F329293

General Info

Members Datasets Scaffolds Average Seq Length
217 170 434 316

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0032519|Ga0495655_0032519_101_1048
Length 315
Sequence MTIDNLKTPTIALGTWAWGDSGKIGDGYFGSHMTQAGLEEVADKAHAAGFNLWDTALVYGNGRSETVLGEVLKRYARSDYQLSTKFNPRIAGTSDDPAADMLEQSLANLGTDYIDLYWIHNPADVPRWTPHLIPLLKSGKVKHIGVSNHNLSEIKLADQILGEAGFRVEAIQNHFSLLYRSSEYAGILDYCHNQSIPFFAYMEQGALTGKYSPDNPLPEGSSRAKIYNGMLAQLKALTDKLASIGQSQGAAAPDVATAWAIAKGTTPIIGVTKPHHVDGLVRASSITLTSDDIAELEALADAANVNTRGFWEQEM

Samples

Sample ID Description Type Environment
1 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
118 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
119 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
120 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
121 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
122 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
123 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
124 2547132424 Nocardia nova SH22a Isolate Unclassified
125 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
126 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
127 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
128 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
129 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
130 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
131 2808606448 Streptomyces sp. 193411 Isolate Unclassified
132 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
133 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
134 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
135 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
136 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
137 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
138 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
139 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
140 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
141 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
142 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
143 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
144 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
145 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
146 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
147 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
148 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
149 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
150 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
151 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
152 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
153 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
154 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
155 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
156 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
157 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
158 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
159 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
160 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
161 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
162 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
163 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
164 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
165 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
166 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
167 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
168 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
169 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
170 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.65
Metatranscriptomes 0
Isolates 25.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.12
Nodule 14.75
Rhizoplane 0.46
Rhizosphere 47.93
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495655_0032519 3300053083 Bacteria 1277
