F329758

General Info

Members Datasets Scaffolds Average Seq Length
218 159 217 330

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100166278|Ga0068862_1001662783
Length 379
Sequence LTKTWKRPLWRRVVRWAIRGIAIVIALPIVALVIGYLRSDNECSRPKQAPAHPMRAIVYCEYGTADNLRLEPVEKPTPTDDQMLVKVKSAAVNPLDWHFIRGTPYVMRLSAGLKKPKEIRLGVDFSGTVEAVGKNVTDFKPGDDIFGGRNGAFAEYVVVRPDRAITPKPANVSFEQAAGVPIAGITALQAIRDRAKLQPGQKVLINGASGGVGTFAVQIAKAYGADVTGVCSGRNVEMVRGLGADRVIDYTKEDFTKGDARYDAIIDNVGNRGLLECKRVLAPNGRYVLIGGGGPDRGNWIGALAGPMKAFMLGAFVKQEMGFFVAQLNKADLKVLADMMEAGQVTPVIDRTYPLAEVPEAIKYLEEGHARGKVVITME

Samples

Sample ID Description Type Environment
1 2904424332 Duganella sp. 1411 Isolate Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 0.92
Rhizosphere 95.41
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10048850 3300003322 Bacteria 41711
2 rootH1_10138576 3300003323 Bacteria 11483
3 Ga0065703_1019006 3300005272 Bacteria 4458
4 Ga0070683_100005779 3300005329 Bacteria 10342
5 Ga0070683_100015808 3300005329 Bacteria 6636
6 Ga0070670_100009733 3300005331 Bacteria 8209
7 Ga0068869_100047167 3300005334 Bacteria 3110
8 Ga0070666_10224373 3300005335 Bacteria 1326
9 Ga0068868_100002201 3300005338 Bacteria 13459
10 Ga0070661_100263331 3300005344 Bacteria 1333
11 Ga0070671_100001427 3300005355 Bacteria 17833
12 Ga0070673_100309503 3300005364 Unclassified 1393
13 Ga0070667_100002990 3300005367 Bacteria 14522
14 Ga0070714_100010176 3300005435 Bacteria 7425
15 Ga0070706_100009210 3300005467 Bacteria 9195
16 Ga0070706_100062829 3300005467 Unclassified 3431
17 Ga0070707_100011064 3300005468 Bacteria 8403
18 Ga0070698_100031372 3300005471 Bacteria 5510
19 Ga0070699_100051835 3300005518 Bacteria 3553
20 Ga0070699_100057097 3300005518 Bacteria 3381
21 Ga0070699_100172678 3300005518 Bacteria 1916
22 Ga0070684_100026707 3300005535 Bacteria 4866
23 Ga0070684_100287401 3300005535 Bacteria 1507
24 Ga0070697_100026571 3300005536 Bacteria 4626
25 Ga0070697_100030829 3300005536 Bacteria 4309
26 Ga0068855_100290574 3300005563 Bacteria 1812
27 Ga0070664_100093608 3300005564 Bacteria 2604
28 Ga0070664_100223246 3300005564 Unclassified 1686
29 Ga0068857_100000346 3300005577 Bacteria 32004
30 Ga0068857_100002083 3300005577 Bacteria 16241
31 Ga0068856_100005566 3300005614 Bacteria 12405
32 Ga0068856_100034933 3300005614 Bacteria 4925
33 Ga0068856_100049023 3300005614 Bacteria 4163
34 Ga0068852_100093389 3300005616 Bacteria 2697
35 Ga0068859_100008361 3300005617 Bacteria 10488
36 Ga0068864_100000516 3300005618 Bacteria 33236
37 Ga0068861_100357185 3300005719 Bacteria 1284
38 Ga0068863_100004761 3300005841 Bacteria 13371
39 Ga0068858_100009154 3300005842 Bacteria 9469
40 Ga0068860_100011630 3300005843 Bacteria 8680
41 Ga0068862_100166278 3300005844 Bacteria 1972
42 Ga0081455_10009746 3300005937 Bacteria 9839
43 Ga0081538_10001034 3300005981 Bacteria 29682
44 Ga0081538_10006852 3300005981 Bacteria 9925
45 Ga0081538_10008660 3300005981 Bacteria 8601
46 Ga0081539_10017512 3300005985 Bacteria 5025
47 Ga0070717_10002421 3300006028 Bacteria 13167
48 Ga0070717_10010475 3300006028 Bacteria 7004
49 Ga0097621_100004147 3300006237 Bacteria 10053
50 Ga0068871_100069417 3300006358 Bacteria 2894
51 Ga0075428_100022077 3300006844 Bacteria 7046
