F329941

General Info

Members Datasets Scaffolds Average Seq Length
218 149 437 138

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10450547|Ga0157373_104505472
Length 155
Sequence LTFPQAPAYFLQALSPEQSMPRCRVTRRVHFNAAHRLHNPEATEGWNQATYGVCNNPNYHGHNYELIVQVTGTPDPATGYVMDMKVLSKITAEEVIERFDHKNLNLDTEFFQKLNPTAENIVIVIYNLLRTRIDAKLELKVRLHETERNFVEYPA

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
147 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
148 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
149 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 1.38
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 0
Rhizoplane 0.92
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 12.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10450547 3300013100 Bacteria 926
2 rootH1_10061358 3300003316 Bacteria 4965
3 rootH1_10080978 3300003316 Bacteria 12372
4 rootH2_10039028 3300003320 Bacteria 3118
5 rootL2_10039178 3300003322 Bacteria 4477
6 rootL2_10080012 3300003322 Bacteria 3106
7 rootH1_10017748 3300003316 Bacteria 1169
8 rootH1_10017748 3300003323 Bacteria 20274
9 rootH1_10032442 3300003323 Bacteria 6027
10 rootH1_10131799 3300003323 Unclassified 4097
11 rootH1_10165299 3300003323 Bacteria 2173
12 Ga0055536_1024319 3300003781 Bacteria 1756
13 Ga0055531_10000087 3300003794 Bacteria 101553
14 Ga0065165_1000266 3300005262 Bacteria 90228
15 Ga0070670_100999159 3300005331 Bacteria 761
16 Ga0068869_100221033 3300005334 Bacteria 1501
17 Ga0070666_10053422 3300005335 Bacteria 2725
18 Ga0070661_100168979 3300005344 Bacteria 1660
19 Ga0070668_100003612 3300005347 Bacteria 11413
20 Ga0070675_100270345 3300005354 Bacteria 1491
21 Ga0070674_100026112 3300005356 Bacteria 3811
22 Ga0070673_100878738 3300005364 Bacteria 830
23 Ga0070659_101196185 3300005366 Bacteria 672
24 Ga0070709_10150311 3300005434 Bacteria 1609
25 Ga0070708_100795902 3300005445 Unclassified 889
26 Ga0070663_100019282 3300005455 Bacteria 4492
27 Ga0070685_10524065 3300005466 Bacteria 842
28 Ga0070699_100341480 3300005518 Bacteria 1348
29 Ga0070679_102014294 3300005530 Bacteria 526
30 Ga0070697_100026466 3300005536 Bacteria 4635
31 Ga0068853_100000874 3300005539 Bacteria 21037
32 Ga0068853_100032104 3300005539 Bacteria 4447
33 Ga0068853_100193166 3300005539 Bacteria 1850
34 Ga0068853_100809985 3300005539 Bacteria 897
35 Ga0070672_100033813 3300005543 Bacteria 3875
36 Ga0070672_100119770 3300005543 Bacteria 2154
37 Ga0070695_100331086 3300005545 Bacteria 1135
38 Ga0070665_100000013 3300005548 Bacteria 484927
39 Ga0068855_100097958 3300005563 Bacteria 3378
40 Ga0068855_101001038 3300005563 Bacteria 878
41 Ga0068857_100008489 3300005577 Bacteria 8880
42 Ga0068854_100020712 3300005578 Bacteria 4456
43 Ga0068856_100199380 3300005614 Bacteria 2016
44 Ga0068856_101285497 3300005614 Unclassified 747
45 Ga0068852_100002206 3300005616 Bacteria 13369
46 Ga0068852_100019930 3300005616 Bacteria 5323
47 Ga0068852_100542125 3300005616 Bacteria 1163
48 Ga0068852_102028703 3300005616 Bacteria 597
49 Ga0068852_102061945 3300005616 Bacteria 592
50 Ga0068864_100193014 3300005618 Bacteria 1868
51 Ga0068861_100967103 3300005719 Bacteria 811
52 Ga0068851_10300758 3300005834 Bacteria 922
53 Ga0068870_10326762 3300005840 Unclassified 976
54 Ga0068858_100568619 3300005842 Bacteria 1098
55 Ga0068860_100000596 3300005843 Bacteria 43134
56 Ga0068860_100086641 3300005843 Bacteria 2981
57 Ga0068862_100527334 3300005844 Unclassified 1125
58 Ga0068862_100595671 3300005844 Bacteria 1061
