F329432

General Info

Members Datasets Scaffolds Average Seq Length
218 174 216 294

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000008|JGI25155J39150_1000008156
Length 333
Sequence MDNLDYCRLLGCLAVGIVCALLINFIGKTMQRRQFSGALGGLVVAGGMFSYTQKSLGAGKLPANPSPADITRRLAAIEQASGGRLGVSLLDTGSGAKYGYRAGERFPMCSTFKLLAAALVLHRVDTGKEQLERRIPIAASDILPHSPTTQQHIGPQGLPMAALCEASIIVSDNAAANLMLASFGGPAGLTAYLRSLGDKVTRLDRTEPDLNESLPGDPRDTTTPDAMLATVHKITLGSALSDASRKLIVQWLQANKTGDRRLRALLPPGWRVGDKTGSGANGSTNDVGLIWPPDGRAPLLVAAYLTGTKRPAAERDAALAQVGQLAASLASTN

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
129 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
130 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
131 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.7
Nodule 0.46
Rhizoplane 2.75
Rhizosphere 55.05
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000008 3300002704 Bacteria 236146
2 JGI25156J39149_1000002 3300002705 Bacteria 343501
3 JGI25154J39366_1000010 3300002738 Bacteria 297985
4 JGI25157J39369_1000001 3300002741 Bacteria 363277
5 JGI25150J39212_1007167 3300002774 Bacteria 2256
6 JGI25150J39212_1009498 3300002774 Bacteria 1846
7 JGI25159J45721_1000182 3300002987 Bacteria 29091
8 JGI25159J45721_1015186 3300002987 Bacteria 1699
9 JGI25151J46595_10025392 3300003187 Bacteria 2411
10 JGI25153J46596_10000908 3300003215 Bacteria 18005
11 JGI25160J50197_1000179 3300003354 Bacteria 53666
12 JGI25161J50226_1000076 3300003374 Bacteria 84478
13 Ga0055526_1024727 3300003771 Bacteria 1953
14 Ga0055526_1026977 3300003771 Bacteria 1791
15 Ga0055537_1004137 3300003773 Bacteria 4236
16 Ga0055524_1000130 3300003775 Bacteria 88754
17 Ga0055536_1003656 3300003781 Bacteria 8184
18 Ga0055534_1000449 3300003784 Bacteria 24146
19 Ga0055528_1001274 3300003790 Bacteria 15851
20 Ga0055530_10007864 3300003791 Bacteria 4390
21 Ga0055540_1000196 3300003792 Bacteria 58476
22 Ga0055531_10002794 3300003794 Bacteria 11446
23 Ga0055531_10018029 3300003794 Bacteria 2941
24 Ga0055543_1000118 3300004625 Bacteria 66892
25 Ga0065165_1007326 3300005262 Bacteria 5462
26 Ga0065165_1014584 3300005262 Bacteria 3042
27 Ga0065165_1026227 3300005262 Bacteria 1920
28 Ga0065707_10083589 3300005295 Bacteria 8692
29 Ga0070676_10008623 3300005328 Bacteria 5497
30 Ga0070676_10042662 3300005328 Unclassified 2635
31 Ga0068869_100083847 3300005334 Bacteria 2385
32 Ga0068869_100139462 3300005334 Bacteria 1871
33 Ga0070689_100130127 3300005340 Unclassified 2018
34 Ga0070668_100023562 3300005347 Bacteria 4657
35 Ga0070668_100242879 3300005347 Unclassified 1492
36 Ga0070669_100011662 3300005353 Bacteria 6235
37 Ga0070669_100222490 3300005353 Unclassified 1493
38 Ga0070675_100131304 3300005354 Unclassified 2135
39 Ga0070671_100166013 3300005355 Bacteria 1867
40 Ga0070659_100061591 3300005366 Bacteria 2965
41 Ga0070667_100028816 3300005367 Bacteria 4623
42 Ga0070667_100060007 3300005367 Bacteria 3219
43 Ga0070667_100191927 3300005367 Unclassified 1810
44 Ga0070714_100099456 3300005435 Bacteria 2560
45 Ga0070663_100141905 3300005455 Bacteria 1835
46 Ga0070662_100150703 3300005457 Unclassified 1810
47 Ga0068853_100029716 3300005539 Bacteria 4610
48 Ga0070672_100079766 3300005543 Bacteria 2621
49 Ga0068857_100059060 3300005577 Bacteria 3406
50 Ga0068857_100415179 3300005577 Bacteria 1254
51 Ga0068854_100115622 3300005578 Bacteria 2030
52 Ga0068852_100033697 3300005616 Bacteria 4255
53 Ga0068866_10158956 3300005718 Bacteria 1316
54 Ga0068860_100254077 3300005843 Bacteria 1712
