F330141

General Info

Members Datasets Scaffolds Average Seq Length
218 142 218 650

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100013980|Ga0307416_1000139803
Length 663
Sequence MTMTKAETLAELITNNRGVRRTITYLEAENSERVVDYAELYERALGILFHLQKLGARPGDKLVIYLANNEQFLDAFWAGMLGGIVPVPVALGISDEHKHKLLRIAKKLGQPFIYTDRKTLDRIGAFAGPAGEQPTYDALASRAFFAESINDISRAGQVQPVRPDDMAFIQFSSGSTSEPKGVVLTHRNILTNTRGAGEASRWNENDVNLTWMPLTHDMGLIGMHIMMFAHRMQLNVMPTELFIRRPLLWMNFASRKGVTVTSSPNFGYRHYLKVLGDRGIGDLDLSRVRLIYNGAEPISVELADEFMARLAPAKLARTAMYPVYGLAEATLVVSFPQPPGQMYEFVSVDRHQLAVGRPPAPLPKEHADALLLMAVGQPIPYSKVRIADDEDRELPEGTVGNILIGGDNVTRGYFENPEANVQGFSAADSDGERWLRTGDLGMLKGGKLYITGRAKEIIFVNGQNYYPHDIESIAIRADGLELGKVVAAGVRARHGSTDDLILFVLHRMDMKEFMPIAAQVTRLVNEHTGLEVAHVVPVKRIPKTTSGKIQRHLLEEDYVNGVYEAELGELAGLRAALEAAGGAKTTSNEIEKKLKDICDAALERNIDVQDNLFEIGASSLKLIEIHEKIDQVYPGLVDLTELFDFPTIAELSRHLEGKMAATV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 2.29
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 10.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017881 3300003203 Unclassified 2921
2 rootL2_10125675 3300003322 Bacteria 5549
3 Ga0065704_10011115 3300005289 Bacteria 2462
4 Ga0070658_10108803 3300005327 Unclassified 2295
5 Ga0070683_100026202 3300005329 Bacteria 5247
6 Ga0070690_100007381 3300005330 Bacteria 6296
7 Ga0070670_100041543 3300005331 Bacteria 3952
8 Ga0070670_100042174 3300005331 Bacteria 3922
9 Ga0068869_100075481 3300005334 Unclassified 2505
10 Ga0070680_100010754 3300005336 Bacteria 7064
11 Ga0068868_100056819 3300005338 Unclassified 3091
12 Ga0070661_100031520 3300005344 Bacteria 3835
13 Ga0070668_100056865 3300005347 Bacteria 3022
14 Ga0070671_100000151 3300005355 Bacteria 45208
15 Ga0070671_100024865 3300005355 Bacteria 4907
16 Ga0070671_100061911 3300005355 Unclassified 3116
17 Ga0070674_100015274 3300005356 Bacteria 4791
18 Ga0070673_100018684 3300005364 Unclassified 4959
19 Ga0070673_100063514 3300005364 Bacteria 2938
20 Ga0070667_100000506 3300005367 Bacteria 39414
21 Ga0070667_100016126 3300005367 Bacteria 6180
22 Ga0070667_100042028 3300005367 Bacteria 3834
23 Ga0070709_10002399 3300005434 Bacteria 10152
24 Ga0070713_100024124 3300005436 Bacteria 4734
25 Ga0070713_100052054 3300005436 Bacteria 3389
26 Ga0070700_100012546 3300005441 Bacteria 4734
27 Ga0070700_100021704 3300005441 Bacteria 3735
28 Ga0070678_100009594 3300005456 Bacteria 5873
29 Ga0070678_100026583 3300005456 Bacteria 3916
30 Ga0070672_100000631 3300005543 Bacteria 20634
31 Ga0070672_100017181 3300005543 Bacteria 5202
32 Ga0070686_100013852 3300005544 Bacteria 4629
33 Ga0070695_100001542 3300005545 Bacteria 12838
34 Ga0070696_100000337 3300005546 Bacteria 28436
35 Ga0070665_100002846 3300005548 Bacteria 18733
36 Ga0070665_100032004 3300005548 Bacteria 5294
37 Ga0068855_100000490 3300005563 Bacteria 48844
38 Ga0068855_100008875 3300005563 Bacteria 12151
39 Ga0070664_100001175 3300005564 Bacteria 20823
40 Ga0068856_100036416 3300005614 Bacteria 4824
41 Ga0068852_100024895 3300005616 Unclassified 4843
42 Ga0068859_100015707 3300005617 Bacteria 7608
43 Ga0068859_100144248 3300005617 Bacteria 2455
44 Ga0068864_100041768 3300005618 Bacteria 3922
45 Ga0068861_100004005 3300005719 Bacteria 9865
46 Ga0068861_100011077 3300005719 Bacteria 6266
47 Ga0068861_100014887 3300005719 Bacteria 5466
48 Ga0068861_100018192 3300005719 Bacteria 5001
49 Ga0068863_100000902 3300005841 Bacteria 29865
50 Ga0068863_100068731 3300005841 Bacteria 3351
51 Ga0068863_100080261 3300005841 Bacteria 3090
