F329271

General Info

Members Datasets Scaffolds Average Seq Length
217 132 434 237

Family's Representative Sequence

Representative Sequence 3300049763|Ga0501266_000007|Ga0501266_000007_106565_107401
Length 278
Sequence LQTLRKSLRTLRLNYSQKKNRIDFGKIRNNRIFASQNKKLVMGRAFEFRKGRKMKRWSAMAKTFTRIGKDIVMAVKEGGPNPDANSRLRAVIQNAKAANMPKDNVERAIKNASNKDTANYKEILFEGYAPHGIAILIETASDNNNRTVANIRSYFNKCNGTMGTQGSVEFMFDHTCNFRIAKGNLDPEELELELIDFGAEEVFEDEDGILIYAPFGSFGALQKELENRGLEILSSGFERIPQITKELTEAQIADVEKLIEKIEEDDDVMNVYHTMKEE

Samples

Sample ID Description Type Environment
1 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
31 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
32 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
49 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
50 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
51 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
52 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
53 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
66 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
71 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
74 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
89 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
90 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
95 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
96 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
97 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
98 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
99 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
100 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
101 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
102 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
103 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
104 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
105 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
106 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
107 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
108 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
109 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
110 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
111 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
112 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
113 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
114 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
115 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
116 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
117 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
118 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
119 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
120 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
121 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
122 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
123 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
124 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
125 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
126 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
127 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
128 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
129 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
130 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
131 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
132 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.49
Metatranscriptomes 0.92
Isolates 16.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 2.3
Rhizoplane 0.92
Rhizosphere 79.26
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501266_000007 3300049763 Bacteria 291751
2 2214717169 2209111006 Bacteria 1009
3 rootH2_10090078 3300003320 Bacteria 3956
4 Ga0006562J51391_1004994 3300003578 Bacteria 3055
5 Ga0065714_10030957 3300005288 Bacteria 969
6 Ga0065714_10073664 3300005288 Bacteria 3151