2 JGI24740J21852_10000032 3300001979 Bacteria 46815
3 JGI25158J39367_1001090 3300002739 Bacteria 4936
4 JGI25152J39213_1003458 3300002773 Bacteria 5385
5 JGI25152J39213_1007645 3300002773 Bacteria 2774
6 JGI25159J45721_1000895 3300002987 Bacteria 12970
7 JGI25153J46596_10011662 3300003215 Bacteria 3864
8 JGI25153J46596_10023032 3300003215 Bacteria 2279
9 rootH1_10003986 3300003316 Bacteria 7292
10 rootH2_10034773 3300003320 Bacteria 3507
11 rootH2_10206890 3300003320 Bacteria 1917
12 rootL2_10009173 3300003322 Bacteria 30207
13 rootL2_10138931 3300003322 Bacteria 2212
14 rootH1_10072531 3300003323 Bacteria 1805
15 JGI25160J50197_1013065 3300003354 Bacteria 2848
16 JGI25161J50226_1000150 3300003374 Bacteria 48475
17 Ga0055532_1000202 3300003758 Bacteria 48563
18 Ga0055525_1000274 3300003759 Bacteria 48089
19 Ga0055527_1000106 3300003760 Bacteria 60032
20 Ga0055535_1000210 3300003761 Bacteria 61721
21 Ga0055535_1000344 3300003761 Bacteria 46295
22 Ga0055542_1000166 3300003762 Bacteria 83233
23 Ga0055542_1000202 3300003762 Bacteria 73177
24 Ga0055529_1000181 3300003763 Bacteria 86692
25 Ga0055526_1002330 3300003771 Bacteria 12910
26 Ga0055524_1003057 3300003775 Bacteria 8281
27 Ga0055528_1003840 3300003790 Bacteria 7390
28 Ga0055528_1026279 3300003790 Bacteria 1678
29 Ga0055540_1004265 3300003792 Bacteria 6543
30 Ga0058692_1001318 3300003856 Bacteria 9328
31 Ga0058692_1016568 3300003856 Bacteria 1634
32 Ga0055543_1000074 3300004625 Bacteria 88424
33 Ga0065165_1010212 3300005262 Bacteria 4093
34 Ga0070658_10048785 3300005327 Bacteria 3429
35 Ga0070665_100015025 3300005548 Bacteria 7770
36 Ga0068855_100013803 3300005563 Bacteria 9738
37 Ga0068854_100004039 3300005578 Bacteria 9211
38 Ga0068856_100016251 3300005614 Bacteria 7200
39 Ga0068852_100370359 3300005616 Bacteria 1403
40 Ga0081455_10129747 3300005937 Bacteria 1973
41 Ga0070717_10021308 3300006028 Bacteria 5105
42 Ga0105240_10070735 3300009093 Unclassified 4316
43 Ga0105240_10243185 3300009093 Bacteria 2085
44 Ga0105241_10002652 3300009174 Bacteria 13402
45 Ga0105238_10032939 3300009551 Bacteria 5274
46 Ga0157370_10127530 3300013104 Bacteria 2375
47 Ga0157374_10500538 3300013296 Bacteria 1220
48 Ga0209436_100011 3300025208 Bacteria 139405
49 Ga0209672_100067 3300025228 Bacteria 180819
50 Ga0209672_100803 3300025228 Bacteria 14847
51 Ga0209147_100012 3300025229 Bacteria 681990
52 Ga0209563_100106 3300025230 Bacteria 146256
53 Ga0209258_100030 3300025242 Bacteria 470208
54 Ga0209258_100286 3300025242 Bacteria 83264
55 Ga0207425_1003202 3300025245 Bacteria 5347
56 Ga0209148_1000022 3300025254 Bacteria 681990
57 Ga0209148_1000135 3300025254 Bacteria 169939
58 Ga0209129_1002525 3300025258 Bacteria 8897
59 Ga0209129_1005567 3300025258 Bacteria 4398
60 Ga0209455_1000024 3300025272 Bacteria 676133
61 Ga0209455_1000495 3300025272 Bacteria 28763
62 Ga0209673_1000021 3300025273 Bacteria 422978
63 Ga0209673_1009774 3300025273 Bacteria 4113
64 Ga0209130_1000081 3300025284 Bacteria 166440
65 Ga0209564_1000225 3300025295 Bacteria 126209
66 Ga0209564_1002877 3300025295 Bacteria 12611
67 Ga0209758_1003268 3300025297 Bacteria 15030
68 Ga0209758_1009853 3300025297 Bacteria 5836
69 Ga0209256_1005028 3300025299 Bacteria 7892
70 Ga0207426_1000008 3300025302 Bacteria 848730
71 Ga0209051_1002199 3300025303 Bacteria 14416
72 Ga0207647_10029544 3300025904 Bacteria 3546
73 Ga0207699_10192878 3300025906 Bacteria 1376
74 Ga0207654_10032984 3300025911 Bacteria 2867
75 Ga0207695_10011795 3300025913 Bacteria 10547
76 Ga0207695_10072396 3300025913 Unclassified 3516
77 Ga0207671_10001887 3300025914 Bacteria 23289
78 Ga0207694_10022655 3300025924 Bacteria 4765
79 Ga0207694_10073271 3300025924 Bacteria 2679
80 Ga0207664_10000340 3300025929 Bacteria 34411
81 Ga0207640_10100537 3300025981 Bacteria 2026
82 Ga0207698_10086771 3300026142 Bacteria 2546
83 Ga0207698_10092395 3300026142 Bacteria 2480
84 Ga0209371_1000128 3300027312 Bacteria 124861