52 Ga0068858_100029761 3300005842 Bacteria 5073
53 Ga0068858_100041619 3300005842 Bacteria 4259
54 Ga0068860_100000086 3300005843 Bacteria 165786
55 Ga0068860_100035221 3300005843 Bacteria 4802
56 Ga0068862_100026021 3300005844 Bacteria 4917
57 Ga0068862_100044767 3300005844 Bacteria 3775
58 Ga0068862_100105202 3300005844 Bacteria 2473
59 Ga0081455_10000055 3300005937 Bacteria 121650
60 Ga0081455_10023862 3300005937 Bacteria 5681
61 Ga0081539_10000123 3300005985 Bacteria 181245
62 Ga0097621_100072659 3300006237 Unclassified 2845
63 Ga0097621_100131575 3300006237 Bacteria 2130
64 Ga0068871_100038868 3300006358 Bacteria 3804
65 Ga0075428_100006571 3300006844 Bacteria 12932
66 Ga0075431_100036696 3300006847 Bacteria 5049
67 Ga0075431_100080212 3300006847 Bacteria 3369
68 Ga0097620_100015707 3300006931 Bacteria 7608
69 Ga0097620_100144241 3300006931 Bacteria 2455
70 Ga0099795_10000002 3300007788 Bacteria 161112
71 Ga0099795_10001939 3300007788 Bacteria 4696
72 Ga0105240_10010706 3300009093 Bacteria 12871
73 Ga0105240_10019580 3300009093 Bacteria 9040
74 Ga0105240_10069752 3300009093 Bacteria 4350
75 Ga0105240_10140881 3300009093 Unclassified 2883
76 Ga0111539_10111068 3300009094 Bacteria 3217
77 Ga0105245_10008374 3300009098 Bacteria 9034
78 Ga0105247_10000121 3300009101 Bacteria 75837
79 Ga0105248_10010947 3300009177 Bacteria 10010
80 Ga0105248_10070653 3300009177 Bacteria 3920
81 Ga0105237_10070548 3300009545 Bacteria 3490
82 Ga0105238_10060769 3300009551 Bacteria 3782
83 Ga0105238_10076547 3300009551 Bacteria 3337
84 Ga0105249_10061988 3300009553 Bacteria 3432
85 Ga0099796_10000017 3300010159 Bacteria 48991
86 Ga0157374_10022974 3300013296 Bacteria 5570
87 Ga0157378_10041474 3300013297 Bacteria 4083
88 Ga0157378_10072341 3300013297 Bacteria 3098
89 Ga0163162_10055074 3300013306 Bacteria 4003
90 Ga0163162_10151391 3300013306 Bacteria 2438
91 Ga0157375_10011458 3300013308 Bacteria 7830
92 Ga0157375_10015078 3300013308 Bacteria 6912
93 Ga0157375_10027324 3300013308 Bacteria 5333
94 Ga0163163_10068663 3300014325 Bacteria 3527
95 Ga0157380_10044496 3300014326 Bacteria 3480
96 Ga0157379_10076365 3300014968 Bacteria 3000
97 Ga0157379_10077893 3300014968 Bacteria 2969
98 Ga0157379_10147245 3300014968 Bacteria 2124
99 Ga0157376_10006622 3300014969 Bacteria 8199
100 Ga0157376_10043445 3300014969 Unclassified 3688
101 Ga0157376_10128350 3300014969 Bacteria 2259
102 Ga0207682_10001798 3300025893 Bacteria 9815
103 Ga0207682_10002003 3300025893 Bacteria 9218
104 Ga0207710_10000156 3300025900 Bacteria 73078
105 Ga0207688_10004740 3300025901 Bacteria 7407
106 Ga0207699_10013423 3300025906 Bacteria 4193
107 Ga0207645_10015886 3300025907 Bacteria 4988
108 Ga0207643_10021754 3300025908 Bacteria 3528
109 Ga0207695_10015658 3300025913 Bacteria 8919
110 Ga0207649_10016526 3300025920 Unclassified 4165
111 Ga0207652_10130806 3300025921 Bacteria 2238
112 Ga0207646_10097473 3300025922 Bacteria 2634
113 Ga0207681_10078882 3300025923 Bacteria 2318
114 Ga0207659_10025933 3300025926 Bacteria 3948
115 Ga0207700_10072783 3300025928 Bacteria 2652
116 Ga0207644_10000799 3300025931 Bacteria 19939
117 Ga0207644_10022693 3300025931 Bacteria 4289
118 Ga0207644_10026581 3300025931 Bacteria 3989
119 Ga0207706_10043918 3300025933 Bacteria 3960
120 Ga0207706_10105689 3300025933 Unclassified 2477
121 Ga0207670_10041350 3300025936 Bacteria 3031
122 Ga0207669_10007067 3300025937 Bacteria 5165
123 Ga0207691_10001543 3300025940 Bacteria 22887
124 Ga0207691_10010796 3300025940 Bacteria 8765
