F329894

General Info

Members Datasets Scaffolds Average Seq Length
218 135 436 405

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10233793|Ga0105245_102337932
Length 429
Sequence MATWHANARRRTTFLQENASRSNSDGLGRRHKPDYWLVALCIVLLAVGLIVVYAISPALSASAHVSSSYYVVKQLVAVGLSLVAFAITSQIPIERWRGTYKLLLAFAAGATLLAIAMPVNPQYPAHRWVRLGSSLSFQSVELLKFALLIWLAGFMAERIKNREVDNTNRTLKPLLIAMGVVGVGIAGIQSDLGSTGVIVLMMATMAYVAGMPFKRIMMIGGIIAVGLILAVSSTPYRRERLATYLHPEADCQTTGYQECQALIAVGSGGMIGLGIGRSVQANGYLPEAANDSIFAIYAEVFGFIGVLVLLGIFIALFGRLKSIAERAPDDFSRLIVVGVLTWLSVQTLINIGAMIGLLPLKGITLPFISYGGTSVVFVAAAVGLVFQVSRYTSYSAPRIVGEANRRAGYDNSYDGRRFRGAYHPNPSGR

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
124 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
131 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
134 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.48
Nodule 0
Rhizoplane 0.46
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 7.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10233793 3300009098 Bacteria 1779
2 JGI24741J21665_1007203 3300001915 Bacteria 2171
3 rootH2_10000244 3300003320 Bacteria 697651
4 rootH1_10009736 3300003323 Bacteria 7567
5 Ga0065704_10108271 3300005289 Bacteria 2034
6 Ga0070658_10000036 3300005327 Bacteria 143743
7 Ga0070658_10000064 3300005327 Bacteria 106537
8 Ga0070676_10002608 3300005328 Bacteria 9274
9 Ga0070683_100000111 3300005329 Bacteria 53589
10 Ga0070683_100017408 3300005329 Bacteria 6352
11 Ga0070690_100007810 3300005330 Bacteria 6133
12 Ga0070670_100010442 3300005331 Bacteria 7925
13 Ga0070680_100014054 3300005336 Bacteria 6251
14 Ga0070680_100148162 3300005336 Bacteria 1970
15 Ga0070682_100042930 3300005337 Bacteria 2794
16 Ga0070660_100000047 3300005339 Bacteria 69868
17 Ga0070660_100006083 3300005339 Bacteria 8345
18 Ga0070691_10022575 3300005341 Bacteria 2920
19 Ga0070659_100002677 3300005366 Bacteria 12665
20 Ga0070667_100000001 3300005367 Bacteria 1108638
21 Ga0070667_100026983 3300005367 Unclassified 4778
22 Ga0070714_100020104 3300005435 Bacteria 5448
23 Ga0070679_100000470 3300005530 Bacteria 34399
24 Ga0070679_100001189 3300005530 Bacteria 22865
25 Ga0070684_100002212 3300005535 Bacteria 14361
26 Ga0070684_100240169 3300005535 Unclassified 1655
27 Ga0068853_100053107 3300005539 Bacteria 3490
28 Ga0068853_100083315 3300005539 Bacteria 2802
29 Ga0070686_100017627 3300005544 Bacteria 4175
30 Ga0070686_100131496 3300005544 Unclassified 1731
31 Ga0070665_100151825 3300005548 Bacteria 2319
32 Ga0068855_100000003 3300005563 Bacteria 589862
33 Ga0068855_100002847 3300005563 Bacteria 21263
34 Ga0068855_100063929 3300005563 Bacteria 4293
35 Ga0070664_100038026 3300005564 Bacteria 4049
36 Ga0068857_100000011 3300005577 Bacteria 106771
37 Ga0068857_100006014 3300005577 Bacteria 10362
38 Ga0068857_100017095 3300005577 Bacteria 6354
39 Ga0068857_100257689 3300005577 Bacteria 1600
40 Ga0068856_100000001 3300005614 Bacteria 565602
41 Ga0068856_100026610 3300005614 Bacteria 5640
42 Ga0068856_100068965 3300005614 Bacteria 3496
