ga0501083_0000919_3782_4633 283
216 3300050509 nmdc:mga0qj67_157073_c1 nmdc:mga0qj67_157073_c1_769_1620 283
217 3300050511 nmdc:mga08y16_23595_c1 nmdc:mga08y16_23595_c1_1695_2561 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

108

188

0.92

PF05175

MTS

Methyltransferase small domain

94

240

0.86

PF13847

Methyltransf_31

Methyltransferase domain

104

248

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wm6-assembly2.cif.gz_D crystal structure of sah-bound trmm from mycoplasma capricolum 0.8835 32 275
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8737 55 275
7wm6-assembly2.cif.gz_D crystal structure of sah-bound trmm from mycoplasma capricolum 0.8655 32 275
7wm6-assembly1.cif.gz_A crystal structure of sah-bound trmm from mycoplasma capricolum 0.8609 32 275
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8608 55 275
ID Description Score Start End Superfamily
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9282 72 126 3.40.50.150
af_Q54UI9_3_272_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8961 72 147 3.40.50.150
af_Q2G2X0_6_241_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8658 32 279 3.40.50.150
af_Q2G2X0_6_241_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8555 32 279 3.40.50.150
af_F7F172_79_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8535 69 128 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3C1VBS0-F1-model_v4 SAM-dependent methyltransferase 0.9705 27 283 GO:0008168
GO:0032259
AF-A0A7V4MG25-F1-model_v4 Methyltransferase domain-containing protein 0.9675 4 283 GO:0008168
GO:0032259
AF-A0A2V8GPJ6-F1-model_v4 SAM-dependent methyltransferase 0.9652 5 283 GO:0008168
GO:0032259
AF-A0A6I1K2Q5-F1-model_v4 Methyltransferase small 0.964 4 283 GO:0008168
GO:0032259
AF-A0A2V8GPJ6-F1-model_v4 SAM-dependent methyltransferase 0.9584 5 283 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
89.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map