125 Ga0207691_10042296 3300025940 Bacteria 4201
126 Ga0207691_10048362 3300025940 Bacteria 3900
127 Ga0207689_10019261 3300025942 Bacteria 5753
128 Ga0207679_10051949 3300025945 Unclassified 3004
129 Ga0207667_10000645 3300025949 Bacteria 45224
130 Ga0207651_10025962 3300025960 Bacteria 3650
131 Ga0207712_10035795 3300025961 Bacteria 3376
132 Ga0207658_10000537 3300025986 Bacteria 34554
133 Ga0207658_10023051 3300025986 Bacteria 4340
134 Ga0207658_10034953 3300025986 Bacteria 3596
135 Ga0207677_10008194 3300026023 Bacteria 5821
136 Ga0207703_10000366 3300026035 Bacteria 48363
137 Ga0207703_10028452 3300026035 Bacteria 4405
138 Ga0207708_10015959 3300026075 Bacteria 5640
139 Ga0207708_10022968 3300026075 Bacteria 4711
140 Ga0207641_10000411 3300026088 Bacteria 50003
141 Ga0207641_10050901 3300026088 Bacteria 3506
142 Ga0207641_10063681 3300026088 Bacteria 3150
143 Ga0207648_10054896 3300026089 Bacteria 3478
144 Ga0207676_10013963 3300026095 Bacteria 5764
145 Ga0207676_10028236 3300026095 Bacteria 4189
146 Ga0207675_100001275 3300026118 Bacteria 25212
147 Ga0207675_100005823 3300026118 Bacteria 11779
148 Ga0207675_100018411 3300026118 Bacteria 6512
149 Ga0207675_100027204 3300026118 Bacteria 5326
150 Ga0207675_100043250 3300026118 Bacteria 4207
151 Ga0207683_10004911 3300026121 Bacteria 11502
152 Ga0207683_10011874 3300026121 Bacteria 7433
153 Ga0207698_10004863 3300026142 Bacteria 8234
154 Ga0209179_1000024 3300027512 Bacteria 39428
155 Ga0268266_10001574 3300028379 Bacteria 26660
156 Ga0268266_10008290 3300028379 Bacteria 9258
157 Ga0268266_10063156 3300028379 Bacteria 3197
158 Ga0268265_10016999 3300028380 Bacteria 5009
159 Ga0268265_10031019 3300028380 Bacteria 3857
160 Ga0268264_10000044 3300028381 Bacteria 368079
161 Ga0268264_10004694 3300028381 Bacteria 11613
162 Ga0265319_1008520 3300028563 Bacteria 4479
163 Ga0265318_10001693 3300028577 Bacteria 12653
164 Ga0265338_10020816 3300028800 Bacteria 6876
165 Ga0307511_10075677 3300030521 Bacteria 2414
166 Ga0265330_10002825 3300031235 Bacteria 9299
167 Ga0265332_10001907 3300031238 Bacteria 11053
168 Ga0265328_10011600 3300031239 Unclassified 3516
169 Ga0265320_10002909 3300031240 Bacteria 11736
170 Ga0265320_10013060 3300031240 Bacteria 4793
171 Ga0265329_10000951 3300031242 Bacteria 14572
172 Ga0265340_10010888 3300031247 Bacteria 4852
173 Ga0265340_10025254 3300031247 Bacteria 3011
174 Ga0265331_10001388 3300031250 Bacteria 17792
175 Ga0265331_10006250 3300031250 Bacteria 7061
176 Ga0265331_10009263 3300031250 Bacteria 5544
177 Ga0265316_10003030 3300031344 Bacteria 17164
178 Ga0307513_10013197 3300031456 Bacteria 10148
179 Ga0307513_10016897 3300031456 Bacteria 8774
180 Ga0307513_10025101 3300031456 Bacteria 6916
181 Ga0307513_10088810 3300031456 Bacteria 3158
182 Ga0307509_10000162 3300031507 Bacteria 104449
183 Ga0265314_10000960 3300031711 Bacteria 33864
184 Ga0265314_10004588 3300031711 Bacteria 12751
185 Ga0265342_10007153 3300031712 Bacteria 8214
186 Ga0307516_10001589 3300031730 Bacteria 31238
187 Ga0307416_100013980 3300032002 Bacteria 5477
188 Ga0307411_10035584 3300032005 Bacteria 3111
189 Ga0307510_10065439 3300033180 Bacteria 3682
190 Ga0316574_0000373 3300035398 Bacteria 17415
191 Ga0436365_1384530 3300039437 Bacteria 4310
192 Ga0466959_0056594 3300045049 Bacteria 2861
193 Ga0451576_0008646 3300045051 Bacteria 11924
194 Ga0495584_0031308 3300046491 Bacteria 2693
195 Ga0495625_0006978 3300046660 Bacteria 9960
196 Ga0495604_0061870 3300047317 Bacteria 2862
197 Ga0496104_0006732 3300048907 Bacteria 10121
