F330284
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 218 | 153 | 215 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0027253|Ga0466967_0027253_3348_4388 |
| Length | 346 |
| Sequence | MWTVVSARILHDRMKTMTTSVAAHRTTALRRAGVRATLAPSVHNTQPWRFVLSADQLRIYADRSRQLHVLDPTGRQLTISCGCALMNARVSLAGDGLDVTVERFPVADQPDLLARIRPTFGASSPAEGLAVLDHVLEIRQTNRRHFTGAEVPEEVLDVLEQAAAAEDSELYVIRDEATRLSVAALSQHADAIENLNPAYRAELRAWTTDDPGRRDGVPNLAVPHVDGTADDEVPIRDFDTRGTGGLPAATRSSKDQCLVLLCTRGDSPADWLRGGEALERVLLEITRHGFVASPLTQVTEVPSARAQLRRQLGMTAFPHVLLRIGRAPIAPQSRRRRLVEVLSEEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 92 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 93 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 94 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 102 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 103 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 104 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 105 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 106 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 107 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 108 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 109 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 110 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 111 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 112 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 115 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 116 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 117 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 118 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 119 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 121 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 124 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 125 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 126 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 127 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 128 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 129 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.09 |
| Rhizosphere | 86.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10143873 | 3300005327 | Bacteria | 1993 |
| 2 | Ga0070690_100102677 | 3300005330 | Bacteria | 1897 |
| 3 | Ga0070666_10019145 | 3300005335 | Bacteria | 4416 |
| 4 | Ga0070682_100037620 | 3300005337 | Bacteria | 2964 |
| 5 | Ga0070660_100097036 | 3300005339 | Bacteria | 2331 |
| 6 | Ga0070660_100221506 | 3300005339 | Unclassified | 1538 |
| 7 | Ga0070692_10007963 | 3300005345 | Bacteria | 4700 |
| 8 | Ga0070668_100024160 | 3300005347 | Bacteria | 4603 |
| 9 | Ga0070668_100121837 | 3300005347 | Bacteria | 2085 |
| 10 | Ga0070669_100083043 | 3300005353 | Bacteria | 2389 |
| 11 | Ga0070671_100034745 | 3300005355 | Bacteria | 4174 |
| 12 | Ga0070659_100054636 | 3300005366 | Bacteria | 3145 |
| 13 | Ga0070667_100055994 | 3300005367 | Bacteria | 3330 |
| 14 | Ga0070667_100097531 | 3300005367 | Bacteria | 2536 |
| 15 | Ga0070714_100000008 | 3300005435 | Bacteria | 278734 |
| 16 | Ga0070700_100278530 | 3300005441 | Bacteria | 1212 |