7 Ga0065714_10117679 3300005288 Bacteria 1386
8 Ga0065704_10089831 3300005289 Bacteria 2829
9 Ga0065712_10138728 3300005290 Bacteria 1471
10 Ga0065715_10214245 3300005293 Bacteria 1300
11 Ga0070680_100002381 3300005336 Bacteria 13906
12 Ga0070667_100306259 3300005367 Unclassified 1431
13 Ga0070678_100337848 3300005456 Bacteria 1291
14 Ga0070693_100019463 3300005547 Bacteria 3559
15 Ga0097621_100018892 3300006237 Bacteria 5279
16 Ga0068871_100024912 3300006358 Bacteria 4646
17 Ga0099824_1012791 3300006942 Bacteria 8981
18 Ga0099826_10017550 3300006948 Bacteria 5407
19 Ga0105251_10178937 3300009011 Bacteria 955
20 Ga0105244_10000003 3300009036 Bacteria 494610
21 Ga0105237_10319944 3300009545 Unclassified 1555
22 Ga0157373_10000014 3300013100 Bacteria 185079
23 Ga0157373_10324943 3300013100 Bacteria 1095
24 Ga0157371_10013686 3300013102 Bacteria 6154
25 Ga0157371_10019027 3300013102 Bacteria 5069
26 Ga0157371_10107610 3300013102 Bacteria 1979
27 Ga0157371_10255009 3300013102 Bacteria 1264
28 Ga0157370_10000060 3300013104 Bacteria 116178
29 Ga0157370_10201089 3300013104 Bacteria 1848
30 Ga0157370_10212147 3300013104 Bacteria 1794
31 Ga0157369_10000766 3300013105 Bacteria 41505
32 Ga0157369_10189196 3300013105 Unclassified 2163
33 Ga0163162_10026195 3300013306 Bacteria 5763
34 Ga0163162_10897456 3300013306 Bacteria 1000
35 Ga0157376_10016667 3300014969 Bacteria 5585
36 Ga0157376_10030344 3300014969 Bacteria 4317
37 Ga0157376_10066405 3300014969 Bacteria 3049
38 Ga0157376_10536794 3300014969 Bacteria 1155
39 Ga0182006_1042681 3300015261 Bacteria 1775
40 Ga0163161_10000119 3300017792 Bacteria 74760
41 Ga0163161_10001302 3300017792 Bacteria 18594
42 Ga0163161_10034990 3300017792 Bacteria 3594
43 Ga0207655_1000010 3300025728 Bacteria 649325
44 Ga0207683_10376967 3300026121 Bacteria 1304
45 Ga0209281_1000156 3300027111 Bacteria 163207
46 Ga0209489_117946 3300027361 Bacteria 2985
47 Ga0209282_1036995 3300027666 Bacteria 2938
48 Ga0307515_10134757 3300028794 Bacteria 2694
49 Ga0265338_10001499 3300028800 Bacteria 37795
50 Ga0265338_10008013 3300028800 Bacteria 12930
51 Ga0265327_10031531 3300031251 Bacteria 2976
52 Ga0265327_10133076 3300031251 Bacteria 1168
53 Ga0307408_100000223 3300031548 Bacteria 60207
54 Ga0307408_100002987 3300031548 Bacteria 11706
55 Ga0307405_10000007 3300031731 Bacteria 348101
56 Ga0307405_10377609 3300031731 Bacteria 1102
57 Ga0307413_10000843 3300031824 Bacteria 10778
58 Ga0307410_10000072 3300031852 Bacteria 35421
59 Ga0307406_10000041 3300031901 Bacteria 74278
60 Ga0307407_10000225 3300031903 Bacteria 16830
61 Ga0307407_10080298 3300031903 Bacteria 1970
62 Ga0307412_10205918 3300031911 Bacteria 1497
63 Ga0307414_10000001 3300032004 Bacteria 1352954
64 Ga0307414_10010408 3300032004 Bacteria 5394
65 Ga0307411_10000005 3300032005 Bacteria 391311
66 Ga0307411_10109021 3300032005 Bacteria 1976
67 Ga0307411_10397089 3300032005 Bacteria 1139
68 Ga0307411_10622331 3300032005 Bacteria 931
69 Ga0316593_10026485 3300032168 Bacteria 1855
70 Ga0307510_10023070 3300033180 Bacteria 7219
71 Ga0316574_0138769 3300035398 Bacteria 1566
72 Ga0400483_012218 3300039062 Bacteria 61234
73 Ga0439447_002474 3300041407 Bacteria 6722
74 Ga0439453_0051319 3300041408 Bacteria 834
75 Ga0439466_0005812 3300041411 Bacteria 4701
76 Ga0451807_1142152 3300041486 Bacteria 1072
77 Ga0451837_0628369 3300041494 Bacteria 8268
78 Ga0451577_0000216 3300042876 Bacteria 119613
79 Ga0451577_0002766 3300042876 Bacteria 20299
80 Ga0451577_0019317 3300042876 Bacteria 6266
81 Ga0451577_0036664 3300042876 Bacteria 4414
82 Ga0451577_0057554 3300042876 Bacteria 3465
83 Ga0451577_0061587 3300042876 Bacteria 3347
84 Ga0451577_0094399 3300042876 Bacteria 2671
85 Ga0451577_0124435 3300042876 Bacteria 2310
86 Ga0451577_0170491 3300042876 Bacteria 1961
87 Ga0451577_0223569 3300042876 Bacteria 1702
88 Ga0451577_0515009 3300042876 Bacteria 1086
89 Ga0451577_0653679 3300042876 Bacteria 953
90 Ga0451577_0987127 3300042876 Unclassified 756