198 Ga0496104_0012390 3300048907 Bacteria 7666
199 Ga0496105_0052268 3300048908 Bacteria 3374
200 Ga0496110_0024211 3300048913 Bacteria 5171
201 Ga0496115_0001961 3300048918 Bacteria 14684
202 Ga0496116_0006307 3300048919 Bacteria 10794
203 Ga0496117_0000095 3300048920 Bacteria 198731
204 Ga0496118_0001497 3300048921 Bacteria 34886
205 Ga0496118_0026156 3300048921 Bacteria 4979
206 Ga0496119_0000836 3300048922 Bacteria 40927
207 Ga0496121_0000547 3300048924 Bacteria 70979
208 Ga0496124_0038623 3300048927 Bacteria 4144
209 Ga0496125_0000112 3300048928 Bacteria 188192
210 Ga0496125_0001399 3300048928 Bacteria 35285
211 Ga0496125_0003498 3300048928 Bacteria 18978
212 Ga0496126_0009146 3300048929 Bacteria 10573
213 Ga0496126_0105385 3300048929 Bacteria 2462
214 Ga0501068_0001626 3300049584 Bacteria 11988
215 Ga0501080_0000557 3300049742 Bacteria 29499
216 nmdc:mga06r32_10139_c1 3300050510 Bacteria 8505
217 nmdc:mga08x19_40701_c1 3300050514 Bacteria 2958
218 Ga0500597_003888 3300053120 Bacteria 4520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053120 Ga0500597_003888 Ga0500597_003888_1346_3127 521
2 3300025928 Ga0207700_10072783 Ga0207700_100727831 553
3 3300005841 Ga0068863_100000902 Ga0068863_1000009022 612
4 3300005842 Ga0068858_100029761 Ga0068858_1000297612 612
5 3300005843 Ga0068860_100000086 Ga0068860_10000008611 612
6 3300025986 Ga0207658_10034953 Ga0207658_100349532 612
7 3300026035 Ga0207703_10000366 Ga0207703_1000036634 612
8 3300026088 Ga0207641_10000411 Ga0207641_100004117 612
9 3300028381 Ga0268264_10000044 Ga0268264_100000446 612
10 3300048928 Ga0496125_0000112 Ga0496125_0000112_160738_162696 612
11 3300048929 Ga0496126_0105385 Ga0496126_0105385_81_2039 612
12 3300014968 Ga0157379_10147245 Ga0157379_101472452 613
13 3300031730 Ga0307516_10001589 Ga0307516_1000158924 616
14 3300046491 Ga0495584_0031308 Ga0495584_0031308_13_1947 621
15 3300014969 Ga0157376_10128350 Ga0157376_101283501 625
16 3300025940 Ga0207691_10042296 Ga0207691_100422962 625
17 3300045051 Ga0451576_0008646 Ga0451576_0008646_2464_4425 625
18 3300005289 Ga0065704_10011115 Ga0065704_100111151 627
19 3300035398 Ga0316574_0000373 Ga0316574_0000373_14173_16155 627
20 3300005434 Ga0070709_10002399 Ga0070709_100023992 628
21 3300005545 Ga0070695_100001542 Ga0070695_10000154210 628
22 3300025906 Ga0207699_10013423 Ga0207699_100134234 628
23 3300048922 Ga0496119_0000836 Ga0496119_0000836_7708_9666 629
24 3300048928 Ga0496125_0001399 Ga0496125_0001399_32084_34042 629
25 3300050510 nmdc:mga06r32_10139_c1 nmdc:mga06r32_10139_c1_1564_3501 629
26 3300032005 Ga0307411_10035584 Ga0307411_100355842 630
27 3300005719 Ga0068861_100011077 Ga0068861_1000110772 631
28 3300006358 Ga0068871_100038868 Ga0068871_1000388682 631
29 3300013306 Ga0163162_10151391 Ga0163162_101513912 631
30 3300049584 Ga0501068_0001626 Ga0501068_0001626_7819_9795 633
31 3300049742 Ga0501080_0000557 Ga0501080_0000557_26315_28291 633
32 3300005441 Ga0070700_100012546 Ga0070700_1000125463 634
33 3300026075 Ga0207708_10015959 Ga0207708_100159595 634
34 3300026118 Ga0207675_100043250 Ga0207675_1000432504 634
35 3300030521 Ga0307511_10075677 Ga0307511_100756771 635
36 3300003322 rootL2_10125675 rootL2_101256754 636
37 3300005327 Ga0070658_10108803 Ga0070658_101088031 636
38 3300005329 Ga0070683_100026202 Ga0070683_1000262024 636
39 3300005331 Ga0070670_100042174 Ga0070670_1000421743 636
40 3300005338 Ga0068868_100056819 Ga0068868_1000568192 636
41 3300005344 Ga0070661_100031520 Ga0070661_1000315201 636