59 Ga0070717_10250724 3300006028 Bacteria 1564
60 Ga0075366_10719836 3300006195 Bacteria 620
61 Ga0097621_100154339 3300006237 Bacteria 1970
62 Ga0068871_100122232 3300006358 Bacteria 2200
63 Ga0068871_100282062 3300006358 Bacteria 1453
64 Ga0075428_100007490 3300006844 Bacteria 12094
65 Ga0075428_100558010 3300006844 Bacteria 1224
66 Ga0075430_101062053 3300006846 Bacteria 667
67 Ga0075431_100099081 3300006847 Bacteria 3008
68 Ga0075429_100016828 3300006880 Bacteria 6329
69 Ga0075429_101532533 3300006880 Bacteria 580
70 Ga0068865_100851536 3300006881 Bacteria 790
71 Ga0105240_10002998 3300009093 Bacteria 26564
72 Ga0105240_10022461 3300009093 Bacteria 8362
73 Ga0105240_10044300 3300009093 Bacteria 5655
74 Ga0105240_10342207 3300009093 Bacteria 1699
75 Ga0105241_10000863 3300009174 Bacteria 23000
76 Ga0105241_10185156 3300009174 Bacteria 1730
77 Ga0105241_10981330 3300009174 Unclassified 789
78 Ga0105248_10015606 3300009177 Bacteria 8373
79 Ga0105248_10516983 3300009177 Bacteria 1346
80 Ga0105237_10006921 3300009545 Bacteria 12505
81 Ga0105237_10012741 3300009545 Bacteria 8845
82 Ga0105237_10033058 3300009545 Bacteria 5239
83 Ga0105237_12270279 3300009545 Bacteria 552
84 Ga0105238_10083431 3300009551 Bacteria 3185
85 Ga0105238_10098021 3300009551 Bacteria 2916
86 Ga0105249_10288109 3300009553 Unclassified 1643
87 Ga0105249_10325503 3300009553 Bacteria 1549
88 Ga0105239_10008565 3300010375 Bacteria 11608
89 Ga0105239_10065178 3300010375 Bacteria 4000
90 Ga0105239_10701574 3300010375 Unclassified 1157
91 Ga0157371_10001805 3300013102 Bacteria 21630
92 Ga0157371_10116766 3300013102 Bacteria 1896
93 Ga0157371_10122345 3300013102 Bacteria 1850
94 Ga0157371_10214082 3300013102 Bacteria 1383
95 Ga0157370_10005721 3300013104 Bacteria 13898
96 Ga0157370_10789267 3300013104 Bacteria 864
97 Ga0157369_10002231 3300013105 Bacteria 23333
98 Ga0157369_10732948 3300013105 Bacteria 1017
99 Ga0157369_10797770 3300013105 Bacteria 970
100 Ga0157369_11215149 3300013105 Bacteria 769
101 Ga0157374_10214722 3300013296 Bacteria 1887
102 Ga0157378_10118777 3300013297 Bacteria 2434
103 Ga0157378_10803061 3300013297 Bacteria 967
104 Ga0163162_10000629 3300013306 Bacteria 32711
105 Ga0157372_10000037 3300013307 Bacteria 172444
106 Ga0157372_10001377 3300013307 Bacteria 26250
107 Ga0157372_10047730 3300013307 Bacteria 4759
108 Ga0157372_10072397 3300013307 Bacteria 3884
109 Ga0157375_10919501 3300013308 Unclassified 1018
110 Ga0163163_11216953 3300014325 Bacteria 816
111 Ga0157379_10044690 3300014968 Bacteria 3954
112 Ga0157379_11348862 3300014968 Bacteria 690
113 Ga0157376_10002175 3300014969 Bacteria 13199
114 Ga0157376_10162548 3300014969 Bacteria 2026
115 Ga0157376_10923565 3300014969 Bacteria 892
116 Ga0206356_10603259 3300020070 Unclassified 859
117 Ga0209676_1000495 3300025292 Bacteria 63184
118 Ga0209050_1063216 3300025298 Bacteria 864
119 Ga0209257_1000006 3300025304 Bacteria 1570111
120 Ga0207697_10099868 3300025315 Bacteria 1236
121 Ga0207656_10472275 3300025321 Unclassified 635
122 Ga0207682_10408226 3300025893 Unclassified 642
123 Ga0207680_10045120 3300025903 Bacteria 2597
124 Ga0207647_10367202 3300025904 Bacteria 814
125 Ga0207654_10028722 3300025911 Bacteria 3035
126 Ga0207654_10161129 3300025911 Bacteria 1449
127 Ga0207695_10000698 3300025913 Bacteria 65751
128 Ga0207695_10008052 3300025913 Bacteria 13269
129 Ga0207695_10067154 3300025913 Bacteria 3680
130 Ga0207695_10107237 3300025913 Bacteria 2779
131 Ga0207695_10162629 3300025913 Bacteria 2163