91 Ga0453683_0000101 3300044673 Bacteria 128396
92 Ga0453683_0001466 3300044673 Bacteria 20299
93 Ga0453683_0017959 3300044673 Bacteria 4543
94 Ga0453683_0039410 3300044673 Bacteria 2969
95 Ga0453683_0053411 3300044673 Bacteria 2528
96 Ga0453683_0165817 3300044673 Unclassified 1398
97 Ga0453683_0285529 3300044673 Bacteria 1054
98 Ga0453683_0311327 3300044673 Bacteria 1008
99 Ga0453683_0313663 3300044673 Bacteria 1004
100 Ga0453684_0000086 3300044712 Bacteria 397278
101 Ga0453684_0000553 3300044712 Bacteria 141396
102 Ga0453684_0001006 3300044712 Bacteria 91343
103 Ga0453684_0002011 3300044712 Bacteria 52058
104 Ga0453684_0003307 3300044712 Bacteria 36750
105 Ga0453684_0006518 3300044712 Bacteria 22114
106 Ga0453684_0007366 3300044712 Bacteria 20299
107 Ga0453684_0007718 3300044712 Bacteria 19651
108 Ga0453684_0011417 3300044712 Bacteria 14902
109 Ga0453684_0013019 3300044712 Archaea 13585
110 Ga0453684_0053388 3300044712 Bacteria 5275
111 Ga0453684_0132653 3300044712 Bacteria 2987
112 Ga0453684_0145700 3300044712 Unclassified 2821
113 Ga0453684_0245813 3300044712 Bacteria 2057
114 Ga0453684_0247219 3300044712 Bacteria 2050
115 Ga0453684_0265966 3300044712 Bacteria 1962
116 Ga0453684_0291361 3300044712 Unclassified 1858
117 Ga0453684_0327605 3300044712 Bacteria 1733
118 Ga0453684_0430945 3300044712 Bacteria 1471
119 Ga0453684_0511325 3300044712 Bacteria 1328
120 Ga0451576_0000083 3300045051 Bacteria 236908
121 Ga0451576_0002630 3300045051 Bacteria 26290
122 Ga0451576_0003112 3300045051 Bacteria 23266
123 Ga0451576_0003810 3300045051 Bacteria 20299
124 Ga0451576_0008125 3300045051 Bacteria 12360
125 Ga0451576_0019484 3300045051 Bacteria 7404
126 Ga0451576_0020740 3300045051 Bacteria 7152
127 Ga0451576_0030435 3300045051 Bacteria 5769
128 Ga0451576_0045554 3300045051 Bacteria 4619
129 Ga0451576_0136119 3300045051 Bacteria 2562
130 Ga0451576_0216996 3300045051 Bacteria 1997
131 Ga0451576_0918426 3300045051 Bacteria 918
132 Ga0451576_1100996 3300045051 Bacteria 831
133 Ga0495627_001652 3300046453 Bacteria 12384
134 Ga0495580_0094252 3300046472 Unclassified 2083
135 Ga0495606_0245285 3300046507 Bacteria 996
136 Ga0495616_0172971 3300046513 Bacteria 964
137 Ga0495632_0134618 3300046519 Bacteria 1149
138 Ga0495643_0001696 3300046522 Bacteria 19158
139 Ga0495652_0238840 3300046529 Unclassified 1354
140 Ga0495640_0080794 3300046533 Bacteria 2162
141 Ga0495587_0289210 3300046536 Unclassified 918
142 Ga0495587_0349935 3300046536 Bacteria 824
143 Ga0495625_0063213 3300046660 Bacteria 2614
144 Ga0495657_0202886 3300046675 Unclassified 1208
145 Ga0495658_0007601 3300046683 Bacteria 5374
146 Ga0495636_0030880 3300047318 Unclassified 2193
147 Ga0495684_0211740 3300047471 Bacteria 1425
148 Ga0496115_0054080 3300048918 Bacteria 3223
149 Ga0496116_0000041 3300048919 Bacteria 343299
150 Ga0496118_0253775 3300048921 Bacteria 997
151 Ga0496121_0078277 3300048924 Bacteria 2629
152 Ga0496124_0010486 3300048927 Bacteria 9377
153 Ga0496124_0108493 3300048927 Bacteria 2239
154 Ga0496124_0342421 3300048927 Bacteria 1061
155 Ga0496125_0000026 3300048928 Bacteria 397380
156 Ga0496125_0000177 3300048928 Bacteria 140730
157 Ga0496126_0005182 3300048929 Bacteria 15066
158 Ga0501031_0006344 3300049568 Bacteria 7712
159 Ga0501032_0019608 3300049569 Bacteria 4727
160 Ga0501032_0043550 3300049569 Bacteria 3039
161 Ga0501033_0000004 3300049570 Bacteria 441310
162 Ga0501034_0000375 3300049571 Bacteria 75945
163 Ga0501034_0071338 3300049571 Bacteria 3483
164 Ga0501036_0069407 3300049572 Bacteria 2981
165 Ga0501036_0406445 3300049572 Bacteria 1135
166 Ga0501037_0006121 3300049573 Bacteria 8790
167 Ga0501038_0027152 3300049574 Bacteria 5095
168 Ga0501039_0010819 3300049575 Bacteria 6952
169 Ga0501043_0025874 3300049579 Bacteria 4603
170 Ga0501223_000695 3300049663 Bacteria 8013
171 Ga0501249_000009 3300049679 Bacteria 173938
172 Ga0501241_001686 3300049758 Unclassified 4413
173 Ga0501035_0006105 3300049822 Bacteria 11339