42 3300005355 Ga0070671_100000151 Ga0070671_10000015118 636
43 3300005355 Ga0070671_100061911 Ga0070671_1000619112 636
44 3300005364 Ga0070673_100018684 Ga0070673_1000186844 636
45 3300005367 Ga0070667_100016126 Ga0070667_1000161262 636
46 3300005456 Ga0070678_100009594 Ga0070678_1000095945 636
47 3300005543 Ga0070672_100000631 Ga0070672_1000006313 636
48 3300005563 Ga0068855_100000490 Ga0068855_10000049014 636
49 3300005564 Ga0070664_100001175 Ga0070664_1000011753 636
50 3300005614 Ga0068856_100036416 Ga0068856_1000364163 636
51 3300005616 Ga0068852_100024895 Ga0068852_1000248952 636
52 3300005618 Ga0068864_100041768 Ga0068864_1000417683 636
53 3300005844 Ga0068862_100044767 Ga0068862_1000447673 636
54 3300006237 Ga0097621_100072659 Ga0097621_1000726592 636
55 3300009093 Ga0105240_10019580 Ga0105240_100195805 636
56 3300009093 Ga0105240_10069752 Ga0105240_100697523 636
57 3300009101 Ga0105247_10000121 Ga0105247_1000012122 636
58 3300009177 Ga0105248_10010947 Ga0105248_100109477 636
59 3300009545 Ga0105237_10070548 Ga0105237_100705483 636
60 3300009551 Ga0105238_10060769 Ga0105238_100607692 636
61 3300009551 Ga0105238_10076547 Ga0105238_100765473 636
62 3300009553 Ga0105249_10061988 Ga0105249_100619882 636
63 3300013297 Ga0157378_10041474 Ga0157378_100414741 636
64 3300013306 Ga0163162_10055074 Ga0163162_100550743 636
65 3300013308 Ga0157375_10015078 Ga0157375_100150782 636
66 3300014968 Ga0157379_10076365 Ga0157379_100763653 636
67 3300014968 Ga0157379_10077893 Ga0157379_100778932 636
68 3300025900 Ga0207710_10000156 Ga0207710_1000015643 636
69 3300025913 Ga0207695_10015658 Ga0207695_100156584 636
70 3300025920 Ga0207649_10016526 Ga0207649_100165263 636
71 3300025922 Ga0207646_10097473 Ga0207646_100974731 636
72 3300025926 Ga0207659_10025933 Ga0207659_100259333 636
73 3300025931 Ga0207644_10000799 Ga0207644_100007998 636
74 3300025931 Ga0207644_10026581 Ga0207644_100265811 636
75 3300025933 Ga0207706_10105689 Ga0207706_101056892 636
76 3300025940 Ga0207691_10048362 Ga0207691_100483623 636
77 3300025945 Ga0207679_10051949 Ga0207679_100519492 636
78 3300025949 Ga0207667_10000645 Ga0207667_1000064518 636
79 3300025961 Ga0207712_10035795 Ga0207712_100357952 636
80 3300025986 Ga0207658_10023051 Ga0207658_100230515 636
81 3300026023 Ga0207677_10008194 Ga0207677_100081942 636
82 3300026121 Ga0207683_10004911 Ga0207683_100049113 636
83 3300026142 Ga0207698_10004863 Ga0207698_100048636 636
84 3300028379 Ga0268266_10008290 Ga0268266_100082906 636
85 3300028381 Ga0268264_10004694 Ga0268264_100046947 636
86 3300031456 Ga0307513_10016897 Ga0307513_100168972 636
87 3300031507 Ga0307509_10000162 Ga0307509_1000016222 636
88 3300033180 Ga0307510_10065439 Ga0307510_100654392 636
89 3300039437 Ga0436365_1384530 Ga0436365_1384530_1993_3951 636
90 3300048913 Ga0496110_0024211 Ga0496110_0024211_3166_5124 636
91 3300048919 Ga0496116_0006307 Ga0496116_0006307_8246_10204 636
92 3300048920 Ga0496117_0000095 Ga0496117_0000095_19349_21307 636
93 3300048921 Ga0496118_0001497 Ga0496118_0001497_14594_16552 636
94 3300048924 Ga0496121_0000547 Ga0496121_0000547_44759_46717 636
95 3300048927 Ga0496124_0038623 Ga0496124_0038623_827_2785 636
96 3300048928 Ga0496125_0003498 Ga0496125_0003498_13601_15559 636
97 3300005330 Ga0070690_100007381 Ga0070690_1000073813 637
98 3300005331 Ga0070670_100041543 Ga0070670_1000415432 637
99 3300005334 Ga0068869_100075481 Ga0068869_1000754812 637
100 3300005347 Ga0070668_100056865 Ga0070668_1000568652 637