132 Ga0207695_10300084 3300025913 Unclassified 1498
133 Ga0207671_10002048 3300025914 Bacteria 22134
134 Ga0207671_10010324 3300025914 Bacteria 7716
135 Ga0207681_10069425 3300025923 Bacteria 2451
136 Ga0207694_10073674 3300025924 Bacteria 2672
137 Ga0207694_10096807 3300025924 Bacteria 2334
138 Ga0207694_10167063 3300025924 Unclassified 1780
139 Ga0207659_10174966 3300025926 Bacteria 1696
140 Ga0207664_10467862 3300025929 Bacteria 1127
141 Ga0207706_10132670 3300025933 Bacteria 2191
142 Ga0207704_10774515 3300025938 Unclassified 799
143 Ga0207691_10010409 3300025940 Bacteria 8922
144 Ga0207711_10562959 3300025941 Bacteria 1063
145 Ga0207689_10246936 3300025942 Bacteria 1476
146 Ga0207667_10000221 3300025949 Bacteria 79940
147 Ga0207651_10399026 3300025960 Bacteria 1169
148 Ga0207651_11529790 3300025960 Bacteria 601
149 Ga0207712_10084685 3300025961 Bacteria 2317
150 Ga0207640_10010581 3300025981 Bacteria 5204
151 Ga0207658_11428033 3300025986 Unclassified 633
152 Ga0207703_10456942 3300026035 Unclassified 1194
153 Ga0207639_10004269 3300026041 Bacteria 9636
154 Ga0207639_10179344 3300026041 Bacteria 1800
155 Ga0207639_10248941 3300026041 Bacteria 1549
156 Ga0207678_10047465 3300026067 Bacteria 3714
157 Ga0207702_10158053 3300026078 Bacteria 2068
158 Ga0207702_10281688 3300026078 Bacteria 1572
159 Ga0207702_10498153 3300026078 Unclassified 1187
160 Ga0207674_10001679 3300026116 Bacteria 28464
161 Ga0207675_100286236 3300026118 Bacteria 1602
162 Ga0207698_10001412 3300026142 Bacteria 13929
163 Ga0207698_10060651 3300026142 Bacteria 2943
164 Ga0207698_10702113 3300026142 Bacteria 1007
165 Ga0268266_10000024 3300028379 Bacteria 490820
166 Ga0268265_10627597 3300028380 Bacteria 1030
167 Ga0268264_10001493 3300028381 Bacteria 21826
168 Ga0268264_10010098 3300028381 Bacteria 7812
169 Ga0265327_10235632 3300031251 Bacteria 819
170 Ga0307509_10143410 3300031507 Unclassified 2319
171 Ga0307408_101714617 3300031548 Bacteria 599
172 Ga0316576_10425192 3300031727 Bacteria 983
173 Ga0307516_10046814 3300031730 Unclassified 4266
174 Ga0307414_11204686 3300032004 Bacteria 701
175 Ga0307507_10272888 3300033179 Bacteria 1066
176 Ga0373941_0368812 3300035115 Unclassified 588
177 Ga0373935_0032806 3300035692 Bacteria 3229
178 Ga0395899_0000180 3300037312 Bacteria 92701
179 Ga0395901_0001566 3300038443 Bacteria 23712
180 Ga0395901_1210158 3300038443 Bacteria 721
181 Ga0436363_0179576 3300039450 Bacteria 2868
182 Ga0451807_1918947 3300041486 Unclassified 1171
183 Ga0451837_0791586 3300041494 Bacteria 820
184 Ga0451577_0044596 3300042876 Bacteria 3970
185 Ga0451577_0574990 3300042876 Bacteria 1023
186 Ga0466965_0402474 3300044683 Bacteria 756
187 Ga0453684_0017716 3300044712 Bacteria 11003
188 Ga0451576_0808796 3300045051 Bacteria 984
189 Ga0451576_0891102 3300045051 Bacteria 934
190 Ga0451576_2342195 3300045051 Bacteria 547
191 Ga0495603_0044759 3300046455 Bacteria 2641
192 Ga0495638_0074516 3300046460 Bacteria 2070
193 Ga0495638_0110791 3300046460 Bacteria 1631
194 Ga0495618_0371438 3300046514 Unclassified 879
195 Ga0495631_0307278 3300046518 Bacteria 675
196 Ga0495643_0456929 3300046522 Unclassified 555
197 Ga0495648_0011775 3300046524 Bacteria 6565
198 Ga0495633_0182808 3300046558 Bacteria 965
199 Ga0495670_0378299 3300046691 Unclassified 764
200 Ga0495660_0194926 3300046810 Bacteria 971
201 Ga0495687_000014 3300047443 Bacteria 366896
202 Ga0496104_0683466 3300048907 Bacteria 934
203 Ga0496124_0124389 3300048927 Bacteria 2056
204 nmdc:mga0k408_671400_c1 3300050493 Bacteria 608