174 Ga0501035_0009600 3300049822 Bacteria 9000
175 Ga0501044_0001402 3300049823 Bacteria 28266
176 Ga0501045_0000430 3300049824 Bacteria 25674
177 Ga0500646_0004325 3300053090 Bacteria 3597
178 Ga0500646_0082257 3300053090 Bacteria 984
179 Ga0500641_0000006 3300053096 Bacteria 223991
180 Ga0500641_0000110 3300053096 Bacteria 31571
181 Ga0500658_0000008 3300053134 Bacteria 273324
182 2513236386 2513020052 Bacteria 5120511
183 2520878575 2519899754 Bacteria 5336938
184 2644011660 2643221600 Bacteria 5530138
185 2644370042 2643221667 Bacteria 5627472
186 2644642109 2643221716 Bacteria 4986332
187 2644685461 2643221725 Bacteria 5087956
188 2738736444 2738541279 Bacteria 6149495
189 2738768887 2738541285 Bacteria 6150075
190 2739218026 2738543007 Bacteria 6149845
191 2740003569 2739367857 Bacteria 5433684
192 2740008386 2739367858 Bacteria 5432813
193 2802653507 2802428842 Bacteria 4926114
194 2817415606 2816332280 Bacteria 5109718
195 2833643703 2833640130 Bacteria 4858325
196 2839992061 2839989709 Bacteria 3773432
197 2857614379 2857613821 Bacteria 4917088
198 2857619263 2857618242 Bacteria 5635925
199 2881249690 2881247448 Bacteria 3717788
200 2881362436 2881359912 Bacteria 4935907
201 2890806138 2890804823 Bacteria 3717572
202 2903898418 2903895155 Bacteria 5258610
203 2904423223 2904419702 Bacteria 5166287
204 2904556449 2904555929 Bacteria 5218588
205 2919193165 2919191525 Bacteria 5765973
206 2919512024 2919509842 Bacteria 4104664
207 2919687651 2919683626 Bacteria 5534354
208 2929152876 2929150217 Bacteria 5462483
209 2958463455 2958458903 Bacteria 5301041
210 2958515311 2958512119 Bacteria 4528530
211 2965321038 2965320100 Bacteria 3975600
212 2977269541 2977268062 Bacteria 5243061
213 8036738831 8036736890 Bacteria 2944828
214 8054308622 8054307821 Bacteria 5212224
215 8055421296 8055419101 Bacteria 5289643
216 8055594323 8055592153 Bacteria 5961247
217 8056441879 8056440228 Bacteria 4946504
218 Ga0501266_000007
219 2214717169
220 rootH2_10090078
221 Ga0006562J51391_1004994
222 Ga0065714_10030957
223 Ga0065714_10073664
224 Ga0065714_10117679
225 Ga0065704_10089831
226 Ga0065712_10138728
227 Ga0065715_10214245
228 Ga0070680_100002381
229 Ga0070667_100306259
230 Ga0070678_100337848
231 Ga0070693_100019463
232 Ga0097621_100018892
233 Ga0068871_100024912
234 Ga0099824_1012791
235 Ga0099826_10017550
236 Ga0105251_10178937
237 Ga0105244_10000003
238 Ga0105237_10319944
239 Ga0157373_10000014
240 Ga0157373_10324943
241 Ga0157371_10013686
242 Ga0157371_10019027
243 Ga0157371_10107610
244 Ga0157371_10255009
245 Ga0157370_10000060
246 Ga0157370_10201089
247 Ga0157370_10212147
248 Ga0157369_10000766
249 Ga0157369_10189196
250 Ga0163162_10026195
251 Ga0163162_10897456
252 Ga0157376_10016667
253 Ga0157376_10030344
254 Ga0157376_10066405
255 Ga0157376_10536794
256 Ga0182006_1042681
257 Ga0163161_10000119
258 Ga0163161_10001302
259 Ga0163161_10034990
260 Ga0207655_1000010
261 Ga0207683_10376967
262 Ga0209281_1000156
263 Ga0209489_117946
264 Ga0209282_1036995
265 Ga0307515_10134757
266 Ga0265338_10001499
267 Ga0265338_10008013
268 Ga0265327_10031531
269 Ga0265327_10133076
270 Ga0307408_100000223
271 Ga0307408_100002987
272 Ga0307405_10000007
273 Ga0307405_10377609
274 Ga0307413_10000843
275 Ga0307410_10000072
276 Ga0307406_10000041
277 Ga0307407_10000225
278 Ga0307407_10080298
279 Ga0307412_10205918
280 Ga0307414_10000001
281 Ga0307414_10010408
282 Ga0307411_10000005
283 Ga0307411_10109021
284 Ga0307411_10397089
285 Ga0307411_10622331
286 Ga0316593_10026485
287 Ga0307510_10023070
288 Ga0316574_0138769
289 Ga0400483_012218
290 Ga0439447_002474
291 Ga0439453_0051319
292 Ga0439466_0005812
293 Ga0451807_1142152
294 Ga0451837_0628369
295 Ga0451577_0000216
296 Ga0451577_0002766
297 Ga0451577_0019317
298 Ga0451577_0036664
299 Ga0451577_0057554
300 Ga0451577_0061587
301 Ga0451577_0094399
302 Ga0451577_0124435
303 Ga0451577_0170491
304 Ga0451577_0223569
305 Ga0451577_0515009
306 Ga0451577_0653679
307 Ga0451577_0987127