101 3300005356 Ga0070674_100015274 Ga0070674_1000152743 637
102 3300005367 Ga0070667_100042028 Ga0070667_1000420283 637
103 3300005441 Ga0070700_100021704 Ga0070700_1000217042 637
104 3300005456 Ga0070678_100026583 Ga0070678_1000265832 637
105 3300005543 Ga0070672_100017181 Ga0070672_1000171814 637
106 3300005544 Ga0070686_100013852 Ga0070686_1000138522 637
107 3300005548 Ga0070665_100002846 Ga0070665_10000284614 637
108 3300005548 Ga0070665_100032004 Ga0070665_1000320043 637
109 3300005617 Ga0068859_100015707 Ga0068859_1000157072 637
110 3300005617 Ga0068859_100144248 Ga0068859_1001442481 637
111 3300005719 Ga0068861_100004005 Ga0068861_1000040055 637
112 3300005719 Ga0068861_100014887 Ga0068861_1000148874 637
113 3300005841 Ga0068863_100068731 Ga0068863_1000687313 637
114 3300005842 Ga0068858_100041619 Ga0068858_1000416193 637
115 3300005843 Ga0068860_100035221 Ga0068860_1000352212 637
116 3300005937 Ga0081455_10023862 Ga0081455_100238625 637
117 3300006847 Ga0075431_100080212 Ga0075431_1000802123 637
118 3300006931 Ga0097620_100015707 Ga0097620_1000157072 637
119 3300006931 Ga0097620_100144241 Ga0097620_1001442412 637
120 3300007788 Ga0099795_10000002 Ga0099795_1000000230 637
121 3300007788 Ga0099795_10001939 Ga0099795_100019392 637
122 3300009098 Ga0105245_10008374 Ga0105245_100083744 637
123 3300009177 Ga0105248_10070653 Ga0105248_100706532 637
124 3300010159 Ga0099796_10000017 Ga0099796_1000001728 637
125 3300013296 Ga0157374_10022974 Ga0157374_100229744 637
126 3300013297 Ga0157378_10072341 Ga0157378_100723412 637
127 3300013308 Ga0157375_10011458 Ga0157375_100114587 637
128 3300013308 Ga0157375_10027324 Ga0157375_100273242 637
129 3300014969 Ga0157376_10006622 Ga0157376_100066228 637
130 3300025893 Ga0207682_10001798 Ga0207682_100017984 637
131 3300025893 Ga0207682_10002003 Ga0207682_100020036 637
132 3300025908 Ga0207643_10021754 Ga0207643_100217543 637
133 3300025933 Ga0207706_10043918 Ga0207706_100439182 637
134 3300025937 Ga0207669_10007067 Ga0207669_100070674 637
135 3300025940 Ga0207691_10001543 Ga0207691_100015437 637
136 3300025940 Ga0207691_10010796 Ga0207691_100107967 637
137 3300025960 Ga0207651_10025962 Ga0207651_100259622 637
138 3300026035 Ga0207703_10028452 Ga0207703_100284523 637
139 3300026075 Ga0207708_10022968 Ga0207708_100229682 637
140 3300026118 Ga0207675_100001275 Ga0207675_1000012758 637
141 3300026118 Ga0207675_100005823 Ga0207675_1000058236 637
142 3300026118 Ga0207675_100018411 Ga0207675_1000184117 637
143 3300026121 Ga0207683_10011874 Ga0207683_100118744 637
144 3300027512 Ga0209179_1000024 Ga0209179_100002415 637
145 3300028379 Ga0268266_10001574 Ga0268266_1000157420 637
146 3300028380 Ga0268265_10016999 Ga0268265_100169992 637
147 3300028563 Ga0265319_1008520 Ga0265319_10085203 637
148 3300028577 Ga0265318_10001693 Ga0265318_1000169313 637
149 3300028800 Ga0265338_10020816 Ga0265338_100208162 637
150 3300031235 Ga0265330_10002825 Ga0265330_100028254 637
151 3300031238 Ga0265332_10001907 Ga0265332_100019072 637
152 3300031240 Ga0265320_10002909 Ga0265320_100029092 637
153 3300031242 Ga0265329_10000951 Ga0265329_100009513 637
154 3300031250 Ga0265331_10001388 Ga0265331_1000138817 637
155 3300031344 Ga0265316_10003030 Ga0265316_100030302 637
156 3300031456 Ga0307513_10013197 Ga0307513_100131973 637
157 3300031456 Ga0307513_10025101 Ga0307513_100251012 637
158 3300031456 Ga0307513_10088810 Ga0307513_100888102 637
159 3300031711 Ga0265314_10004588 Ga0265314_100045888 637
160 3300031712 Ga0265342_10007153 Ga0265342_100071538 637