43 Ga0068856_100174622 3300005614 Bacteria 2161
44 Ga0068858_100059253 3300005842 Unclassified 3539
45 Ga0068860_100132930 3300005843 Unclassified 2389
46 Ga0081455_10000003 3300005937 Bacteria 367763
47 Ga0075365_10000194 3300006038 Bacteria 20050
48 Ga0075368_10000018 3300006042 Bacteria 41733
49 Ga0075363_100000013 3300006048 Bacteria 41961
50 Ga0075364_10000048 3300006051 Bacteria 43021
51 Ga0075364_10004268 3300006051 Bacteria 8209
52 Ga0075364_10010947 3300006051 Bacteria 5499
53 Ga0075364_10019111 3300006051 Unclassified 4299
54 Ga0075362_10002070 3300006177 Bacteria 6620
55 Ga0075367_10003930 3300006178 Bacteria 7171
56 Ga0075367_10025500 3300006178 Unclassified 3344
57 Ga0075369_10000047 3300006186 Bacteria 31293
58 Ga0075366_10000001 3300006195 Bacteria 569172
59 Ga0075366_10000105 3300006195 Bacteria 33992
60 Ga0075366_10000268 3300006195 Bacteria 23079
61 Ga0075366_10023447 3300006195 Bacteria 3595
62 Ga0097621_100000002 3300006237 Bacteria 172240
63 Ga0075370_10004104 3300006353 Bacteria 7016
64 Ga0068871_100003371 3300006358 Bacteria 10979
65 Ga0105240_10082813 3300009093 Bacteria 3939
66 Ga0105245_10000001 3300009098 Bacteria 939270
67 Ga0105245_10000002 3300009098 Bacteria 634374
68 Ga0105245_10031972 3300009098 Bacteria 4659
69 Ga0105243_10006254 3300009148 Bacteria 9202
70 Ga0105241_10000007 3300009174 Bacteria 343524
71 Ga0105241_10002667 3300009174 Bacteria 13367
72 Ga0105241_10045145 3300009174 Bacteria 3342
73 Ga0105249_10000684 3300009553 Bacteria 30846
74 Ga0105239_10387280 3300010375 Bacteria 1581
75 Ga0157373_10000294 3300013100 Bacteria 40230
76 Ga0157373_10133907 3300013100 Archaea 1742
77 Ga0157371_10001223 3300013102 Bacteria 27300
78 Ga0157370_10070648 3300013104 Bacteria 3295
79 Ga0157370_10221319 3300013104 Bacteria 1753
80 Ga0157369_10000104 3300013105 Bacteria 118133
81 Ga0157369_10025321 3300013105 Bacteria 6587
82 Ga0157369_10052241 3300013105 Bacteria 4423
83 Ga0157374_10000018 3300013296 Bacteria 286683
84 Ga0157374_10002995 3300013296 Bacteria 14135
85 Ga0157372_10003053 3300013307 Bacteria 18047
86 Ga0207682_10018243 3300025893 Unclassified 2744
87 Ga0207647_10023172 3300025904 Bacteria 4111
88 Ga0207645_10006946 3300025907 Bacteria 8061
89 Ga0207705_10000011 3300025909 Bacteria 517768
90 Ga0207705_10001630 3300025909 Bacteria 17799
91 Ga0207654_10000002 3300025911 Bacteria 1460142
92 Ga0207654_10006055 3300025911 Bacteria 6080
93 Ga0207707_10017846 3300025912 Bacteria 6189
94 Ga0207695_10078764 3300025913 Bacteria 3343
95 Ga0207660_10008075 3300025917 Bacteria 6808
96 Ga0207660_10071647 3300025917 Bacteria 2522
97 Ga0207657_10003630 3300025919 Bacteria 16432
98 Ga0207657_10015782 3300025919 Bacteria 7300
99 Ga0207652_10001517 3300025921 Bacteria 20494
100 Ga0207652_10019209 3300025921 Bacteria 5616
101 Ga0207652_10033383 3300025921 Bacteria 4333
102 Ga0207650_10008522 3300025925 Bacteria 6999
103 Ga0207687_10000001 3300025927 Bacteria 1130810
104 Ga0207687_10000004 3300025927 Bacteria 841177
105 Ga0207687_10000008 3300025927 Bacteria 497738