| 17 | Ga0070663_100182558 | 3300005455 | Bacteria | 1629 |
| 18 | Ga0070684_100280431 | 3300005535 | Bacteria | 1527 |
| 19 | Ga0068853_100043539 | 3300005539 | Bacteria | 3841 |
| 20 | Ga0070686_100067045 | 3300005544 | Bacteria | 2336 |
| 21 | Ga0070665_100020781 | 3300005548 | Bacteria | 6598 |
| 22 | Ga0070665_100433410 | 3300005548 | Bacteria | 1324 |
| 23 | Ga0070704_100045421 | 3300005549 | Bacteria | 3056 |
| 24 | Ga0068855_100015000 | 3300005563 | Bacteria | 9332 |
| 25 | Ga0068855_100034220 | 3300005563 | Bacteria | 6060 |
| 26 | Ga0068855_100085220 | 3300005563 | Bacteria | 3657 |
| 27 | Ga0068855_100183845 | 3300005563 | Bacteria | 2362 |
| 28 | Ga0068855_100336917 | 3300005563 | Bacteria | 1664 |
| 29 | Ga0070664_100226534 | 3300005564 | Bacteria | 1674 |
| 30 | Ga0068857_100069248 | 3300005577 | Unclassified | 3142 |
| 31 | Ga0068854_100184756 | 3300005578 | Bacteria | 1630 |
| 32 | Ga0068856_100064657 | 3300005614 | Bacteria | 3615 |
| 33 | Ga0068856_100105123 | 3300005614 | Bacteria | 2817 |
| 34 | Ga0070702_100008065 | 3300005615 | Bacteria | 5084 |
| 35 | Ga0068852_100570302 | 3300005616 | Bacteria | 1134 |
| 36 | Ga0068859_100002765 | 3300005617 | Bacteria | 17784 |
| 37 | Ga0068859_100003454 | 3300005617 | Bacteria | 16063 |
| 38 | Ga0068866_10076234 | 3300005718 | Bacteria | 1788 |
| 39 | Ga0068861_100033105 | 3300005719 | Bacteria | 3811 |
| 40 | Ga0068870_10056381 | 3300005840 | Bacteria | 2097 |
| 41 | Ga0068863_100001131 | 3300005841 | Bacteria | 26659 |
| 42 | Ga0068858_100018553 | 3300005842 | Bacteria | 6513 |
| 43 | Ga0068858_100317874 | 3300005842 | Bacteria | 1487 |
| 44 | Ga0068860_100000767 | 3300005843 | Bacteria | 36120 |
| 45 | Ga0068860_100509232 | 3300005843 | Bacteria | 1202 |
| 46 | Ga0081455_10007337 | 3300005937 | Bacteria | 11627 |
| 47 | Ga0081455_10023348 | 3300005937 | Bacteria | 5757 |
| 48 | Ga0070717_10033615 | 3300006028 | Bacteria | 4137 |
| 49 | Ga0070716_100097175 | 3300006173 | Bacteria | 1797 |
| 50 | Ga0068871_100179549 | 3300006358 | Bacteria | 1818 |
| 51 | Ga0075434_100077176 | 3300006871 | Bacteria | 3326 |
| 52 | Ga0097620_100002765 | 3300006931 | Bacteria | 17784 |
| 53 | Ga0097620_100003454 | 3300006931 | Bacteria | 16063 |
| 54 | Ga0105240_10041070 | 3300009093 | Bacteria | 5908 |
| 55 | Ga0105240_10107451 | 3300009093 | Bacteria | 3383 |
| 56 | Ga0105240_10112392 | 3300009093 | Bacteria | 3293 |
| 57 | Ga0105240_10169743 | 3300009093 | Bacteria | 2585 |
| 58 | Ga0105240_10341916 | 3300009093 | Bacteria | 1700 |
| 59 | Ga0105240_10607411 | 3300009093 | Bacteria | 1203 |
| 60 | Ga0111539_10352115 | 3300009094 | Bacteria | 1714 |
| 61 | Ga0105245_10038034 | 3300009098 | Bacteria | 4279 |
| 62 | Ga0105245_10151341 | 3300009098 | Bacteria | 2194 |
| 63 | Ga0105247_10004806 | 3300009101 | Bacteria | 8598 |
| 64 | Ga0105247_10007712 | 3300009101 | Bacteria | 6586 |
| 65 | Ga0105247_10085605 | 3300009101 | Bacteria | 1993 |
| 66 | Ga0105243_10370262 | 3300009148 | Bacteria | 1321 |
| 67 | Ga0105241_10086618 | 3300009174 | Bacteria | 2464 |