52 Ga0075428_100040052 3300006844 Bacteria 5156
53 Ga0075431_100021464 3300006847 Bacteria 6604
54 Ga0075431_100047384 3300006847 Bacteria 4431
55 Ga0075429_100003227 3300006880 Bacteria 13880
56 Ga0075429_100086424 3300006880 Bacteria 2733
57 Ga0075429_100098447 3300006880 Bacteria 2552
58 Ga0097620_100008361 3300006931 Bacteria 10488
59 Ga0105240_10001323 3300009093 Bacteria 42757
60 Ga0105240_10014528 3300009093 Bacteria 10747
61 Ga0105240_10096451 3300009093 Bacteria 3603
62 Ga0105240_10384400 3300009093 Bacteria 1584
63 Ga0111539_10107614 3300009094 Bacteria 3272
64 Ga0105245_10000593 3300009098 Bacteria 32862
65 Ga0105245_10114853 3300009098 Bacteria 2508
66 Ga0105247_10026067 3300009101 Bacteria 3529
67 Ga0114129_10031850 3300009147 Bacteria 7454
68 Ga0114129_10149648 3300009147 Bacteria 3195
69 Ga0114129_10409171 3300009147 Bacteria 1787
70 Ga0105241_10000435 3300009174 Bacteria 31472
71 Ga0105241_10001660 3300009174 Bacteria 16952
72 Ga0105248_10000868 3300009177 Bacteria 33989
73 Ga0105248_10009374 3300009177 Bacteria 10777
74 Ga0105238_10000558 3300009551 Bacteria 38989
75 Ga0105238_10015055 3300009551 Bacteria 7834
76 Ga0105238_10015898 3300009551 Bacteria 7614
77 Ga0105238_10075099 3300009551 Bacteria 3372
78 Ga0105249_10001091 3300009553 Bacteria 24125
79 Ga0105249_10053794 3300009553 Unclassified 3680
80 Ga0105239_10000723 3300010375 Bacteria 46885
81 Ga0105246_10000999 3300011119 Bacteria 16245
82 Ga0157369_10016866 3300013105 Bacteria 8206
83 Ga0157369_10039761 3300013105 Bacteria 5139
84 Ga0157369_10039859 3300013105 Bacteria 5132
85 Ga0157369_10090116 3300013105 Bacteria 3274
86 Ga0157374_10007650 3300013296 Bacteria 9224
87 Ga0157374_10017118 3300013296 Bacteria 6381
88 Ga0157378_10018668 3300013297 Bacteria 6097
89 Ga0157378_10051703 3300013297 Unclassified 3656
90 Ga0157378_10079580 3300013297 Bacteria 2959
91 Ga0163162_10085297 3300013306 Unclassified 3235
92 Ga0157372_10024317 3300013307 Bacteria 6578
93 Ga0157372_10050195 3300013307 Bacteria 4641
94 Ga0163163_10003253 3300014325 Bacteria 13779
95 Ga0157379_10022446 3300014968 Bacteria 5590
96 Ga0157376_10046903 3300014969 Bacteria 3565
97 Ga0157376_10066906 3300014969 Unclassified 3038
98 Ga0207710_10002698 3300025900 Bacteria 8138
99 Ga0207684_10026262 3300025910 Bacteria 4965
100 Ga0207684_10052041 3300025910 Bacteria 3475
101 Ga0207654_10000107 3300025911 Bacteria 55194
102 Ga0207654_10000668 3300025911 Bacteria 19386
103 Ga0207695_10000113 3300025913 Bacteria 247240
104 Ga0207695_10007675 3300025913 Bacteria 13661
105 Ga0207695_10403608 3300025913 Bacteria 1251
106 Ga0207671_10000506 3300025914 Bacteria 52834
107 Ga0207646_10004467 3300025922 Bacteria 15158
108 Ga0207681_10074020 3300025923 Bacteria 2385
109 Ga0207694_10000076 3300025924 Bacteria 113436
110 Ga0207694_10002679 3300025924 Bacteria 14414
111 Ga0207650_10005630 3300025925 Bacteria 8554
112 Ga0207650_10079890 3300025925 Unclassified 2478
113 Ga0207659_10075649 3300025926 Bacteria 2471
114 Ga0207687_10010978 3300025927 Bacteria 5919
115 Ga0207644_10022758 3300025931 Bacteria 4284
116 Ga0207711_10000794 3300025941 Bacteria 31074
117 Ga0207689_10018634 3300025942 Bacteria 5856
118 Ga0207667_10129554 3300025949 Bacteria 2598