106 Ga0207664_10001356 3300025929 Bacteria 16091
107 Ga0207644_10222736 3300025931 Unclassified 1496
108 Ga0207690_10004359 3300025932 Bacteria 8353
109 Ga0207709_10002234 3300025935 Bacteria 12335
110 Ga0207689_10133720 3300025942 Bacteria 2042
111 Ga0207661_10000996 3300025944 Bacteria 18714
112 Ga0207661_10011588 3300025944 Bacteria 6396
113 Ga0207679_10118919 3300025945 Bacteria 2100
114 Ga0207667_10000008 3300025949 Bacteria 625138
115 Ga0207667_10002907 3300025949 Bacteria 21273
116 Ga0207667_10052641 3300025949 Bacteria 4286
117 Ga0207667_10098166 3300025949 Bacteria 3023
118 Ga0207712_10000519 3300025961 Bacteria 31751
119 Ga0207658_10000003 3300025986 Bacteria 1151934
120 Ga0207658_10033600 3300025986 Unclassified 3660
121 Ga0207639_10060767 3300026041 Bacteria 2916
122 Ga0207702_10000062 3300026078 Bacteria 124850
123 Ga0207702_10178888 3300026078 Bacteria 1952
124 Ga0207674_10000001 3300026116 Bacteria 616581
125 Ga0207674_10017849 3300026116 Bacteria 7735
126 Ga0207674_10185372 3300026116 Bacteria 2031
127 Ga0207674_10368647 3300026116 Bacteria 1388
128 Ga0207698_10201061 3300026142 Bacteria 1784
129 Ga0209813_10000002 3300027866 Bacteria 215993
130 Ga0265337_1004600 3300028556 Bacteria 5684
131 Ga0265337_1005152 3300028556 Bacteria 5257
132 Ga0265338_10000381 3300028800 Bacteria 79305
133 Ga0265338_10076431 3300028800 Bacteria 2836
134 Ga0265338_10088990 3300028800 Bacteria 2560
135 Ga0265320_10005067 3300031240 Bacteria 8521
136 Ga0265327_10000017 3300031251 Bacteria 445264
137 Ga0265327_10001888 3300031251 Bacteria 24243
138 Ga0265327_10002278 3300031251 Bacteria 20624
139 Ga0265327_10064474 3300031251 Bacteria 1856
140 Ga0265316_10196288 3300031344 Bacteria 1497
141 Ga0395899_0030690 3300037312 Bacteria 4042
142 Ga0395899_0053552 3300037312 Unclassified 2987
143 Ga0395900_0001097 3300037418 Bacteria 34411
144 Ga0395900_0047616 3300037418 Unclassified 4414
145 Ga0395900_0109919 3300037418 Bacteria 2832
146 Ga0395898_0201660 3300037466 Bacteria 1899
147 Ga0395905_0001303 3300037471 Bacteria 30622
148 Ga0395905_0008792 3300037471 Bacteria 9927
149 Ga0395901_0017004 3300038443 Bacteria 7412
150 Ga0395901_0110469 3300038443 Bacteria 2886
151 Ga0451807_2341157 3300041486 Bacteria 6071
152 Ga0495622_0000051 3300046557 Bacteria 105674
153 Ga0495588_0000158 3300046674 Bacteria 91168
154 Ga0495658_0000297 3300046683 Bacteria 28276
155 Ga0495649_0000069 3300046694 Bacteria 90066
156 Ga0495600_0020749 3300046809 Bacteria 4203
157 Ga0495672_0000016 3300047320 Bacteria 500601
158 Ga0495672_0050770 3300047320 Bacteria 2446
159 Ga0501031_0000414 3300049568 Bacteria 24691
160 Ga0501032_0000616 3300049569 Bacteria 28840
161 Ga0501034_0003030 3300049571 Bacteria 19422
162 Ga0501034_0022635 3300049571 Bacteria 6402
163 Ga0501036_0007208 3300049572 Bacteria 9055
164 Ga0501036_0088502 3300049572 Bacteria 2617
165 Ga0501037_0000038 3300049573 Bacteria 121931
166 Ga0501037_0031990 3300049573 Unclassified 3884
167 Ga0501037_0278385 3300049573 Bacteria 1166
168 Ga0501038_0002777 3300049574 Bacteria 16283