| 68 | Ga0105248_10061555 | 3300009177 | Bacteria | 4215 |
| 69 | Ga0105248_10732367 | 3300009177 | Unclassified | 1116 |
| 70 | Ga0105237_10050526 | 3300009545 | Bacteria | 4178 |
| 71 | Ga0105237_10164943 | 3300009545 | Bacteria | 2214 |
| 72 | Ga0105238_10131797 | 3300009551 | Bacteria | 2478 |
| 73 | Ga0105238_10189931 | 3300009551 | Bacteria | 2030 |
| 74 | Ga0105238_10250788 | 3300009551 | Bacteria | 1748 |
| 75 | Ga0105239_10078026 | 3300010375 | Bacteria | 3645 |
| 76 | Ga0105239_10168231 | 3300010375 | Bacteria | 2451 |
| 77 | Ga0105246_10088773 | 3300011119 | Bacteria | 2222 |
| 78 | Ga0157370_10076496 | 3300013104 | Bacteria | 3153 |
| 79 | Ga0157370_10100806 | 3300013104 | Bacteria | 2705 |
| 80 | Ga0157370_10236645 | 3300013104 | Bacteria | 1690 |
| 81 | Ga0157369_10107373 | 3300013105 | Bacteria | 2969 |
| 82 | Ga0157374_10008615 | 3300013296 | Bacteria | 8725 |
| 83 | Ga0157374_10412530 | 3300013296 | Bacteria | 1348 |
| 84 | Ga0157378_10182932 | 3300013297 | Bacteria | 1973 |
| 85 | Ga0163162_10030123 | 3300013306 | Bacteria | 5375 |
| 86 | Ga0157372_10000132 | 3300013307 | Bacteria | 82054 |
| 87 | Ga0157372_10065744 | 3300013307 | Bacteria | 4072 |
| 88 | Ga0157375_10098959 | 3300013308 | Bacteria | 2994 |
| 89 | Ga0157379_10043081 | 3300014968 | Bacteria | 4030 |
| 90 | Ga0163161_10013809 | 3300017792 | Bacteria | 5625 |
| 91 | Ga0206353_10039200 | 3300020082 | Unclassified | 1653 |
| 92 | Ga0224712_10028818 | 3300022467 | Bacteria | 1988 |
| 93 | Ga0207710_10005422 | 3300025900 | Bacteria | 5494 |
| 94 | Ga0207688_10021395 | 3300025901 | Bacteria | 3533 |
| 95 | Ga0207680_10163513 | 3300025903 | Bacteria | 1494 |
| 96 | Ga0207647_10030351 | 3300025904 | Bacteria | 3488 |
| 97 | Ga0207654_10052324 | 3300025911 | Bacteria | 2353 |
| 98 | Ga0207695_10080616 | 3300025913 | Bacteria | 3295 |
| 99 | Ga0207695_10142801 | 3300025913 | Bacteria | 2340 |
| 100 | Ga0207695_10359366 | 3300025913 | Bacteria | 1343 |
| 101 | Ga0207695_10405694 | 3300025913 | Bacteria | 1247 |
| 102 | Ga0207662_10031190 | 3300025918 | Bacteria | 3096 |
| 103 | Ga0207657_10017912 | 3300025919 | Bacteria | 6777 |
| 104 | Ga0207694_10093423 | 3300025924 | Bacteria | 2376 |
| 105 | Ga0207694_10145461 | 3300025924 | Bacteria | 1908 |
| 106 | Ga0207687_10053597 | 3300025927 | Bacteria | 2818 |
| 107 | Ga0207700_10021332 | 3300025928 | Bacteria | 4420 |
| 108 | Ga0207664_10000002 | 3300025929 | Bacteria | 657053 |
| 109 | Ga0207644_10040135 | 3300025931 | Bacteria | 3307 |
| 110 | Ga0207690_10212957 | 3300025932 | Bacteria | 1474 |
| 111 | Ga0207706_10008795 | 3300025933 | Bacteria | 9296 |
| 112 | Ga0207665_10007324 | 3300025939 | Bacteria | 7301 |
| 113 | Ga0207711_10527916 | 3300025941 | Unclassified | 1101 |
| 114 | Ga0207679_10380129 | 3300025945 | Bacteria | 1238 |
| 115 | Ga0207667_10071374 | 3300025949 | Bacteria | 3611 |
| 116 | Ga0207667_10080674 | 3300025949 | Bacteria | 3371 |
| 117 | Ga0207667_10108052 | 3300025949 | Bacteria | 2870 |
| 118 | Ga0207712_10007897 | 3300025961 | Bacteria | 6722 |
| 119 | Ga0207703_10013971 | 3300026035 | Bacteria | 6259 |