119 Ga0207658_10003790 3300025986 Bacteria 10641
120 Ga0207677_10000102 3300026023 Bacteria 70677
121 Ga0207703_10009837 3300026035 Bacteria 7502
122 Ga0207702_10031342 3300026078 Unclassified 4431
123 Ga0207702_10080439 3300026078 Bacteria 2827
124 Ga0207641_10001490 3300026088 Bacteria 22925
125 Ga0207676_10013540 3300026095 Bacteria 5855
126 Ga0207674_10001025 3300026116 Bacteria 36477
127 Ga0207674_10003095 3300026116 Bacteria 20554
128 Ga0207698_10116739 3300026142 Bacteria 2250
129 Ga0207428_10174373 3300027907 Bacteria 1627
130 Ga0268264_10015153 3300028381 Bacteria 6324
131 Ga0265337_1002692 3300028556 Bacteria 7986
132 Ga0265319_1006190 3300028563 Bacteria 5580
133 Ga0265334_10006318 3300028573 Bacteria 5114
134 Ga0265338_10000299 3300028800 Bacteria 89317
135 Ga0265338_10028784 3300028800 Bacteria 5531
136 Ga0265324_10004529 3300029957 Bacteria 6238
137 Ga0265320_10027617 3300031240 Bacteria 2956
138 Ga0265325_10007632 3300031241 Bacteria 6467
139 Ga0265340_10009186 3300031247 Bacteria 5314
140 Ga0265339_10080298 3300031249 Unclassified 1725
141 Ga0265316_10027450 3300031344 Bacteria 4713
142 Ga0307513_10236006 3300031456 Bacteria 1638
143 Ga0265313_10003783 3300031595 Bacteria 12003
144 Ga0265314_10002967 3300031711 Bacteria 16812
145 Ga0265342_10028451 3300031712 Unclassified 3481
146 Ga0307407_10177158 3300031903 Bacteria 1410
147 Ga0307409_100107585 3300031995 Bacteria 2330
148 Ga0307415_100357456 3300032126 Bacteria 1232
149 Ga0373951_0003726 3300035091 Bacteria 3678
150 Ga0373955_0081378 3300035172 Bacteria 1831
151 Ga0395899_0008057 3300037312 Bacteria 8113
152 Ga0395899_0066456 3300037312 Bacteria 2648
153 Ga0395900_0005816 3300037418 Bacteria 12883
154 Ga0395900_0007878 3300037418 Bacteria 10971
155 Ga0395900_0028955 3300037418 Bacteria 5678
156 Ga0395900_0188540 3300037418 Bacteria 2093
157 Ga0395900_0300243 3300037418 Unclassified 1592
158 Ga0395898_0007734 3300037466 Bacteria 11412
159 Ga0395905_0061605 3300037471 Bacteria 3510
160 Ga0395905_0121199 3300037471 Bacteria 2458
161 Ga0395901_0008877 3300038443 Bacteria 10177
162 Ga0395901_0078638 3300038443 Bacteria 3443
163 Ga0451577_0000049 3300042876 Bacteria 304750
164 Ga0453684_0000156 3300044712 Bacteria 304753
165 Ga0451576_0001122 3300045051 Bacteria 48663
166 Ga0451576_0030918 3300045051 Bacteria 5713
167 Ga0466967_0026282 3300045976 Bacteria 4819
168 Ga0466967_0153073 3300045976 Bacteria 2158
169 Ga0495603_0027592 3300046455 Archaea 3426
170 Ga0495651_0023185 3300046462 Bacteria 4827
171 Ga0495639_0056678 3300046475 Bacteria 1789
172 Ga0495662_0057171 3300046476 Bacteria 1884
173 Ga0495616_0016852 3300046513 Bacteria 4037
174 Ga0495628_0240497 3300046516 Bacteria 1354
175 Ga0495644_0057768 3300046523 Bacteria 1459
176 Ga0495665_0083695 3300046531 Bacteria 1677
177 Ga0495598_0100147 3300046537 Bacteria 958
178 Ga0495633_0049507 3300046558 Bacteria 1983
179 Ga0495581_0010330 3300047315 Bacteria 5401
180 Ga0495674_0002898 3300047319 Bacteria 16703
181 Ga0495675_0021571 3300047444 Unclassified 4103
182 Ga0495684_0050145 3300047471 Bacteria 3188
183 Ga0495593_0057505 3300047673 Bacteria 2042
184 Ga0496110_0231771 3300048913 Unclassified 1680
185 Ga0496114_0106218 3300048917 Bacteria 2402