169 Ga0501039_0046647 3300049575 Bacteria 3348
170 Ga0501042_0066747 3300049578 Unclassified 2572
171 Ga0501043_0000145 3300049579 Bacteria 65943
172 Ga0501046_0000065 3300049580 Bacteria 116095
173 Ga0501047_0000119 3300049581 Bacteria 96051
174 Ga0501047_0000227 3300049581 Bacteria 66683
175 Ga0501048_0001141 3300049582 Bacteria 19950
176 Ga0501048_0063607 3300049582 Bacteria 2609
177 Ga0501070_0010939 3300049586 Bacteria 7662
178 Ga0501070_0034309 3300049586 Unclassified 4243
179 Ga0501073_0006251 3300049589 Bacteria 8881
180 Ga0501073_0024597 3300049589 Bacteria 4324
181 Ga0501080_0000103 3300049742 Bacteria 58069
182 Ga0501035_0000570 3300049822 Bacteria 40767
183 Ga0501035_0004124 3300049822 Bacteria 13803
184 Ga0501044_0003010 3300049823 Bacteria 19077
185 Ga0501044_0036989 3300049823 Bacteria 5104
186 nmdc:mga03683_177_c1 3300050489 Bacteria 21301
187 nmdc:mga03683_6328_c1 3300050489 Unclassified 4048
188 nmdc:mga03n38_113_c1 3300050490 Bacteria 17467
189 nmdc:mga00v17_143064_c1 3300050491 Bacteria 1534
190 nmdc:mga00v17_166_c1 3300050491 Bacteria 38448
191 nmdc:mga00v17_52664_c1 3300050491 Bacteria 2477
192 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
193 nmdc:mga0k408_117_c2 3300050493 Bacteria 17853
194 nmdc:mga0k408_141_c1 3300050493 Bacteria 36516
195 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
196 nmdc:mga0k408_903_c1 3300050493 Bacteria 16225
197 nmdc:mga06z11_2371_c1 3300050494 Bacteria 7171
198 nmdc:mga06z11_31_c1 3300050494 Bacteria 57393
199 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
200 nmdc:mga07m45_34248_c1 3300050496 Bacteria 2823
201 nmdc:mga0sz30_14013_c1 3300050516 Bacteria 3148
202 nmdc:mga0sz30_4_c2 3300050516 Bacteria 152717
203 Ga0500610_0000002 3300053079 Bacteria 166752
204 Ga0500643_000010 3300053087 Bacteria 408084
205 Ga0500643_000391 3300053087 Bacteria 33789
206 Ga0500643_001783 3300053087 Bacteria 11800
207 Ga0500644_0000018 3300053088 Bacteria 104498
208 Ga0500566_0000001 3300053094 Bacteria 1101031
209 Ga0500555_000002 3300053103 Bacteria 1314346
210 Ga0500556_0000756 3300053104 Bacteria 19286
211 Ga0500562_000002 3300053108 Bacteria 977234
212 Ga0500614_000001 3300053123 Bacteria 1274484
213 Ga0500652_000079 3300053131 Bacteria 42430
214 Ga0500561_0000001 3300053137 Bacteria 957685
215 Ga0500568_0009317 3300053139 Bacteria 4674
216 Ga0500649_000002 3300053722 Bacteria 145889
217 Ga0500570_000003 3300053724 Bacteria 149500
218 Ga0501082_0093291 3300060353 Unclassified 2601
219 Ga0105245_10233793
220 JGI24741J21665_1007203
221 rootH2_10000244
222 rootH1_10009736
223 Ga0065704_10108271
224 Ga0070658_10000036
225 Ga0070658_10000064
226 Ga0070676_10002608
227 Ga0070683_100000111
228 Ga0070683_100017408
229 Ga0070690_100007810
230 Ga0070670_100010442
231 Ga0070680_100014054
232 Ga0070680_100148162
233 Ga0070682_100042930
234 Ga0070660_100000047
235 Ga0070660_100006083
236 Ga0070691_10022575
237 Ga0070659_100002677
238 Ga0070667_100000001
239 Ga0070667_100026983
240 Ga0070714_100020104