55 Ga0081455_10008967 3300005937 Bacteria 10335
56 Ga0081540_1029765 3300005983 Bacteria 3037
57 Ga0081539_10003057 3300005985 Bacteria 21597
58 Ga0075363_100032841 3300006048 Bacteria 2699
59 Ga0075364_10073527 3300006051 Bacteria 2253
60 Ga0075362_10017849 3300006177 Bacteria 2928
61 Ga0075362_10025607 3300006177 Bacteria 2513
62 Ga0075367_10062414 3300006178 Bacteria 2226
63 Ga0075369_10000702 3300006186 Bacteria 10767
64 Ga0075366_10025084 3300006195 Bacteria 3479
65 Ga0075366_10034111 3300006195 Bacteria 2998
66 Ga0075366_10162241 3300006195 Bacteria 1355
67 Ga0075366_10222661 3300006195 Bacteria 1149
68 Ga0075370_10038724 3300006353 Bacteria 2684
69 Ga0075370_10187850 3300006353 Bacteria 1217
70 Ga0068865_100211770 3300006881 Bacteria 1511
71 Ga0099794_10041052 3300007265 Bacteria 2202
72 Ga0105240_10114348 3300009093 Bacteria 3260
73 Ga0105242_10283356 3300009176 Bacteria 1506
74 Ga0105237_10024836 3300009545 Bacteria 6132
75 Ga0105249_10026661 3300009553 Bacteria 5210
76 Ga0105239_10022093 3300010375 Bacteria 7013
77 Ga0157326_1003219 3300012513 Bacteria 1723
78 Ga0157374_10001127 3300013296 Bacteria 22941
79 Ga0157374_10321391 3300013296 Bacteria 1534
80 Ga0163162_10192564 3300013306 Unclassified 2167
81 Ga0182008_10045214 3300014497 Bacteria 2189
82 Ga0182006_1044788 3300015261 Bacteria 1724
83 Ga0182007_10029882 3300015262 Bacteria 1865
84 Ga0163161_10016574 3300017792 Bacteria 5147
85 Ga0209435_100001 3300025206 Bacteria 1424171
86 Ga0209436_102043 3300025208 Bacteria 6350
87 Ga0207425_1002448 3300025245 Bacteria 6528
88 Ga0207425_1013144 3300025245 Bacteria 1920
89 Ga0209646_1000001 3300025246 Bacteria 3092932
90 Ga0209026_1000001 3300025250 Bacteria 1228671
91 Ga0209759_1000001 3300025256 Bacteria 2799452
92 Ga0209565_1000161 3300025263 Bacteria 90019
93 Ga0209565_1003562 3300025263 Bacteria 4989
94 Ga0209565_1014175 3300025263 Bacteria 1840
95 Ga0209673_1001262 3300025273 Bacteria 26047
96 Ga0209130_1000041 3300025284 Bacteria 261078
97 Ga0209130_1005992 3300025284 Bacteria 4054
98 Ga0209675_1000128 3300025291 Bacteria 103111
99 Ga0209675_1006009 3300025291 Bacteria 4966
100 Ga0209676_1000054 3300025292 Bacteria 365890
101 Ga0209676_1002599 3300025292 Bacteria 12382
102 Ga0209025_1002417 3300025294 Bacteria 19867
103 Ga0209025_1003667 3300025294 Bacteria 14198
104 Ga0209564_1017491 3300025295 Bacteria 2790
105 Ga0209564_1021564 3300025295 Bacteria 2311
106 Ga0209564_1037668 3300025295 Bacteria 1358
107 Ga0209758_1009963 3300025297 Bacteria 5782
108 Ga0209758_1028571 3300025297 Bacteria 2354
109 Ga0209050_1000066 3300025298 Bacteria 305458
110 Ga0209050_1002908 3300025298 Bacteria 13455
111 Ga0209050_1021335 3300025298 Bacteria 2366
112 Ga0209256_1000003 3300025299 Bacteria 1661127
113 Ga0207426_1000061 3300025302 Bacteria 362507
114 Ga0207426_1000197 3300025302 Bacteria 146366
115 Ga0209051_1000044 3300025303 Bacteria 305458
116 Ga0209257_1000082 3300025304 Bacteria 305458
117 Ga0209257_1000219 3300025304 Bacteria 135666
118 Ga0209257_1007143 3300025304 Bacteria 6866
119 Ga0207697_10000106 3300025315 Bacteria 38593
120 Ga0207645_10046713 3300025907 Bacteria 2765
121 Ga0207645_10069078 3300025907 Unclassified 2260
122 Ga0207671_10008043 3300025914 Bacteria 9016
123 Ga0207681_10011044 3300025923 Bacteria 5545
124 Ga0207659_10031326 3300025926 Bacteria 3640
125 Ga0207706_10139562 3300025933 Bacteria 2132
126 Ga0207706_10174144 3300025933 Bacteria 1890
127 Ga0207704_10248983 3300025938 Bacteria 1332