186 Ga0501031_0069588 3300049568 Bacteria 2292
187 Ga0501038_0008140 3300049574 Bacteria 9649
188 Ga0501039_0050144 3300049575 Bacteria 3229
189 Ga0501039_0119890 3300049575 Bacteria 2061
190 Ga0501040_0175161 3300049576 Bacteria 1520
191 Ga0501042_0039581 3300049578 Bacteria 3350
192 Ga0501043_0021647 3300049579 Bacteria 5040
193 Ga0501046_0021764 3300049580 Bacteria 5286
194 Ga0501048_0074809 3300049582 Bacteria 2390
195 Ga0501074_0005270 3300049590 Bacteria 9309
196 Ga0501075_0088002 3300049591 Bacteria 2354
197 Ga0501076_0066683 3300049592 Bacteria 2873
198 Ga0501079_0132095 3300049741 Bacteria 1943
199 Ga0501079_0365672 3300049741 Bacteria 1131
200 Ga0501081_0283808 3300049743 Bacteria 1212
201 Ga0501045_0048812 3300049824 Bacteria 3085
202 nmdc:mga05p37_173260_c1 3300050507 Bacteria 2630
203 nmdc:mga05p37_206495_c1 3300050507 Bacteria 2376
204 nmdc:mga09592_337691_c1 3300050508 Bacteria 1304
205 nmdc:mga09592_69356_c1 3300050508 Bacteria 2991
206 nmdc:mga0qj67_47916_c1 3300050509 Bacteria 3377
207 nmdc:mga06r32_17577_c1 3300050510 Bacteria 6531
208 nmdc:mga08y16_24234_c1 3300050511 Bacteria 6406
209 Ga0495595_0155107 3300053084 Bacteria 1128
210 Ga0500644_0007313 3300053088 Bacteria 2872
211 Ga0500650_0038319 3300053098 Bacteria 2206
212 Ga0500593_000569 3300053117 Bacteria 14204
213 Ga0500588_0001508 3300053146 Bacteria 4455
214 Ga0500645_001478 3300053730 Bacteria 11812
215 Ga0501084_0055655 3300054114 Bacteria 3309
216 Ga0501082_0095080 3300060353 Bacteria 2575
217 Ga0530510_0242888 3300061734 Bacteria 1341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100062829 Ga0070706_1000628295 256
2 3300046537 Ga0495598_0100147 Ga0495598_0100147_92_931 256
3 3300013297 Ga0157378_10079580 Ga0157378_100795802 264
4 3300046558 Ga0495633_0049507 Ga0495633_0049507_17_943 281
5 3300009174 Ga0105241_10000435 Ga0105241_100004354 292
6 3300013105 Ga0157369_10039859 Ga0157369_100398594 292
7 3300025911 Ga0207654_10000107 Ga0207654_1000010728 292
8 3300031903 Ga0307407_10177158 Ga0307407_101771581 292
9 3300031995 Ga0307409_100107585 Ga0307409_1001075852 292
10 3300028800 Ga0265338_10028784 Ga0265338_100287844 299
11 3300061734 Ga0530510_0242888 Ga0530510_0242888_200_1324 299
12 3300005364 Ga0070673_100309503 Ga0070673_1003095031 300
13 3300005564 Ga0070664_100223246 Ga0070664_1002232462 300
14 3300013306 Ga0163162_10085297 Ga0163162_100852972 300
15 3300025923 Ga0207681_10074020 Ga0207681_100740202 300
16 3300025926 Ga0207659_10075649 Ga0207659_100756491 300
17 3300042876 Ga0451577_0000049 Ga0451577_0000049_105067_106026 300
18 3300044712 Ga0453684_0000156 Ga0453684_0000156_198728_199687 300
19 3300045051 Ga0451576_0001122 Ga0451576_0001122_25241_26200 300
20 3300006028 Ga0070717_10010475 Ga0070717_100104752 301
21 3300005985 Ga0081539_10017512 Ga0081539_100175125 302
22 iso_pu_bacteria 2904424332 2904429345 302
23 3300005937 Ga0081455_10009746 Ga0081455_1000974611 303
24 3300032126 Ga0307415_100357456 Ga0307415_1003574561 304
25 3300048917 Ga0496114_0106218 Ga0496114_0106218_1277_2284 304
26 3300005535 Ga0070684_100287401 Ga0070684_1002874012 306
27 3300035091 Ga0373951_0003726 Ga0373951_0003726_2454_3461 306
28 3300037418 Ga0395900_0028955 Ga0395900_0028955_11_1024 306