| 120 | Ga0207639_10350070 | 3300026041 | Bacteria | 1319 |
| 121 | Ga0207678_10007538 | 3300026067 | Bacteria | 9617 |
| 122 | Ga0207702_10045928 | 3300026078 | Bacteria | 3676 |
| 123 | Ga0207641_10001260 | 3300026088 | Bacteria | 25231 |
| 124 | Ga0207641_10463016 | 3300026088 | Bacteria | 1227 |
| 125 | Ga0207675_100090910 | 3300026118 | Bacteria | 2870 |
| 126 | Ga0207683_10096655 | 3300026121 | Bacteria | 2634 |
| 127 | Ga0268266_10001159 | 3300028379 | Bacteria | 32594 |
| 128 | Ga0268266_10053104 | 3300028379 | Bacteria | 3481 |
| 129 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 130 | Ga0307406_10012057 | 3300031901 | Bacteria | 4917 |
| 131 | Ga0307407_10011431 | 3300031903 | Bacteria | 4225 |
| 132 | Ga0307409_100029019 | 3300031995 | Bacteria | 3952 |
| 133 | Ga0307416_100015807 | 3300032002 | Bacteria | 5224 |
| 134 | Ga0307411_10091177 | 3300032005 | Bacteria | 2128 |
| 135 | Ga0373940_0014326 | 3300035088 | Bacteria | 1933 |
| 136 | Ga0373951_0038710 | 3300035091 | Bacteria | 1144 |
| 137 | Ga0373941_0009002 | 3300035115 | Bacteria | 2503 |
| 138 | Ga0373942_0039655 | 3300035207 | Bacteria | 1282 |
| 139 | Ga0373931_0036482 | 3300035691 | Bacteria | 2562 |
| 140 | Ga0466972_0036266 | 3300044658 | Bacteria | 2413 |
| 141 | Ga0466965_0019157 | 3300044683 | Bacteria | 3286 |
| 142 | Ga0466965_0069402 | 3300044683 | Bacteria | 1771 |
| 143 | Ga0466966_0199977 | 3300044684 | Bacteria | 1209 |
| 144 | Ga0466961_0158949 | 3300044693 | Bacteria | 1409 |
| 145 | Ga0466961_0169161 | 3300044693 | Bacteria | 1360 |
| 146 | Ga0466963_0010926 | 3300044694 | Bacteria | 5515 |
| 147 | Ga0466963_0011245 | 3300044694 | Bacteria | 5447 |
| 148 | Ga0466963_0085324 | 3300044694 | Bacteria | 2143 |
| 149 | Ga0466971_0031274 | 3300044719 | Bacteria | 2383 |
| 150 | Ga0466970_0019596 | 3300044765 | Bacteria | 3508 |
| 151 | Ga0466957_0089548 | 3300044842 | Bacteria | 1926 |
| 152 | Ga0466959_0004336 | 3300045049 | Bacteria | 9480 |
| 153 | Ga0466958_0015745 | 3300045836 | Bacteria | 4341 |
| 154 | Ga0466958_0060873 | 3300045836 | Bacteria | 2299 |
| 155 | Ga0466958_0237127 | 3300045836 | Bacteria | 1165 |
| 156 | Ga0466967_0014617 | 3300045976 | Bacteria | 6123 |
| 157 | Ga0466967_0027253 | 3300045976 | Bacteria | 4750 |
| 158 | Ga0466967_0041864 | 3300045976 | Bacteria | 3953 |
| 159 | Ga0466967_0159491 | 3300045976 | Bacteria | 2116 |
| 160 | Ga0495639_0091872 | 3300046475 | Bacteria | 1425 |
| 161 | Ga0496100_0352431 | 3300048903 | Bacteria | 1112 |
| 162 | Ga0496101_0124733 | 3300048904 | Bacteria | 1950 |
| 163 | Ga0496102_0000044 | 3300048905 | Bacteria | 187834 |
| 164 | Ga0496102_0000378 | 3300048905 | Bacteria | 53414 |
| 165 | Ga0496102_0029210 | 3300048905 | Bacteria | 4932 |
| 166 | Ga0496102_0072361 | 3300048905 | Bacteria | 3168 |
| 167 | Ga0496102_0259764 | 3300048905 | Bacteria | 1637 |
| 168 | Ga0496103_0000123 | 3300048906 | Bacteria | 83794 |
| 169 | Ga0496103_0037288 | 3300048906 | Bacteria | 2978 |
| 170 | Ga0496103_0078117 | 3300048906 | Bacteria | 2078 |
| 171 | Ga0496103_0100346 | 3300048906 | Bacteria | 1832 |