128 Ga0207691_10242357 3300025940 Bacteria 1558
129 Ga0207689_10100252 3300025942 Bacteria 2379
130 Ga0207668_10025739 3300025972 Bacteria 3811
131 Ga0207658_10123242 3300025986 Bacteria 2070
132 Ga0207658_10302206 3300025986 Bacteria 1379
133 Ga0207658_10332633 3300025986 Bacteria 1318
134 Ga0207674_10046703 3300026116 Bacteria 4444
135 Ga0207698_10123473 3300026142 Bacteria 2197
136 Ga0268265_10291696 3300028380 Bacteria 1465
137 Ga0268264_10161871 3300028381 Bacteria 2017
138 Ga0265323_10024407 3300028653 Bacteria 2298
139 Ga0265338_10193719 3300028800 Bacteria 1538
140 Ga0265330_10017691 3300031235 Bacteria 3281
141 Ga0265325_10000459 3300031241 Bacteria 29426
142 Ga0265316_10024033 3300031344 Bacteria 5116
143 Ga0307513_10000021 3300031456 Bacteria 228078
144 Ga0265313_10001400 3300031595 Bacteria 22611
145 Ga0265313_10016573 3300031595 Bacteria 4229
146 Ga0265313_10033393 3300031595 Bacteria 2615
147 Ga0307405_10157936 3300031731 Bacteria 1602
148 Ga0307412_10347675 3300031911 Bacteria 1189
149 Ga0373934_0055708 3300035086 Bacteria 1572
150 Ga0373923_0004407 3300035111 Bacteria 4667
151 Ga0373956_0050383 3300035119 Bacteria 1869
152 Ga0373943_0080083 3300035170 Bacteria 1673
153 Ga0373955_0201645 3300035172 Bacteria 1184
154 Ga0373927_0122309 3300035695 Bacteria 1699
155 Ga0373933_0001907 3300035724 Bacteria 12034
156 Ga0373947_0040730 3300035725 Bacteria 2768
157 Ga0373937_0001900 3300036401 Bacteria 17541
158 Ga0373925_0058707 3300037068 Bacteria 2885
159 Ga0395899_0007322 3300037312 Bacteria 8537
160 Ga0395900_0231552 3300037418 Bacteria 1858
161 Ga0439436_0015868 3300041404 Bacteria 2263
162 Ga0439445_0011871 3300042004 Bacteria 2084
163 Ga0439432_017020 3300042006 Bacteria 2442
164 Ga0439449_0008358 3300042007 Bacteria 3936
165 Ga0439452_003280 3300042010 Bacteria 5700
166 Ga0450894_005145 3300042131 Bacteria 1691
167 Ga0450896_007868 3300042133 Bacteria 1473
168 Ga0450906_013222 3300042145 Bacteria 1525
169 Ga0450909_004277 3300042185 Bacteria 2036
170 Ga0453684_0231611 3300044712 Unclassified 2132
171 Ga0451576_0130078 3300045051 Unclassified 2624
172 Ga0466967_0595181 3300045976 Bacteria 1091
173 Ga0495629_0102316 3300046459 Bacteria 1999
174 Ga0495638_0022019 3300046460 Bacteria 4189
175 Ga0495639_0004274 3300046475 Bacteria 6127
176 Ga0495597_0002141 3300046542 Bacteria 13072
177 Ga0495667_0003622 3300046559 Bacteria 10385
178 Ga0495657_0062425 3300046675 Bacteria 2462
179 Ga0495672_0001554 3300047320 Bacteria 22467
180 Ga0495680_0024603 3300047322 Bacteria 4994
181 Ga0495687_000761 3300047443 Bacteria 34838
182 Ga0495675_0162120 3300047444 Bacteria 1376
183 Ga0495602_0127756 3300048088 Bacteria 2033
184 Ga0496100_0004454 3300048903 Bacteria 7431
185 Ga0496103_0051467 3300048906 Bacteria 2549
186 Ga0496104_0019488 3300048907 Bacteria 6209
187 Ga0496105_0005332 3300048908 Bacteria 9743
188 Ga0496108_0165156 3300048911 Bacteria 1914
189 Ga0496114_0512022 3300048917 Bacteria 1061
190 Ga0496118_0026675 3300048921 Bacteria 4913
191 Ga0496121_0160675 3300048924 Bacteria 1643
192 Ga0501038_0192664 3300049574 Bacteria 1640
193 Ga0501047_0185952 3300049581 Bacteria 1943
194 Ga0501067_0044533 3300049583 Bacteria 2465
195 Ga0501069_0132802 3300049585 Bacteria 1426
196 Ga0501070_0001905 3300049586 Bacteria 18456
197 Ga0501074_0256438 3300049590 Bacteria 1244
198 Ga0501077_0166218 3300049593 Bacteria 1401
199 Ga0501080_0089123 3300049742 Bacteria 2866
200 nmdc:mga03683_59722_c1 3300050489 Bacteria 1609
201 nmdc:mga00v17_68053_c1 3300050491 Bacteria 2201