29 3300037471 Ga0395905_0121199 Ga0395905_0121199_286_1299 306
30 3300038443 Ga0395901_0078638 Ga0395901_0078638_862_1875 306
31 3300046513 Ga0495616_0016852 Ga0495616_0016852_2898_3944 306
32 3300053088 Ga0500644_0007313 Ga0500644_0007313_431_1432 306
33 3300053098 Ga0500650_0038319 Ga0500650_0038319_1067_2068 306
34 3300053117 Ga0500593_000569 Ga0500593_000569_12659_13660 306
35 3300053730 Ga0500645_001478 Ga0500645_001478_5709_6710 306
36 3300005272 Ga0065703_1019006 Ga0065703_10190063 307
37 3300005536 Ga0070697_100026571 Ga0070697_1000265712 307
38 3300006028 Ga0070717_10002421 Ga0070717_1000242118 307
39 3300005518 Ga0070699_100051835 Ga0070699_1000518354 308
40 3300006847 Ga0075431_100047384 Ga0075431_1000473842 308
41 3300006880 Ga0075429_100086424 Ga0075429_1000864242 308
42 3300013297 Ga0157378_10018668 Ga0157378_100186683 308
43 3300025910 Ga0207684_10052041 Ga0207684_100520412 308
44 3300035172 Ga0373955_0081378 Ga0373955_0081378_252_1358 308
45 3300037418 Ga0395900_0007878 Ga0395900_0007878_5356_6417 308
46 3300046462 Ga0495651_0023185 Ga0495651_0023185_106_1212 308
47 3300046516 Ga0495628_0240497 Ga0495628_0240497_161_1267 308
48 3300047319 Ga0495674_0002898 Ga0495674_0002898_1111_2160 308
49 3300047444 Ga0495675_0021571 Ga0495675_0021571_1821_2927 308
50 3300047471 Ga0495684_0050145 Ga0495684_0050145_372_1478 308
51 3300049575 Ga0501039_0119890 Ga0501039_0119890_467_1591 308
52 3300049576 Ga0501040_0175161 Ga0501040_0175161_86_1045 308
53 3300050507 nmdc:mga05p37_173260_c1 nmdc:mga05p37_173260_c1_1256_2230 308
54 3300050508 nmdc:mga09592_337691_c1 nmdc:mga09592_337691_c1_264_1229 308
55 3300050510 nmdc:mga06r32_17577_c1 nmdc:mga06r32_17577_c1_4215_5180 308
56 3300053084 Ga0495595_0155107 Ga0495595_0155107_30_1007 308
57 3300060353 Ga0501082_0095080 Ga0501082_0095080_169_1128 308
58 3300005329 Ga0070683_100005779 Ga0070683_1000057794 309
59 3300005329 Ga0070683_100015808 Ga0070683_1000158083 309
60 3300005331 Ga0070670_100009733 Ga0070670_1000097334 309
61 3300005334 Ga0068869_100047167 Ga0068869_1000471672 309
62 3300005335 Ga0070666_10224373 Ga0070666_102243731 309
63 3300005338 Ga0068868_100002201 Ga0068868_1000022016 309
64 3300005344 Ga0070661_100263331 Ga0070661_1002633311 309
65 3300005355 Ga0070671_100001427 Ga0070671_10000142714 309
66 3300005367 Ga0070667_100002990 Ga0070667_1000029909 309
67 3300005435 Ga0070714_100010176 Ga0070714_1000101762 309
68 3300005467 Ga0070706_100009210 Ga0070706_1000092103 309
69 3300005468 Ga0070707_100011064 Ga0070707_1000110643 309
70 3300005471 Ga0070698_100031372 Ga0070698_1000313723 309
71 3300005518 Ga0070699_100057097 Ga0070699_1000570972 309
72 3300005535 Ga0070684_100026707 Ga0070684_1000267074 309
73 3300005563 Ga0068855_100290574 Ga0068855_1002905742 309
74 3300005564 Ga0070664_100093608 Ga0070664_1000936082 309
75 3300005577 Ga0068857_100000346 Ga0068857_10000034623 309
76 3300005577 Ga0068857_100002083 Ga0068857_1000020834 309
77 3300005614 Ga0068856_100005566 Ga0068856_1000055667 309
78 3300005614 Ga0068856_100034933 Ga0068856_1000349333 309
79 3300005614 Ga0068856_100049023 Ga0068856_1000490234 309
80 3300005616 Ga0068852_100093389 Ga0068852_1000933893 309
81 3300005617 Ga0068859_100008361 Ga0068859_1000083612 309