205 nmdc:mga09592_32958_c1 3300050508 Bacteria 4321
206 nmdc:mga0qj67_903642_c1 3300050509 Bacteria 696
207 nmdc:mga06r32_121458_c1 3300050510 Bacteria 2577
208 Ga0500583_0032790 3300053092 Bacteria 2294
209 Ga0500650_0410761 3300053098 Unclassified 585
210 Ga0500562_038083 3300053108 Bacteria 1277
211 Ga0500642_0005225 3300053130 Bacteria 4171
212 Ga0500616_0062110 3300053153 Unclassified 1931
213 Ga0500622_0001634 3300053156 Bacteria 17538
214 Ga0587128_098417 3300059630 Bacteria 610
215 Ga0587061_05714 3300060244 Bacteria 596
216 2740031267 2739367866 Bacteria 4215900
217 2884936855 2884933994 Bacteria 4535041
218 2911141165 2911138879 Bacteria 5811561
219 2958514474 2958512119 Bacteria 4528530
220 Ga0157373_10450547
221 rootH1_10061358
222 rootH1_10080978
223 rootH2_10039028
224 rootL2_10039178
225 rootL2_10080012
226 rootH1_10017748
227 rootH1_10032442
228 rootH1_10131799
229 rootH1_10165299
230 Ga0055536_1024319
231 Ga0055531_10000087
232 Ga0065165_1000266
233 Ga0070670_100999159
234 Ga0068869_100221033
235 Ga0070666_10053422
236 Ga0070661_100168979
237 Ga0070668_100003612
238 Ga0070675_100270345
239 Ga0070674_100026112
240 Ga0070673_100878738
241 Ga0070659_101196185
242 Ga0070709_10150311
243 Ga0070708_100795902
244 Ga0070663_100019282
245 Ga0070685_10524065
246 Ga0070699_100341480
247 Ga0070679_102014294
248 Ga0070697_100026466
249 Ga0068853_100000874
250 Ga0068853_100032104
251 Ga0068853_100193166
252 Ga0068853_100809985
253 Ga0070672_100033813
254 Ga0070672_100119770
255 Ga0070695_100331086
256 Ga0070665_100000013
257 Ga0068855_100097958
258 Ga0068855_101001038
259 Ga0068857_100008489
260 Ga0068854_100020712
261 Ga0068856_100199380
262 Ga0068856_101285497
263 Ga0068852_100002206
264 Ga0068852_100019930
265 Ga0068852_100542125
266 Ga0068852_102028703
267 Ga0068852_102061945
268 Ga0068864_100193014
269 Ga0068861_100967103
270 Ga0068851_10300758
271 Ga0068870_10326762
272 Ga0068858_100568619
273 Ga0068860_100000596
274 Ga0068860_100086641
275 Ga0068862_100527334
276 Ga0068862_100595671
277 Ga0070717_10250724
278 Ga0075366_10719836
279 Ga0097621_100154339
280 Ga0068871_100122232
281 Ga0068871_100282062
282 Ga0075428_100007490
283 Ga0075428_100558010
284 Ga0075430_101062053
285 Ga0075431_100099081
286 Ga0075429_100016828
287 Ga0075429_101532533
288 Ga0068865_100851536
289 Ga0105240_10002998
290 Ga0105240_10022461
291 Ga0105240_10044300
292 Ga0105240_10342207
293 Ga0105241_10000863
294 Ga0105241_10185156
295 Ga0105241_10981330
296 Ga0105248_10015606
297 Ga0105248_10516983
298 Ga0105237_10006921
299 Ga0105237_10012741
300 Ga0105237_10033058
301 Ga0105237_12270279
302 Ga0105238_10083431
303 Ga0105238_10098021
304 Ga0105249_10288109
305 Ga0105249_10325503
306 Ga0105239_10008565
307 Ga0105239_10065178
308 Ga0105239_10701574
309 Ga0157371_10001805
310 Ga0157371_10116766
311 Ga0157371_10122345
312 Ga0157371_10214082
313 Ga0157370_10005721
314 Ga0157370_10789267
315 Ga0157369_10002231
316 Ga0157369_10732948
317 Ga0157369_10797770
318 Ga0157369_11215149
319 Ga0157374_10214722
320 Ga0157378_10118777
321 Ga0157378_10803061
322 Ga0163162_10000629
323 Ga0157372_10000037
324 Ga0157372_10001377
325 Ga0157372_10047730
326 Ga0157372_10072397
327 Ga0157375_10919501
328 Ga0163163_11216953
329 Ga0157379_10044690
330 Ga0157379_11348862
331 Ga0157376_10002175
332 Ga0157376_10162548
333 Ga0157376_10923565
334 Ga0206356_10603259
335 Ga0209676_1000495
336 Ga0209050_1063216
337 Ga0209257_1000006
338 Ga0207697_10099868