202 nmdc:mga0yw44_343481_c1 3300050492 Bacteria 1004
203 nmdc:mga0yw44_477520_c1 3300050492 Bacteria 845
204 nmdc:mga0k408_13506_c1 3300050493 Bacteria 4481
205 nmdc:mga0k408_14380_c1 3300050493 Bacteria 4359
206 nmdc:mga0k408_62948_c1 3300050493 Bacteria 2157
207 nmdc:mga07m45_3503_c1 3300050496 Bacteria 7566
208 nmdc:mga0sz30_1525_c1 3300050516 Bacteria 8250
209 Ga0495601_0107606 3300053077 Bacteria 1804
210 Ga0495619_0035702 3300053085 Bacteria 3234
211 Ga0500593_000936 3300053117 Bacteria 10779
212 Ga0500616_0002413 3300053153 Bacteria 15568
213 Ga0500634_0010921 3300053161 Bacteria 4658
214 Ga0500645_002155 3300053730 Bacteria 9030
215 Ga0500645_040986 3300053730 Bacteria 1368
216 Ga0500552_000114 3300053733 Bacteria 6742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10045214 Ga0182008_100452142 244
2 3300013296 Ga0157374_10321391 Ga0157374_103213912 246
3 3300050492 nmdc:mga0yw44_477520_c1 nmdc:mga0yw44_477520_c1_28_822 263
4 3300049590 Ga0501074_0256438 Ga0501074_0256438_99_905 267
5 3300005347 Ga0070668_100242879 Ga0070668_1002428792 271
6 3300005328 Ga0070676_10008623 Ga0070676_100086235 272
7 3300005334 Ga0068869_100139462 Ga0068869_1001394622 272
8 3300005340 Ga0070689_100130127 Ga0070689_1001301273 272
9 3300005347 Ga0070668_100023562 Ga0070668_1000235625 272
10 3300005353 Ga0070669_100011662 Ga0070669_1000116625 272
11 3300005353 Ga0070669_100222490 Ga0070669_1002224902 272
12 3300005354 Ga0070675_100131304 Ga0070675_1001313042 272
13 3300005367 Ga0070667_100028816 Ga0070667_1000288165 272
14 3300005367 Ga0070667_100191927 Ga0070667_1001919272 272
15 3300005457 Ga0070662_100150703 Ga0070662_1001507032 272
16 3300009553 Ga0105249_10026661 Ga0105249_100266615 272
17 3300013306 Ga0163162_10192564 Ga0163162_101925642 272
18 3300025315 Ga0207697_10000106 Ga0207697_1000010636 272
19 3300025907 Ga0207645_10046713 Ga0207645_100467133 272
20 3300025907 Ga0207645_10069078 Ga0207645_100690782 272
21 3300025923 Ga0207681_10011044 Ga0207681_100110445 272
22 3300025926 Ga0207659_10031326 Ga0207659_100313264 272
23 3300025933 Ga0207706_10139562 Ga0207706_101395623 272
24 3300025933 Ga0207706_10174144 Ga0207706_101741442 272
25 3300025972 Ga0207668_10025739 Ga0207668_100257393 272
26 3300025986 Ga0207658_10123242 Ga0207658_101232422 272
27 3300028381 Ga0268264_10161871 Ga0268264_101618712 272
28 3300031344 Ga0265316_10024033 Ga0265316_100240333 272
29 3300045051 Ga0451576_0130078 Ga0451576_0130078_1304_2137 272
30 iso_pu_bacteria 2922361189 2922365263 273
31 3300007265 Ga0099794_10041052 Ga0099794_100410522 282
32 3300028800 Ga0265338_10193719 Ga0265338_101937192 282
33 3300035725 Ga0373947_0040730 Ga0373947_0040730_400_1251 282
34 3300049585 Ga0501069_0132802 Ga0501069_0132802_480_1349 282
35 3300031731 Ga0307405_10157936 Ga0307405_101579362 284
36 3300041404 Ga0439436_0015868 Ga0439436_0015868_1220_2098 284
37 3300042004 Ga0439445_0011871 Ga0439445_0011871_332_1210 284
38 3300042006 Ga0439432_017020 Ga0439432_017020_1544_2422 284
39 3300042007 Ga0439449_0008358 Ga0439449_0008358_160_1038 284
40 3300042010 Ga0439452_003280 Ga0439452_003280_875_1753 284
41 3300042131 Ga0450894_005145 Ga0450894_005145_132_1010 284
42 3300042133 Ga0450896_007868 Ga0450896_007868_571_1449 284
43 3300042145 Ga0450906_013222 Ga0450906_013222_305_1183 284
44 3300042185 Ga0450909_004277 Ga0450909_004277_946_1824 284
45 3300053733 Ga0500552_000114 Ga0500552_000114_948_1829 284
46 3300005985 Ga0081539_10003057 Ga0081539_1000305712 285