82 3300005618 Ga0068864_100000516 Ga0068864_10000051628 309
83 3300005841 Ga0068863_100004761 Ga0068863_1000047612 309
84 3300005842 Ga0068858_100009154 Ga0068858_1000091545 309
85 3300005843 Ga0068860_100011630 Ga0068860_1000116304 309
86 3300005844 Ga0068862_100166278 Ga0068862_1001662783 309
87 3300005981 Ga0081538_10006852 Ga0081538_100068529 309
88 3300006237 Ga0097621_100004147 Ga0097621_1000041473 309
89 3300006358 Ga0068871_100069417 Ga0068871_1000694173 309
90 3300006844 Ga0075428_100040052 Ga0075428_1000400522 309
91 3300006880 Ga0075429_100098447 Ga0075429_1000984472 309
92 3300006931 Ga0097620_100008361 Ga0097620_1000083612 309
93 3300009093 Ga0105240_10001323 Ga0105240_1000132315 309
94 3300009093 Ga0105240_10014528 Ga0105240_100145285 309
95 3300009093 Ga0105240_10096451 Ga0105240_100964512 309
96 3300009093 Ga0105240_10384400 Ga0105240_103844002 309
97 3300009094 Ga0111539_10107614 Ga0111539_101076142 309
98 3300009098 Ga0105245_10000593 Ga0105245_100005937 309
99 3300009098 Ga0105245_10114853 Ga0105245_101148532 309
100 3300009101 Ga0105247_10026067 Ga0105247_100260674 309
101 3300009147 Ga0114129_10031850 Ga0114129_100318504 309
102 3300009147 Ga0114129_10149648 Ga0114129_101496482 309
103 3300009147 Ga0114129_10409171 Ga0114129_104091712 309
104 3300009174 Ga0105241_10001660 Ga0105241_1000166014 309
105 3300009177 Ga0105248_10000868 Ga0105248_1000086811 309
106 3300009177 Ga0105248_10009374 Ga0105248_100093747 309
107 3300009551 Ga0105238_10000558 Ga0105238_1000055831 309
108 3300009551 Ga0105238_10015055 Ga0105238_100150554 309
109 3300009551 Ga0105238_10015898 Ga0105238_100158985 309
110 3300009551 Ga0105238_10075099 Ga0105238_100750993 309
111 3300009553 Ga0105249_10053794 Ga0105249_100537943 309
112 3300010375 Ga0105239_10000723 Ga0105239_1000072327 309
113 3300011119 Ga0105246_10000999 Ga0105246_100009997 309
114 3300013105 Ga0157369_10016866 Ga0157369_100168663 309
115 3300013105 Ga0157369_10039761 Ga0157369_100397614 309
116 3300013105 Ga0157369_10090116 Ga0157369_100901162 309
117 3300013296 Ga0157374_10007650 Ga0157374_100076504 309
118 3300013296 Ga0157374_10017118 Ga0157374_100171184 309
119 3300013297 Ga0157378_10051703 Ga0157378_100517032 309
120 3300013307 Ga0157372_10024317 Ga0157372_100243172 309
121 3300013307 Ga0157372_10050195 Ga0157372_100501953 309
122 3300014325 Ga0163163_10003253 Ga0163163_1000325315 309
123 3300014968 Ga0157379_10022446 Ga0157379_100224461 309
124 3300014969 Ga0157376_10046903 Ga0157376_100469033 309
125 3300014969 Ga0157376_10066906 Ga0157376_100669062 309
126 3300025900 Ga0207710_10002698 Ga0207710_100026989 309
127 3300025910 Ga0207684_10026262 Ga0207684_100262623 309
128 3300025911 Ga0207654_10000668 Ga0207654_1000066815 309
129 3300025913 Ga0207695_10000113 Ga0207695_1000011336 309
130 3300025913 Ga0207695_10007675 Ga0207695_100076756 309
131 3300025913 Ga0207695_10403608 Ga0207695_104036082 309
132 3300025914 Ga0207671_10000506 Ga0207671_1000050644 309
133 3300025922 Ga0207646_10004467 Ga0207646_1000446711 309
134 3300025924 Ga0207694_10000076 Ga0207694_1000007652 309
135 3300025924 Ga0207694_10002679 Ga0207694_100026793 309
136 3300025925 Ga0207650_10005630 Ga0207650_100056306 309