308 Ga0453683_0000101
309 Ga0453683_0001466
310 Ga0453683_0017959
311 Ga0453683_0039410
312 Ga0453683_0053411
313 Ga0453683_0165817
314 Ga0453683_0285529
315 Ga0453683_0311327
316 Ga0453683_0313663
317 Ga0453684_0000086
318 Ga0453684_0000553
319 Ga0453684_0001006
320 Ga0453684_0002011
321 Ga0453684_0003307
322 Ga0453684_0006518
323 Ga0453684_0007366
324 Ga0453684_0007718
325 Ga0453684_0011417
326 Ga0453684_0013019
327 Ga0453684_0053388
328 Ga0453684_0132653
329 Ga0453684_0145700
330 Ga0453684_0245813
331 Ga0453684_0247219
332 Ga0453684_0265966
333 Ga0453684_0291361
334 Ga0453684_0327605
335 Ga0453684_0430945
336 Ga0453684_0511325
337 Ga0451576_0000083
338 Ga0451576_0002630
339 Ga0451576_0003112
340 Ga0451576_0003810
341 Ga0451576_0008125
342 Ga0451576_0019484
343 Ga0451576_0020740
344 Ga0451576_0030435
345 Ga0451576_0045554
346 Ga0451576_0136119
347 Ga0451576_0216996
348 Ga0451576_0918426
349 Ga0451576_1100996
350 Ga0495627_001652
351 Ga0495580_0094252
352 Ga0495606_0245285
353 Ga0495616_0172971
354 Ga0495632_0134618
355 Ga0495643_0001696
356 Ga0495652_0238840
357 Ga0495640_0080794
358 Ga0495587_0289210
359 Ga0495587_0349935
360 Ga0495625_0063213
361 Ga0495657_0202886
362 Ga0495658_0007601
363 Ga0495636_0030880
364 Ga0495684_0211740
365 Ga0496115_0054080
366 Ga0496116_0000041
367 Ga0496118_0253775
368 Ga0496121_0078277
369 Ga0496124_0010486
370 Ga0496124_0108493
371 Ga0496124_0342421
372 Ga0496125_0000026
373 Ga0496125_0000177
374 Ga0496126_0005182
375 Ga0501031_0006344
376 Ga0501032_0019608
377 Ga0501032_0043550
378 Ga0501033_0000004
379 Ga0501034_0000375
380 Ga0501034_0071338
381 Ga0501036_0069407
382 Ga0501036_0406445
383 Ga0501037_0006121
384 Ga0501038_0027152
385 Ga0501039_0010819
386 Ga0501043_0025874
387 Ga0501223_000695
388 Ga0501249_000009
389 Ga0501241_001686
390 Ga0501035_0006105
391 Ga0501035_0009600
392 Ga0501044_0001402
393 Ga0501045_0000430
394 Ga0500646_0004325
395 Ga0500646_0082257
396 Ga0500641_0000006
397 Ga0500641_0000110
398 Ga0500658_0000008
399 2513236386
400 2520878575
401 2644011660
402 2644370042
403 2644642109
404 2644685461
405 2738736444
406 2738768887
407 2739218026
408 2740003569
409 2740008386
410 2802653507
411 2817415606
412 2833643703
413 2839992061
414 2857614379
415 2857619263
416 2881249690
417 2881362436
418 2890806138
419 2903898418
420 2904423223
421 2904556449
422 2919193165
423 2919512024
424 2919687651
425 2929152876
426 2958463455
427 2958515311
428 2965321038
429 2977269541
430 8036738831
431 8054308622
432 8055421296
433 8055594323
434 8056441879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

120

275

0.97

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

44

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9303 21 234
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9021 21 234
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.816 21 234
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.7811 21 235
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.7417 21 234
ID Description Score Start End Superfamily
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9727 21 71 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9658 80 234 3.30.70.980
af_P9WGA5_1_79_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.963 19 72 1.10.10.200
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.955 21 79 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9546 80 234 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A519NL36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9768 99 236 GO:0003677
GO:0005829
AF-A0A3D2R6I8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9746 130 237 GO:0003677
GO:0005829
AF-A0A519NL36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9699 99 236 GO:0003677
GO:0005829
AF-A0A7R9V5A2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9692 19 120 GO:0009507
AF-I5C779-F1-model_v4 Probable transcriptional regulatory protein A3SI_05809 0.9623 20 234 GO:0003677
GO:0005829
GO:0006355

Map