47 3300006177 Ga0075362_10017849 Ga0075362_100178493 285
48 3300006186 Ga0075369_10000702 Ga0075369_100007026 285
49 3300006195 Ga0075366_10222661 Ga0075366_102226612 285
50 3300006353 Ga0075370_10038724 Ga0075370_100387243 285
51 3300006353 Ga0075370_10187850 Ga0075370_101878502 285
52 3300028380 Ga0268265_10291696 Ga0268265_102916962 285
53 3300031911 Ga0307412_10347675 Ga0307412_103476752 285
54 3300050489 nmdc:mga03683_59722_c1 nmdc:mga03683_59722_c1_247_1185 285
55 3300050492 nmdc:mga0yw44_343481_c1 nmdc:mga0yw44_343481_c1_22_882 285
56 3300050496 nmdc:mga07m45_3503_c1 nmdc:mga07m45_3503_c1_1440_2300 285
57 3300050516 nmdc:mga0sz30_1525_c1 nmdc:mga0sz30_1525_c1_1290_2150 285
58 3300053153 Ga0500616_0002413 Ga0500616_0002413_6240_7097 285
59 3300049586 Ga0501070_0001905 Ga0501070_0001905_8904_9764 286
60 3300049742 Ga0501080_0089123 Ga0501080_0089123_1183_2043 286
61 3300005543 Ga0070672_100079766 Ga0070672_1000797662 288
62 3300012513 Ga0157326_1003219 Ga0157326_10032193 288
63 3300017792 Ga0163161_10016574 Ga0163161_100165743 288
64 3300025263 Ga0209565_1014175 Ga0209565_10141752 288
65 3300025295 Ga0209564_1021564 Ga0209564_10215643 288
66 3300025940 Ga0207691_10242357 Ga0207691_102423572 288
67 3300025986 Ga0207658_10332633 Ga0207658_103326331 288
68 3300046459 Ga0495629_0102316 Ga0495629_0102316_795_1661 288
69 3300046475 Ga0495639_0004274 Ga0495639_0004274_5163_6029 288
70 3300048903 Ga0496100_0004454 Ga0496100_0004454_4776_5642 288
71 3300048906 Ga0496103_0051467 Ga0496103_0051467_1464_2330 288
72 3300048907 Ga0496104_0019488 Ga0496104_0019488_864_1730 288
73 3300048908 Ga0496105_0005332 Ga0496105_0005332_7481_8347 288
74 3300048911 Ga0496108_0165156 Ga0496108_0165156_644_1510 288
75 3300048917 Ga0496114_0512022 Ga0496114_0512022_17_883 288
76 3300002774 JGI25150J39212_1007167 JGI25150J39212_10071673 289
77 3300002774 JGI25150J39212_1009498 JGI25150J39212_10094982 289
78 3300002987 JGI25159J45721_1015186 JGI25159J45721_10151862 289
79 3300003187 JGI25151J46595_10025392 JGI25151J46595_100253922 289
80 3300003773 Ga0055537_1004137 Ga0055537_10041373 289
81 3300003775 Ga0055524_1000130 Ga0055524_100013077 289
82 3300003781 Ga0055536_1003656 Ga0055536_10036562 289
83 3300003784 Ga0055534_1000449 Ga0055534_100044922 289
84 3300003790 Ga0055528_1001274 Ga0055528_10012747 289
85 3300003791 Ga0055530_10007864 Ga0055530_100078643 289
86 3300003792 Ga0055540_1000196 Ga0055540_100019652 289
87 3300003794 Ga0055531_10002794 Ga0055531_100027943 289
88 3300003794 Ga0055531_10018029 Ga0055531_100180293 289
89 3300025263 Ga0209565_1000161 Ga0209565_100016124 289
90 3300025273 Ga0209673_1001262 Ga0209673_100126225 289
91 3300025284 Ga0209130_1005992 Ga0209130_10059923 289
92 3300025291 Ga0209675_1000128 Ga0209675_100012832 289
93 3300025292 Ga0209676_1000054 Ga0209676_1000054137 289
94 3300025294 Ga0209025_1003667 Ga0209025_10036673 289
95 3300025295 Ga0209564_1017491 Ga0209564_10174913 289
96 3300025298 Ga0209050_1000066 Ga0209050_1000066137 289
97 3300025298 Ga0209050_1021335 Ga0209050_10213353 289
98 3300025299 Ga0209256_1000003 Ga0209256_10000031410 289
99 3300025302 Ga0207426_1000197 Ga0207426_10001979 289
100 3300025303 Ga0209051_1000044 Ga0209051_1000044137 289
101 3300025304 Ga0209257_1000082 Ga0209257_1000082137 289
102 3300025304 Ga0209257_1000219 Ga0209257_100021951 289
103 3300053161 Ga0500634_0010921 Ga0500634_0010921_1830_2702 290
104 3300031241 Ga0265325_10000459 Ga0265325_100004592 291