161 3300032002 Ga0307416_100013980 Ga0307416_1000139803 637
162 3300045049 Ga0466959_0056594 Ga0466959_0056594_118_2085 637
163 3300046660 Ga0495625_0006978 Ga0495625_0006978_2467_4440 637
164 3300047317 Ga0495604_0061870 Ga0495604_0061870_711_2675 637
165 3300048907 Ga0496104_0006732 Ga0496104_0006732_7926_9887 637
166 3300048921 Ga0496118_0026156 Ga0496118_0026156_2268_4232 637
167 3300050514 nmdc:mga08x19_40701_c1 nmdc:mga08x19_40701_c1_175_2139 637
168 3300005336 Ga0070680_100010754 Ga0070680_1000107542 638
169 3300005355 Ga0070671_100024865 Ga0070671_1000248653 638
170 3300005364 Ga0070673_100063514 Ga0070673_1000635142 638
171 3300005367 Ga0070667_100000506 Ga0070667_10000050629 638
172 3300005436 Ga0070713_100024124 Ga0070713_1000241242 638
173 3300005563 Ga0068855_100008875 Ga0068855_1000088757 638
174 3300005841 Ga0068863_100080261 Ga0068863_1000802612 638
175 3300005844 Ga0068862_100026021 Ga0068862_1000260213 638
176 3300005844 Ga0068862_100105202 Ga0068862_1001052022 638
177 3300005937 Ga0081455_10000055 Ga0081455_1000005588 638
178 3300006237 Ga0097621_100131575 Ga0097621_1001315751 638
179 3300006844 Ga0075428_100006571 Ga0075428_1000065715 638
180 3300006847 Ga0075431_100036696 Ga0075431_1000366964 638
181 3300009093 Ga0105240_10010706 Ga0105240_1001070610 638
182 3300009093 Ga0105240_10140881 Ga0105240_101408812 638
183 3300009094 Ga0111539_10111068 Ga0111539_101110683 638
184 3300014325 Ga0163163_10068663 Ga0163163_100686632 638
185 3300014326 Ga0157380_10044496 Ga0157380_100444962 638
186 3300014969 Ga0157376_10043445 Ga0157376_100434452 638
187 3300025901 Ga0207688_10004740 Ga0207688_100047403 638
188 3300025907 Ga0207645_10015886 Ga0207645_100158863 638
189 3300025921 Ga0207652_10130806 Ga0207652_101308062 638
190 3300025923 Ga0207681_10078882 Ga0207681_100788822 638
191 3300025931 Ga0207644_10022693 Ga0207644_100226932 638
192 3300025936 Ga0207670_10041350 Ga0207670_100413502 638
193 3300025942 Ga0207689_10019261 Ga0207689_100192612 638
194 3300025986 Ga0207658_10000537 Ga0207658_100005378 638
195 3300026088 Ga0207641_10050901 Ga0207641_100509012 638
196 3300026088 Ga0207641_10063681 Ga0207641_100636812 638
197 3300026089 Ga0207648_10054896 Ga0207648_100548962 638
198 3300026095 Ga0207676_10013963 Ga0207676_100139632 638
199 3300026095 Ga0207676_10028236 Ga0207676_100282364 638
200 3300028379 Ga0268266_10063156 Ga0268266_100631562 638
201 3300028380 Ga0268265_10031019 Ga0268265_100310192 638
202 3300031239 Ga0265328_10011600 Ga0265328_100116003 638
203 3300031240 Ga0265320_10013060 Ga0265320_100130603 638
204 3300031250 Ga0265331_10006250 Ga0265331_100062506 638
205 3300031250 Ga0265331_10009263 Ga0265331_100092633 638
206 3300031711 Ga0265314_10000960 Ga0265314_1000096032 638
207 3300048929 Ga0496126_0009146 Ga0496126_0009146_2303_4279 638
208 3300003203 JGI25406J46586_10017881 JGI25406J46586_100178812 639
209 3300005436 Ga0070713_100052054 Ga0070713_1000520543 639
210 3300005546 Ga0070696_100000337 Ga0070696_10000033729 639
211 3300005719 Ga0068861_100018192 Ga0068861_1000181922 639
212 3300005985 Ga0081539_10000123 Ga0081539_1000012340 639
213 3300026118 Ga0207675_100027204 Ga0207675_1000272042 639
214 3300031247 Ga0265340_10010888 Ga0265340_100108884 639
215 3300031247 Ga0265340_10025254 Ga0265340_100252541 639
216 3300048907 Ga0496104_0012390 Ga0496104_0012390_4866_6857 639
217 3300048908 Ga0496105_0052268 Ga0496105_0052268_71_2062 639
218 3300048918 Ga0496115_0001961 Ga0496115_0001961_41_2032 639