137 3300025927 Ga0207687_10010978 Ga0207687_100109783 309
138 3300025931 Ga0207644_10022758 Ga0207644_100227584 309
139 3300025941 Ga0207711_10000794 Ga0207711_1000079410 309
140 3300025942 Ga0207689_10018634 Ga0207689_100186344 309
141 3300025949 Ga0207667_10129554 Ga0207667_101295542 309
142 3300025986 Ga0207658_10003790 Ga0207658_100037905 309
143 3300026023 Ga0207677_10000102 Ga0207677_1000010252 309
144 3300026035 Ga0207703_10009837 Ga0207703_100098375 309
145 3300026078 Ga0207702_10031342 Ga0207702_100313423 309
146 3300026078 Ga0207702_10080439 Ga0207702_100804392 309
147 3300026088 Ga0207641_10001490 Ga0207641_1000149020 309
148 3300026095 Ga0207676_10013540 Ga0207676_100135404 309
149 3300026116 Ga0207674_10001025 Ga0207674_100010257 309
150 3300026116 Ga0207674_10003095 Ga0207674_100030954 309
151 3300026142 Ga0207698_10116739 Ga0207698_101167392 309
152 3300027907 Ga0207428_10174373 Ga0207428_101743732 309
153 3300028381 Ga0268264_10015153 Ga0268264_100151535 309
154 3300028556 Ga0265337_1002692 Ga0265337_10026925 309
155 3300028563 Ga0265319_1006190 Ga0265319_10061902 309
156 3300028573 Ga0265334_10006318 Ga0265334_100063184 309
157 3300028800 Ga0265338_10000299 Ga0265338_1000029911 309
158 3300029957 Ga0265324_10004529 Ga0265324_100045292 309
159 3300031240 Ga0265320_10027617 Ga0265320_100276172 309
160 3300031241 Ga0265325_10007632 Ga0265325_100076322 309
161 3300031247 Ga0265340_10009186 Ga0265340_100091864 309
162 3300031249 Ga0265339_10080298 Ga0265339_100802982 309
163 3300031344 Ga0265316_10027450 Ga0265316_100274506 309
164 3300031456 Ga0307513_10236006 Ga0307513_102360061 309
165 3300031595 Ga0265313_10003783 Ga0265313_100037832 309
166 3300031711 Ga0265314_10002967 Ga0265314_100029675 309
167 3300031712 Ga0265342_10028451 Ga0265342_100284513 309
168 3300037312 Ga0395899_0008057 Ga0395899_0008057_5395_6375 309
169 3300037418 Ga0395900_0005816 Ga0395900_0005816_96_1076 309
170 3300037418 Ga0395900_0188540 Ga0395900_0188540_209_1183 309
171 3300037466 Ga0395898_0007734 Ga0395898_0007734_6284_7264 309
172 3300038443 Ga0395901_0008877 Ga0395901_0008877_1679_2659 309
173 3300045051 Ga0451576_0030918 Ga0451576_0030918_1900_3033 309
174 3300045976 Ga0466967_0026282 Ga0466967_0026282_686_1657 309
175 3300045976 Ga0466967_0153073 Ga0466967_0153073_717_1793 309
176 3300049568 Ga0501031_0069588 Ga0501031_0069588_60_1058 309
177 3300049574 Ga0501038_0008140 Ga0501038_0008140_443_1441 309
178 3300049575 Ga0501039_0050144 Ga0501039_0050144_958_1956 309
179 3300049578 Ga0501042_0039581 Ga0501042_0039581_1272_2270 309
180 3300049579 Ga0501043_0021647 Ga0501043_0021647_39_1037 309
181 3300049580 Ga0501046_0021764 Ga0501046_0021764_2963_4165 309
182 3300049582 Ga0501048_0074809 Ga0501048_0074809_361_1359 309
183 3300049590 Ga0501074_0005270 Ga0501074_0005270_1053_2051 309
184 3300049591 Ga0501075_0088002 Ga0501075_0088002_164_1162 309
185 3300049592 Ga0501076_0066683 Ga0501076_0066683_981_1979 309
186 3300049741 Ga0501079_0132095 Ga0501079_0132095_441_1439 309
187 3300049741 Ga0501079_0365672 Ga0501079_0365672_26_1009 309
188 3300049743 Ga0501081_0283808 Ga0501081_0283808_164_1162 309
189 3300049824 Ga0501045_0048812 Ga0501045_0048812_1705_2703 309