85 Ga0209371_1001770 3300027312 Bacteria 13556
86 Ga0209371_1004380 3300027312 Bacteria 6194
87 Ga0268266_10333305 3300028379 Bacteria 1422
88 Ga0268256_1000152 3300030500 Bacteria 92565
89 Ga0268256_1002022 3300030500 Bacteria 10968
90 Ga0268256_1009637 3300030500 Bacteria 3183
91 Ga0307513_10007967 3300031456 Bacteria 13629
92 Ga0307412_10000083 3300031911 Bacteria 91374
93 Ga0395898_0122381 3300037466 Bacteria 2493
94 Ga0395898_0211542 3300037466 Bacteria 1850
95 Ga0395905_0000314 3300037471 Bacteria 70335
96 Ga0395905_0001962 3300037471 Bacteria 23534
97 Ga0436365_0129053 3300039437 Bacteria 13412
98 Ga0466969_0014772 3300044656 Bacteria 4102
99 Ga0466969_0023291 3300044656 Bacteria 3191
100 Ga0466969_0026212 3300044656 Bacteria 2991
101 Ga0466972_0001274 3300044658 Bacteria 12159
102 Ga0466972_0009250 3300044658 Bacteria 4949
103 Ga0466982_0000001 3300044672 Bacteria 514662
104 Ga0466982_0086761 3300044672 Bacteria 1939
105 Ga0466965_0017177 3300044683 Bacteria 3455
106 Ga0466966_0004089 3300044684 Bacteria 9627
107 Ga0466961_0039880 3300044693 Bacteria 3010
108 Ga0466970_0002539 3300044765 Bacteria 8804
109 Ga0466957_0207582 3300044842 Bacteria 1289
110 Ga0466959_0002864 3300045049 Bacteria 11125
111 Ga0466959_0059594 3300045049 Bacteria 2780
112 Ga0466959_0192786 3300045049 Bacteria 1421
113 Ga0466958_0006439 3300045836 Bacteria 6389
114 Ga0466958_0075818 3300045836 Bacteria 2063
115 Ga0466967_0733118 3300045976 Bacteria 980
116 Ga0495651_0038181 3300046462 Bacteria 3739
117 Ga0495653_0132690 3300046463 Bacteria 1761
118 Ga0495628_0008496 3300046516 Bacteria 8800
119 Ga0495628_0039081 3300046516 Bacteria 3796
120 Ga0495643_0019991 3300046522 Bacteria 3868
121 Ga0495648_0037454 3300046524 Bacteria 3116
122 Ga0495652_0013048 3300046529 Bacteria 7488
123 Ga0495652_0180715 3300046529 Bacteria 1619
124 Ga0495623_0217269 3300046679 Bacteria 1091
125 Ga0495624_0075055 3300046690 Bacteria 2100
126 Ga0495600_0014916 3300046809 Bacteria 4905
127 Ga0495680_0043334 3300047322 Bacteria 3564
128 Ga0496117_0168735 3300048920 Bacteria 1273
129 Ga0496119_0000639 3300048922 Bacteria 47198
130 Ga0496119_0005725 3300048922 Bacteria 11780
131 Ga0496120_0170856 3300048923 Bacteria 1075
132 Ga0496122_0066820 3300048925 Bacteria 2594
133 Ga0496123_0102161 3300048926 Bacteria 1665
134 Ga0496124_0058037 3300048927 Bacteria 3257
135 Ga0496125_0077357 3300048928 Bacteria 2565
136 Ga0501031_0009572 3300049568 Bacteria 6309
137 Ga0501032_0008911 3300049569 Bacteria 7294
138 Ga0501032_0069003 3300049569 Bacteria 2359
139 Ga0501032_0153406 3300049569 Bacteria 1514
140 Ga0501036_0018828 3300049572 Bacteria 5791
141 Ga0501038_0074181 3300049574 Bacteria 2879
142 Ga0501042_0012471 3300049578 Bacteria 5760
143 Ga0501043_0019469 3300049579 Bacteria 5327
144 Ga0501043_0343961 3300049579 Bacteria 1134
145 Ga0501047_0000023 3300049581 Bacteria 240478
146 Ga0501047_0005761 3300049581 Bacteria 11666
147 Ga0501048_0293391 3300049582 Bacteria 1157
148 Ga0501067_0038560 3300049583 Bacteria 2653
149 Ga0501070_0314780 3300049586 Bacteria 1274
150 Ga0501073_0151267 3300049589 Bacteria 1609
151 Ga0501238_001722 3300049671 Bacteria 2547
152 Ga0501083_0130020 3300049744 Bacteria 1650
153 Ga0501035_0000362 3300049822 Bacteria 52504
154 Ga0501035_0005301 3300049822 Bacteria 12209
155 Ga0501035_0007701 3300049822 Bacteria 10060
156 Ga0501044_0004767 3300049823 Bacteria 15173
157 Ga0501044_0017320 3300049823 Bacteria 7727
158 Ga0501044_0025316 3300049823 Bacteria 6288
159 Ga0501044_0032415 3300049823 Bacteria 5493
160 Ga0500633_0001408 3300053160 Bacteria 4505
161 Ga0466962_0009607 3300061719 Bacteria 4640
162 Ga0466962_0014554 3300061719 Bacteria 3791
163 2501072210 2501025501 Bacteria 7768574
164 2501077789 2501025502 Bacteria 9641094
165 2501408903 2501025504 Bacteria 8008976
166 2510251351 2510065045 Bacteria 7761063
167 2511092243 2510917013 Bacteria 9951648