105 3300031595 Ga0265313_10001400 Ga0265313_1000140013 291
106 3300031595 Ga0265313_10033393 Ga0265313_100333932 291
107 3300045976 Ga0466967_0595181 Ga0466967_0595181_56_1024 291
108 3300047320 Ga0495672_0001554 Ga0495672_0001554_14908_15783 291
109 3300005577 Ga0068857_100415179 Ga0068857_1004151791 292
110 3300006048 Ga0075363_100032841 Ga0075363_1000328412 292
111 3300006195 Ga0075366_10025084 Ga0075366_100250842 292
112 3300006195 Ga0075366_10162241 Ga0075366_101622411 292
113 3300015261 Ga0182006_1044788 Ga0182006_10447882 292
114 3300015262 Ga0182007_10029882 Ga0182007_100298822 292
115 3300046460 Ga0495638_0022019 Ga0495638_0022019_2421_3299 292
116 3300048921 Ga0496118_0026675 Ga0496118_0026675_2977_3855 292
117 3300050493 nmdc:mga0k408_14380_c1 nmdc:mga0k408_14380_c1_1715_2593 292
118 3300031456 Ga0307513_10000021 Ga0307513_10000021150 293
119 3300053730 Ga0500645_002155 Ga0500645_002155_1484_2365 293
120 3300005295 Ga0065707_10083589 Ga0065707_1008358910 294
121 3300005435 Ga0070714_100099456 Ga0070714_1000994562 294
122 3300005718 Ga0068866_10158956 Ga0068866_101589561 294
123 3300006195 Ga0075366_10034111 Ga0075366_100341112 294
124 3300006881 Ga0068865_100211770 Ga0068865_1002117702 294
125 3300025938 Ga0207704_10248983 Ga0207704_102489832 294
126 3300044712 Ga0453684_0231611 Ga0453684_0231611_338_1222 294
127 3300048924 Ga0496121_0160675 Ga0496121_0160675_70_954 294
128 3300050493 nmdc:mga0k408_13506_c1 nmdc:mga0k408_13506_c1_1302_2186 294
129 iso_pu_bacteria 2511231002 2511245503 294
130 3300031595 Ga0265313_10016573 Ga0265313_100165732 295
131 3300035086 Ga0373934_0055708 Ga0373934_0055708_310_1200 295
132 3300035111 Ga0373923_0004407 Ga0373923_0004407_824_1714 295
133 3300035119 Ga0373956_0050383 Ga0373956_0050383_862_1752 295
134 3300035170 Ga0373943_0080083 Ga0373943_0080083_50_940 295
135 3300035172 Ga0373955_0201645 Ga0373955_0201645_268_1158 295
136 3300035695 Ga0373927_0122309 Ga0373927_0122309_744_1634 295
137 3300035724 Ga0373933_0001907 Ga0373933_0001907_3794_4684 295
138 3300036401 Ga0373937_0001900 Ga0373937_0001900_7448_8338 295
139 3300037068 Ga0373925_0058707 Ga0373925_0058707_1007_1897 295
140 3300046559 Ga0495667_0003622 Ga0495667_0003622_1258_2148 295
141 3300046675 Ga0495657_0062425 Ga0495657_0062425_1207_2097 295
142 3300047322 Ga0495680_0024603 Ga0495680_0024603_2731_3621 295
143 3300047444 Ga0495675_0162120 Ga0495675_0162120_238_1128 295
144 3300048088 Ga0495602_0127756 Ga0495602_0127756_1075_1965 295
145 3300053077 Ga0495601_0107606 Ga0495601_0107606_635_1525 295
146 3300053085 Ga0495619_0035702 Ga0495619_0035702_1184_2074 295
147 3300003215 JGI25153J46596_10000908 JGI25153J46596_1000090812 296
148 3300005937 Ga0081455_10008967 Ga0081455_100089678 296
149 3300009176 Ga0105242_10283356 Ga0105242_102833562 296
150 3300013296 Ga0157374_10001127 Ga0157374_1000112710 296
151 3300049583 Ga0501067_0044533 Ga0501067_0044533_1308_2201 296
152 3300005983 Ga0081540_1029765 Ga0081540_10297653 297
153 3300025294 Ga0209025_1002417 Ga0209025_100241720 299
154 3300025295 Ga0209564_1037668 Ga0209564_10376681 299
155 3300005328 Ga0070676_10042662 Ga0070676_100426623 300
156 3300003771 Ga0055526_1026977 Ga0055526_10269772 301
157 3300050493 nmdc:mga0k408_62948_c1 nmdc:mga0k408_62948_c1_788_1705 301
158 3300003771 Ga0055526_1024727 Ga0055526_10247272 302
159 3300005262 Ga0065165_1026227 Ga0065165_10262272 302
160 3300025245 Ga0207425_1002448 Ga0207425_10024488 302
161 3300025245 Ga0207425_1013144 Ga0207425_10131441 302