190 3300050507 nmdc:mga05p37_206495_c1 nmdc:mga05p37_206495_c1_760_1728 309
191 3300050511 nmdc:mga08y16_24234_c1 nmdc:mga08y16_24234_c1_1473_2612 309
192 3300053146 Ga0500588_0001508 Ga0500588_0001508_378_1490 309
193 3300054114 Ga0501084_0055655 Ga0501084_0055655_1052_2050 309
194 3300003322 rootL2_10048850 rootL2_1004885027 310
195 3300003323 rootH1_10138576 rootH1_1013857610 310
196 3300005518 Ga0070699_100172678 Ga0070699_1001726782 310
197 3300005536 Ga0070697_100030829 Ga0070697_1000308291 310
198 3300005719 Ga0068861_100357185 Ga0068861_1003571851 310
199 3300005981 Ga0081538_10001034 Ga0081538_1000103410 310
200 3300005981 Ga0081538_10008660 Ga0081538_100086604 310
201 3300006844 Ga0075428_100022077 Ga0075428_1000220775 310
202 3300006847 Ga0075431_100021464 Ga0075431_1000214645 310
203 3300006880 Ga0075429_100003227 Ga0075429_1000032275 310
204 3300009553 Ga0105249_10001091 Ga0105249_1000109123 310
205 3300025925 Ga0207650_10079890 Ga0207650_100798903 310
206 3300037312 Ga0395899_0066456 Ga0395899_0066456_67_1080 310
207 3300037418 Ga0395900_0300243 Ga0395900_0300243_279_1286 310
208 3300037471 Ga0395905_0061605 Ga0395905_0061605_1160_2173 310
209 3300046455 Ga0495603_0027592 Ga0495603_0027592_1620_2633 310
210 3300046475 Ga0495639_0056678 Ga0495639_0056678_363_1376 310
211 3300046476 Ga0495662_0057171 Ga0495662_0057171_686_1699 310
212 3300046523 Ga0495644_0057768 Ga0495644_0057768_359_1375 310
213 3300046531 Ga0495665_0083695 Ga0495665_0083695_326_1339 310
214 3300047315 Ga0495581_0010330 Ga0495581_0010330_676_1689 310
215 3300047673 Ga0495593_0057505 Ga0495593_0057505_452_1465 310
216 3300048913 Ga0496110_0231771 Ga0496110_0231771_198_1205 310
217 3300050508 nmdc:mga09592_69356_c1 nmdc:mga09592_69356_c1_543_1535 310
218 3300050509 nmdc:mga0qj67_47916_c1 nmdc:mga0qj67_47916_c1_930_1922 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

79

170

0.85

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

242

376

0.85

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

211

342

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9373 1 310
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9344 1 310
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9264 1 310
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9235 1 310
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.9208 2 310
ID Description Score Start End Superfamily
3tqhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 128 259 3.40.50.720
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9402 1 118 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9372 1 122 3.90.180.10
af_P28304_1_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9336 2 122 3.90.180.10
3tqhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.933 128 259 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A497ZA47-F1-model_v4 deleted 0.9831 1 310
AF-A0A497ZA47-F1-model_v4 deleted 0.98 1 310
AF-A0A2V9NJB6-F1-model_v4 NADPH:quinone reductase 0.978 137 309 GO:0008270
GO:0016491
AF-A0A0D6A346-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.975 113 309 GO:0016491
AF-A0A435GLL1-F1-model_v4 NADP-dependent oxidoreductase 0.9724 60 218 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map