168 2511098606 2510917014 Bacteria 8296963
169 2511106368 2510917015 Bacteria 7950052
170 2548698503 2547132424 Bacteria 8348532
171 2552107456 2551306166 Bacteria 9731570
172 2671113142 2667528174 Bacteria 6435400
173 2687581305 2687453130 Bacteria 4227172
174 2694627893 2693429783 Bacteria 7019804
175 2694636143 2693429784 Bacteria 7241525
176 2719640469 2718217991 Bacteria 7829542
177 2809229027 2808606448 Bacteria 8656184
178 2816503829 2816332139 Bacteria 9138787
179 2819611858 2818991448 Bacteria 6772224
180 2838031665 2838029111 Bacteria 6603031
181 2842478397 2842475841 Bacteria 6603183
182 2842505657 2842502639 Bacteria 6604161
183 2856369884 2856364286 Bacteria 6939991
184 2863426796 2863421361 Bacteria 7300805
185 2869290691 2869285874 Bacteria 6901219
186 2871432973 2871429161 Bacteria 6547891
187 2874153866 2874146452 Bacteria 7533118
188 2874161131 2874155637 Bacteria 6724144
189 2876381876 2876377896 Bacteria 6565995
190 2876419171 2876413966 Bacteria 6831344
191 2878750586 2878745973 Bacteria 6867388
192 2888350993 2888350351 Bacteria 7372807
193 2889014897 2889010040 Bacteria 6749192
194 2903499568 2903492973 Bacteria 13473544
195 2906313511 2906308376 Bacteria 6841989
196 2906326220 2906321335 Bacteria 6579571
197 2909400084 2909399089 Bacteria 3922598
198 2909400352 2909399089 Bacteria 3922598
199 2919412910 2919408235 Bacteria 6149349
200 2937820185 2937813078 Bacteria 7783518
201 2938017163 2938014810 Bacteria 6700592
202 2958046351 2958041894 Bacteria 13082850
203 2958074010 2958071322 Bacteria 6815895
204 2958135091 2958130278 Bacteria 6897202
205 2958184120 2958179912 Bacteria 6874908
206 2961082175 2961077736 Bacteria 7079850
207 2977850272 2977843712 Bacteria 6753583
208 2979751398 2979742915 Bacteria 7301278
209 2987655775 2987652177 Bacteria 6969023
210 3005423341 3005416602 Bacteria 7064308
211 8004392980 8004387939 Bacteria 7049250
212 8004719767 8004714634 Bacteria 6776161
213 8005320860 8005314921 Bacteria 7072929
214 8005486536 8005484373 Bacteria 6297373
215 8005683479 8005682033 Bacteria 6726518
216 8055434759 8055431914 Bacteria 4551896
217 8057580952 8057575449 Bacteria 7367519
218 Ga0495655_0032519
219 JGI24740J21852_10000032
220 JGI25158J39367_1001090
221 JGI25152J39213_1003458
222 JGI25152J39213_1007645
223 JGI25159J45721_1000895
224 JGI25153J46596_10011662
225 JGI25153J46596_10023032
226 rootH1_10003986
227 rootH2_10034773
228 rootH2_10206890
229 rootL2_10009173
230 rootL2_10138931
231 rootH1_10072531
232 JGI25160J50197_1013065
233 JGI25161J50226_1000150
234 Ga0055532_1000202
235 Ga0055525_1000274
236 Ga0055527_1000106
237 Ga0055535_1000210
238 Ga0055535_1000344
239 Ga0055542_1000166
240 Ga0055542_1000202
241 Ga0055529_1000181
242 Ga0055526_1002330
243 Ga0055524_1003057
244 Ga0055528_1003840
245 Ga0055528_1026279
246 Ga0055540_1004265
247 Ga0058692_1001318
248 Ga0058692_1016568
249 Ga0055543_1000074
250 Ga0065165_1010212
251 Ga0070658_10048785
252 Ga0070665_100015025
253 Ga0068855_100013803
254 Ga0068854_100004039
255 Ga0068856_100016251
256 Ga0068852_100370359
257 Ga0081455_10129747
258 Ga0070717_10021308
259 Ga0105240_10070735
260 Ga0105240_10243185
261 Ga0105241_10002652
262 Ga0105238_10032939
263 Ga0157370_10127530
264 Ga0157374_10500538
265 Ga0209436_100011
266 Ga0209672_100067
267 Ga0209672_100803
268 Ga0209147_100012
269 Ga0209563_100106
270 Ga0209258_100030
271 Ga0209258_100286
272 Ga0207425_1003202
273 Ga0209148_1000022
274 Ga0209148_1000135
275 Ga0209129_1002525
276 Ga0209129_1005567
277 Ga0209455_1000024
278 Ga0209455_1000495
279 Ga0209673_1000021
280 Ga0209673_1009774
281 Ga0209130_1000081
282 Ga0209564_1000225
283 Ga0209564_1002877
284 Ga0209758_1003268
285 Ga0209758_1009853
286 Ga0209256_1005028
287 Ga0207426_1000008
288 Ga0209051_1002199
289 Ga0207647_10029544
290 Ga0207699_10192878
291 Ga0207654_10032984
292 Ga0207695_10011795
293 Ga0207695_10072396
294 Ga0207671_10001887
295 Ga0207694_10022655