162 3300025263 Ga0209565_1003562 Ga0209565_10035627 302
163 3300025291 Ga0209675_1006009 Ga0209675_10060097 302
164 3300025297 Ga0209758_1009963 Ga0209758_10099632 302
165 3300025297 Ga0209758_1028571 Ga0209758_10285712 302
166 3300002987 JGI25159J45721_1000182 JGI25159J45721_10001826 303
167 3300003354 JGI25160J50197_1000179 JGI25160J50197_100017924 303
168 3300003374 JGI25161J50226_1000076 JGI25161J50226_100007650 303
169 3300004625 Ga0055543_1000118 Ga0055543_100011836 303
170 3300005262 Ga0065165_1007326 Ga0065165_10073267 303
171 3300025208 Ga0209436_102043 Ga0209436_1020438 303
172 3300025284 Ga0209130_1000041 Ga0209130_1000041235 303
173 3300025298 Ga0209050_1002908 Ga0209050_100290810 303
174 3300025302 Ga0207426_1000061 Ga0207426_10000616 303
175 3300025206 Ga0209435_100001 Ga0209435_1000011198 304
176 3300025246 Ga0209646_1000001 Ga0209646_10000011567 304
177 3300025250 Ga0209026_1000001 Ga0209026_1000001220 304
178 3300025256 Ga0209759_1000001 Ga0209759_10000011198 304
179 3300049574 Ga0501038_0192664 Ga0501038_0192664_87_1151 305
180 3300049581 Ga0501047_0185952 Ga0501047_0185952_762_1826 305
181 3300049593 Ga0501077_0166218 Ga0501077_0166218_156_1220 305
182 3300005334 Ga0068869_100083847 Ga0068869_1000838473 307
183 3300005355 Ga0070671_100166013 Ga0070671_1001660132 307
184 3300005366 Ga0070659_100061591 Ga0070659_1000615913 307
185 3300005367 Ga0070667_100060007 Ga0070667_1000600073 307
186 3300005455 Ga0070663_100141905 Ga0070663_1001419052 307
187 3300005539 Ga0068853_100029716 Ga0068853_1000297163 307
188 3300005577 Ga0068857_100059060 Ga0068857_1000590605 307
189 3300005578 Ga0068854_100115622 Ga0068854_1001156222 307
190 3300005616 Ga0068852_100033697 Ga0068852_1000336974 307
191 3300005843 Ga0068860_100254077 Ga0068860_1002540772 307
192 3300006051 Ga0075364_10073527 Ga0075364_100735272 307
193 3300006177 Ga0075362_10025607 Ga0075362_100256072 307
194 3300006178 Ga0075367_10062414 Ga0075367_100624142 307
195 3300009093 Ga0105240_10114348 Ga0105240_101143485 307
196 3300009545 Ga0105237_10024836 Ga0105237_100248366 307
197 3300010375 Ga0105239_10022093 Ga0105239_100220935 307
198 3300025914 Ga0207671_10008043 Ga0207671_100080432 307
199 3300025942 Ga0207689_10100252 Ga0207689_101002522 307
200 3300025986 Ga0207658_10302206 Ga0207658_103022061 307
201 3300026116 Ga0207674_10046703 Ga0207674_100467032 307
202 3300026142 Ga0207698_10123473 Ga0207698_101234731 307
203 3300046542 Ga0495597_0002141 Ga0495597_0002141_7800_8735 307
204 3300047443 Ga0495687_000761 Ga0495687_000761_17826_18761 307
205 3300050491 nmdc:mga00v17_68053_c1 nmdc:mga00v17_68053_c1_449_1375 307
206 3300037312 Ga0395899_0007322 Ga0395899_0007322_5580_6560 313
207 3300037418 Ga0395900_0231552 Ga0395900_0231552_497_1504 313
208 3300028653 Ga0265323_10024407 Ga0265323_100244072 318
209 3300031235 Ga0265330_10017691 Ga0265330_100176913 318
210 3300053730 Ga0500645_040986 Ga0500645_040986_87_1082 320
211 3300025292 Ga0209676_1002599 Ga0209676_100259910 328
212 3300025304 Ga0209257_1007143 Ga0209257_10071435 328
213 3300005262 Ga0065165_1014584 Ga0065165_10145843 331
214 3300002704 JGI25155J39150_1000008 JGI25155J39150_1000008156 333
215 3300002705 JGI25156J39149_1000002 JGI25156J39149_100000298 333
216 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010219 333
217 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001119 333
218 3300053117 Ga0500593_000936 Ga0500593_000936_8832_9833 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13354