241 Ga0070679_100000470
242 Ga0070679_100001189
243 Ga0070684_100002212
244 Ga0070684_100240169
245 Ga0068853_100053107
246 Ga0068853_100083315
247 Ga0070686_100017627
248 Ga0070686_100131496
249 Ga0070665_100151825
250 Ga0068855_100000003
251 Ga0068855_100002847
252 Ga0068855_100063929
253 Ga0070664_100038026
254 Ga0068857_100000011
255 Ga0068857_100006014
256 Ga0068857_100017095
257 Ga0068857_100257689
258 Ga0068856_100000001
259 Ga0068856_100026610
260 Ga0068856_100068965
261 Ga0068856_100174622
262 Ga0068858_100059253
263 Ga0068860_100132930
264 Ga0081455_10000003
265 Ga0075365_10000194
266 Ga0075368_10000018
267 Ga0075363_100000013
268 Ga0075364_10000048
269 Ga0075364_10004268
270 Ga0075364_10010947
271 Ga0075364_10019111
272 Ga0075362_10002070
273 Ga0075367_10003930
274 Ga0075367_10025500
275 Ga0075369_10000047
276 Ga0075366_10000001
277 Ga0075366_10000105
278 Ga0075366_10000268
279 Ga0075366_10023447
280 Ga0097621_100000002
281 Ga0075370_10004104
282 Ga0068871_100003371
283 Ga0105240_10082813
284 Ga0105245_10000001
285 Ga0105245_10000002
286 Ga0105245_10031972
287 Ga0105243_10006254
288 Ga0105241_10000007
289 Ga0105241_10002667
290 Ga0105241_10045145
291 Ga0105249_10000684
292 Ga0105239_10387280
293 Ga0157373_10000294
294 Ga0157373_10133907
295 Ga0157371_10001223
296 Ga0157370_10070648
297 Ga0157370_10221319
298 Ga0157369_10000104
299 Ga0157369_10025321
300 Ga0157369_10052241
301 Ga0157374_10000018
302 Ga0157374_10002995
303 Ga0157372_10003053
304 Ga0207682_10018243
305 Ga0207647_10023172
306 Ga0207645_10006946
307 Ga0207705_10000011
308 Ga0207705_10001630
309 Ga0207654_10000002
310 Ga0207654_10006055
311 Ga0207707_10017846
312 Ga0207695_10078764
313 Ga0207660_10008075
314 Ga0207660_10071647
315 Ga0207657_10003630
316 Ga0207657_10015782
317 Ga0207652_10001517
318 Ga0207652_10019209
319 Ga0207652_10033383
320 Ga0207650_10008522
321 Ga0207687_10000001
322 Ga0207687_10000004
323 Ga0207687_10000008
324 Ga0207664_10001356
325 Ga0207644_10222736
326 Ga0207690_10004359
327 Ga0207709_10002234
328 Ga0207689_10133720
329 Ga0207661_10000996
330 Ga0207661_10011588
331 Ga0207679_10118919
332 Ga0207667_10000008
333 Ga0207667_10002907
334 Ga0207667_10052641
335 Ga0207667_10098166
336 Ga0207712_10000519
337 Ga0207658_10000003
338 Ga0207658_10033600
339 Ga0207639_10060767
340 Ga0207702_10000062
341 Ga0207702_10178888
342 Ga0207674_10000001
343 Ga0207674_10017849
344 Ga0207674_10185372
345 Ga0207674_10368647
346 Ga0207698_10201061
347 Ga0209813_10000002
348 Ga0265337_1004600
349 Ga0265337_1005152
350 Ga0265338_10000381
351 Ga0265338_10076431
352 Ga0265338_10088990
353 Ga0265320_10005067
354 Ga0265327_10000017
355 Ga0265327_10001888
356 Ga0265327_10002278
357 Ga0265327_10064474
358 Ga0265316_10196288
359 Ga0395899_0030690
360 Ga0395899_0053552
361 Ga0395900_0001097
362 Ga0395900_0047616
363 Ga0395900_0109919
364 Ga0395898_0201660
365 Ga0395905_0001303
366 Ga0395905_0008792
367 Ga0395901_0017004
368 Ga0395901_0110469
369 Ga0451807_2341157
370 Ga0495622_0000051
371 Ga0495588_0000158