339 Ga0207656_10472275
340 Ga0207682_10408226
341 Ga0207680_10045120
342 Ga0207647_10367202
343 Ga0207654_10028722
344 Ga0207654_10161129
345 Ga0207695_10000698
346 Ga0207695_10008052
347 Ga0207695_10067154
348 Ga0207695_10107237
349 Ga0207695_10162629
350 Ga0207695_10300084
351 Ga0207671_10002048
352 Ga0207671_10010324
353 Ga0207681_10069425
354 Ga0207694_10073674
355 Ga0207694_10096807
356 Ga0207694_10167063
357 Ga0207659_10174966
358 Ga0207664_10467862
359 Ga0207706_10132670
360 Ga0207704_10774515
361 Ga0207691_10010409
362 Ga0207711_10562959
363 Ga0207689_10246936
364 Ga0207667_10000221
365 Ga0207651_10399026
366 Ga0207651_11529790
367 Ga0207712_10084685
368 Ga0207640_10010581
369 Ga0207658_11428033
370 Ga0207703_10456942
371 Ga0207639_10004269
372 Ga0207639_10179344
373 Ga0207639_10248941
374 Ga0207678_10047465
375 Ga0207702_10158053
376 Ga0207702_10281688
377 Ga0207702_10498153
378 Ga0207674_10001679
379 Ga0207675_100286236
380 Ga0207698_10001412
381 Ga0207698_10060651
382 Ga0207698_10702113
383 Ga0268266_10000024
384 Ga0268265_10627597
385 Ga0268264_10001493
386 Ga0268264_10010098
387 Ga0265327_10235632
388 Ga0307509_10143410
389 Ga0307408_101714617
390 Ga0316576_10425192
391 Ga0307516_10046814
392 Ga0307414_11204686
393 Ga0307507_10272888
394 Ga0373941_0368812
395 Ga0373935_0032806
396 Ga0395899_0000180
397 Ga0395901_0001566
398 Ga0395901_1210158
399 Ga0436363_0179576
400 Ga0451807_1918947
401 Ga0451837_0791586
402 Ga0451577_0044596
403 Ga0451577_0574990
404 Ga0466965_0402474
405 Ga0453684_0017716
406 Ga0451576_0808796
407 Ga0451576_0891102
408 Ga0451576_2342195
409 Ga0495603_0044759
410 Ga0495638_0074516
411 Ga0495638_0110791
412 Ga0495618_0371438
413 Ga0495631_0307278
414 Ga0495643_0456929
415 Ga0495648_0011775
416 Ga0495633_0182808
417 Ga0495670_0378299
418 Ga0495660_0194926
419 Ga0495687_000014
420 Ga0496104_0683466
421 Ga0496124_0124389
422 nmdc:mga0k408_671400_c1
423 nmdc:mga09592_32958_c1
424 nmdc:mga0qj67_903642_c1
425 nmdc:mga06r32_121458_c1
426 Ga0500583_0032790
427 Ga0500650_0410761
428 Ga0500562_038083
429 Ga0500642_0005225
430 Ga0500616_0062110
431 Ga0500622_0001634
432 Ga0587128_098417
433 Ga0587061_05714
434 2740031267
435 2884936855
436 2911141165
437 2958514474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

24

155

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9357 1 136
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9334 1 136
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9291 1 136
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9269 1 132
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9269 1 136
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9349 1 136 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9211 1 132 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9152 1 136 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9151 3 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9038 1 136 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A090X5N0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9822 62 133 GO:0046872
GO:0070497
AF-A0A512BBS9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9814 1 135 GO:0046872
GO:0070497
AF-A0A4Q3BHY6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9804 2 136 GO:0008616
GO:0046872
GO:0070497
AF-A0A0M9DSK3-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9803 1 135 GO:0008616
GO:0046872
GO:0070497
AF-A0A2E1AVZ2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9794 1 133 GO:0008616
GO:0046872
GO:0070497

Map