296 Ga0207694_10073271
297 Ga0207664_10000340
298 Ga0207640_10100537
299 Ga0207698_10086771
300 Ga0207698_10092395
301 Ga0209371_1000128
302 Ga0209371_1001770
303 Ga0209371_1004380
304 Ga0268266_10333305
305 Ga0268256_1000152
306 Ga0268256_1002022
307 Ga0268256_1009637
308 Ga0307513_10007967
309 Ga0307412_10000083
310 Ga0395898_0122381
311 Ga0395898_0211542
312 Ga0395905_0000314
313 Ga0395905_0001962
314 Ga0436365_0129053
315 Ga0466969_0014772
316 Ga0466969_0023291
317 Ga0466969_0026212
318 Ga0466972_0001274
319 Ga0466972_0009250
320 Ga0466982_0000001
321 Ga0466982_0086761
322 Ga0466965_0017177
323 Ga0466966_0004089
324 Ga0466961_0039880
325 Ga0466970_0002539
326 Ga0466957_0207582
327 Ga0466959_0002864
328 Ga0466959_0059594
329 Ga0466959_0192786
330 Ga0466958_0006439
331 Ga0466958_0075818
332 Ga0466967_0733118
333 Ga0495651_0038181
334 Ga0495653_0132690
335 Ga0495628_0008496
336 Ga0495628_0039081
337 Ga0495643_0019991
338 Ga0495648_0037454
339 Ga0495652_0013048
340 Ga0495652_0180715
341 Ga0495623_0217269
342 Ga0495624_0075055
343 Ga0495600_0014916
344 Ga0495680_0043334
345 Ga0496117_0168735
346 Ga0496119_0000639
347 Ga0496119_0005725
348 Ga0496120_0170856
349 Ga0496122_0066820
350 Ga0496123_0102161
351 Ga0496124_0058037
352 Ga0496125_0077357
353 Ga0501031_0009572
354 Ga0501032_0008911
355 Ga0501032_0069003
356 Ga0501032_0153406
357 Ga0501036_0018828
358 Ga0501038_0074181
359 Ga0501042_0012471
360 Ga0501043_0019469
361 Ga0501043_0343961
362 Ga0501047_0000023
363 Ga0501047_0005761
364 Ga0501048_0293391
365 Ga0501067_0038560
366 Ga0501070_0314780
367 Ga0501073_0151267
368 Ga0501238_001722
369 Ga0501083_0130020
370 Ga0501035_0000362
371 Ga0501035_0005301
372 Ga0501035_0007701
373 Ga0501044_0004767
374 Ga0501044_0017320
375 Ga0501044_0025316
376 Ga0501044_0032415
377 Ga0500633_0001408
378 Ga0466962_0009607
379 Ga0466962_0014554
380 2501072210
381 2501077789
382 2501408903
383 2510251351
384 2511092243
385 2511098606
386 2511106368
387 2548698503
388 2552107456
389 2671113142
390 2687581305
391 2694627893
392 2694636143
393 2719640469
394 2809229027
395 2816503829
396 2819611858
397 2838031665
398 2842478397
399 2842505657
400 2856369884
401 2863426796
402 2869290691
403 2871432973
404 2874153866
405 2874161131
406 2876381876
407 2876419171
408 2878750586
409 2888350993
410 2889014897
411 2903499568
412 2906313511
413 2906326220
414 2909400084
415 2909400352
416 2919412910
417 2937820185
418 2938017163
419 2958046351
420 2958074010
421 2958135091
422 2958184120
423 2961082175
424 2977850272
425 2979751398
426 2987655775
427 3005423341
428 8004392980
429 8004719767
430 8005320860
431 8005486536
432 8005683479
433 8055434759
434 8057580952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

10

301

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.851 4 301
6ow0-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.8463 6 307
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8414 5 301
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.8385 8 301
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8383 6 302
ID Description Score Start End Superfamily
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8732 1 307 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8689 6 306 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8586 6 310 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8559 6 310 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8483 6 86 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A1G8NX47-F1-model_v4 Aldo/keto reductase family protein 0.9607 101 185 GO:0005829
GO:0016491
AF-A0A242BG72-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9498 51 314 GO:0005829
AF-A0A4Q2QTD6-F1-model_v4 Aldo/keto reductase 0.9481 112 313 GO:0005829
AF-A0A7K0DFR9-F1-model_v4 Aldo-keto reductase IolS (EC 1.1.1.-) 0.9467 43 317 GO:0004033
GO:0005737
AF-A0A2W5V726-F1-model_v4 Aldo/keto reductase 0.9417 84 317 GO:0005829
GO:0016491

Map