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

588

655

0.87

PF00501

AMP-binding

AMP-binding enzyme

14

414

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pxh-assembly3.cif.gz_F structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain 0.9177 564 630
4neo-assembly1.cif.gz_A structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis 0.9138 560 634
4hkg-assembly2.cif.gz_B crystal structure of free-standing peptidyl carrier protein from uncharacterized acinetobacter baumannii secondary metabolic pathway 0.9063 561 634
8h6s-assembly1.cif.gz_C structure of acyltransferase vink in complex with the loading acyl carrier protein of vicenistatin pks 0.901 561 634
8g3j-assembly2.cif.gz_B non-ribosomal pcp-c didomain r2577g (thioether stabilised glycolic acid) acceptor bound state 0.8941 564 630
ID Description Score Start End Superfamily
1mdbA03 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9246 377 445 2.30.38.10
2d1qA01 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9234 371 445 2.30.38.10
af_I6Y231_2022_2106_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9195 561 635 1.10.1200.10
4pxhD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9192 564 630 1.10.1200.10
5u95D03 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9151 373 445 2.30.38.10
ID Description Score Start End GO Terms
AF-T1A0V2-F1-model_v4 AMP-dependent synthetase and ligase 0.9546 61 237 GO:0016874
AF-T1BKV0-F1-model_v4 Amino acid adenylation 0.9521 61 177 GO:0016020
AF-A0A849GNP7-F1-model_v4 deleted 0.9508 1 145
AF-T1A0V2-F1-model_v4 AMP-dependent synthetase and ligase 0.9442 61 237 GO:0016874
AF-A0A6B0Q1M0-F1-model_v4 deleted 0.9425 1 373

Feature Viewer

pLDDT pTM Quality
87.31 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map