Beta-lactamase2

Beta-lactamase enzyme family

86

305

0.95

PF00144

Beta-lactamase

Beta-lactamase

71

325

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b88-assembly1.cif.gz_A ancestral (gnca) beta-lactamase class a 0.992 70 325
4c6y-assembly2.cif.gz_B ancestral pnca (last common ancestors of gram-positive and gram- negative bacteria) beta-lactamase class a 0.9903 70 327
4uhu-assembly1.cif.gz_A w229d mutant of the last common ancestor of gram-negative bacteria (gnca) beta-lactamase class a 0.9889 70 325
5fqq-assembly1.cif.gz_A last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a 0.9873 70 325
5fqk-assembly1.cif.gz_A w229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a bound to 5(6)-nitrobenzotriazole (ts-analog) 0.9871 70 325
ID Description Score Start End Superfamily
5hw3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9719 70 331 3.40.710.10
5ne2A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9669 75 330 3.40.710.10
1g6aA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9637 67 332 3.40.710.10
3ni9B00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9582 66 333 3.40.710.10
5hx9A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9545 74 326 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A127P9K0-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.9977 75 331 GO:0008800
GO:0030655
GO:0046677
AF-A0A088FSX9-F1-model_v4 beta-lactamase (EC 3.5.2.6) 0.9956 157 278 GO:0008800
GO:0030655
GO:0046677
AF-R8NI96-F1-model_v4 Beta-lactamase 3 0.9956 158 255 GO:0008800
GO:0030655
GO:0046677
AF-A0A088SAA4-F1-model_v4 beta-lactamase (EC 3.5.2.6) 0.9942 158 288 GO:0008800
GO:0030655
GO:0046677
AF-A0A141RMK0-F1-model_v4 ClassA 0.9942 161 267 GO:0008800
GO:0030655
GO:0046677

Feature Viewer

pLDDT pTM Quality
84.94 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map