372 Ga0495658_0000297
373 Ga0495649_0000069
374 Ga0495600_0020749
375 Ga0495672_0000016
376 Ga0495672_0050770
377 Ga0501031_0000414
378 Ga0501032_0000616
379 Ga0501034_0003030
380 Ga0501034_0022635
381 Ga0501036_0007208
382 Ga0501036_0088502
383 Ga0501037_0000038
384 Ga0501037_0031990
385 Ga0501037_0278385
386 Ga0501038_0002777
387 Ga0501039_0046647
388 Ga0501042_0066747
389 Ga0501043_0000145
390 Ga0501046_0000065
391 Ga0501047_0000119
392 Ga0501047_0000227
393 Ga0501048_0001141
394 Ga0501048_0063607
395 Ga0501070_0010939
396 Ga0501070_0034309
397 Ga0501073_0006251
398 Ga0501073_0024597
399 Ga0501080_0000103
400 Ga0501035_0000570
401 Ga0501035_0004124
402 Ga0501044_0003010
403 Ga0501044_0036989
404 nmdc:mga03683_177_c1
405 nmdc:mga03683_6328_c1
406 nmdc:mga03n38_113_c1
407 nmdc:mga00v17_143064_c1
408 nmdc:mga00v17_166_c1
409 nmdc:mga00v17_52664_c1
410 nmdc:mga0yw44_2_c1
411 nmdc:mga0k408_117_c2
412 nmdc:mga0k408_141_c1
413 nmdc:mga0k408_1_c1
414 nmdc:mga0k408_903_c1
415 nmdc:mga06z11_2371_c1
416 nmdc:mga06z11_31_c1
417 nmdc:mga04h51_2_c1
418 nmdc:mga07m45_34248_c1
419 nmdc:mga0sz30_14013_c1
420 nmdc:mga0sz30_4_c2
421 Ga0500610_0000002
422 Ga0500643_000010
423 Ga0500643_000391
424 Ga0500643_001783
425 Ga0500644_0000018
426 Ga0500566_0000001
427 Ga0500555_000002
428 Ga0500556_0000756
429 Ga0500562_000002
430 Ga0500614_000001
431 Ga0500652_000079
432 Ga0500561_0000001
433 Ga0500568_0009317
434 Ga0500649_000002
435 Ga0500570_000003
436 Ga0501082_0093291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

35

394

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8719 26 379
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8463 26 379
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8331 25 381
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8298 25 381
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8295 25 381
ID Description Score Start End Superfamily
af_Q2FVN1_194_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4451 26 114 1.20.1250.20
6dv1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3058 227 381 1.20.120.230
af_Q9XV34_215_427_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2596 28 220 1.20.1250.20
6dv1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2427 227 381 1.20.120.230
af_Q2FVN1_194_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2403 26 114 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1V5ZGQ9-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9245 23 380 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A800BQY8-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9133 19 383 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A1H5UTG3-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9092 19 381 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-V2Q9X1-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9089 27 380 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-U2RJL3-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9079 29 379 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301

Map