| 172 | Ga0496103_0199548 | 3300048906 | Unclassified | 1286 |
| 173 | Ga0496104_0174679 | 3300048907 | Bacteria | 2059 |
| 174 | Ga0496105_0115003 | 3300048908 | Bacteria | 2219 |
| 175 | Ga0496109_0449950 | 3300048912 | Bacteria | 1216 |
| 176 | Ga0496110_0038402 | 3300048913 | Bacteria | 4166 |
| 177 | Ga0496111_0057758 | 3300048914 | Bacteria | 2809 |
| 178 | Ga0496113_0000814 | 3300048916 | Bacteria | 16232 |
| 179 | Ga0496113_0003253 | 3300048916 | Bacteria | 9689 |
| 180 | Ga0496113_0096191 | 3300048916 | Bacteria | 2289 |
| 181 | Ga0496114_0068255 | 3300048917 | Bacteria | 2985 |
| 182 | Ga0496118_0003272 | 3300048921 | Bacteria | 20622 |
| 183 | Ga0496119_0000305 | 3300048922 | Bacteria | 68548 |
| 184 | Ga0496119_0037427 | 3300048922 | Bacteria | 3151 |
| 185 | Ga0496120_0006093 | 3300048923 | Bacteria | 9353 |
| 186 | Ga0496120_0011362 | 3300048923 | Bacteria | 6125 |
| 187 | Ga0496121_0024755 | 3300048924 | Bacteria | 5727 |
| 188 | Ga0496126_0048490 | 3300048929 | Bacteria | 3881 |
| 189 | Ga0501031_0001048 | 3300049568 | Bacteria | 16785 |
| 190 | Ga0501032_0000955 | 3300049569 | Bacteria | 23363 |
| 191 | Ga0501033_0001191 | 3300049570 | Bacteria | 23501 |
| 192 | Ga0501034_0002839 | 3300049571 | Bacteria | 20187 |
| 193 | Ga0501036_0003718 | 3300049572 | Bacteria | 12231 |
| 194 | Ga0501037_0000344 | 3300049573 | Bacteria | 39209 |
| 195 | Ga0501037_0134300 | 3300049573 | Bacteria | 1773 |
| 196 | Ga0501038_0000195 | 3300049574 | Bacteria | 52526 |
| 197 | Ga0501039_0000355 | 3300049575 | Bacteria | 32637 |
| 198 | Ga0501042_0049939 | 3300049578 | Bacteria | 2984 |
| 199 | Ga0501043_0002157 | 3300049579 | Bacteria | 16786 |
| 200 | Ga0501046_0001615 | 3300049580 | Bacteria | 21554 |
| 201 | Ga0501047_0001634 | 3300049581 | Bacteria | 21880 |
| 202 | Ga0501047_0175851 | 3300049581 | Bacteria | 2008 |
| 203 | Ga0501048_0000709 | 3300049582 | Bacteria | 24346 |
| 204 | Ga0501067_0007944 | 3300049583 | Bacteria | 5893 |
| 205 | Ga0501068_0004860 | 3300049584 | Bacteria | 7318 |
| 206 | Ga0501070_0001006 | 3300049586 | Bacteria | 25283 |
| 207 | Ga0501071_0026249 | 3300049587 | Bacteria | 4087 |
| 208 | Ga0501073_0000569 | 3300049589 | Bacteria | 26046 |
| 209 | Ga0501074_0003518 | 3300049590 | Bacteria | 11116 |
| 210 | Ga0501080_0010337 | 3300049742 | Bacteria | 8535 |
| 211 | Ga0501035_0005521 | 3300049822 | Bacteria | 11950 |
| 212 | Ga0501044_0011056 | 3300049823 | Bacteria | 9790 |
| 213 | nmdc:mga0n895_222616_c1 | 3300050512 | Bacteria | 1916 |
| 214 | Ga0501084_0002679 | 3300054114 | Bacteria | 14335 |
| 215 | Ga0466962_0007126 | 3300061719 | Bacteria | 5356 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0449950 | Ga0496109_0449950_60_863 | 266 |
| 2 | 3300009148 | Ga0105243_10370262 | Ga0105243_103702622 | 267 |
| 3 | 3300035207 | Ga0373942_0039655 | Ga0373942_0039655_409_1218 | 267 |
| 4 | 3300044683 | Ga0466965_0019157 | Ga0466965_0019157_1908_2741 | 270 |
| 5 | 3300044765 | Ga0466970_0019596 | Ga0466970_0019596_1623_2456 | 270 |
| 6 | 3300005617 | Ga0068859_100003454 | Ga0068859_1000034545 | 273 |
| 7 | 3300006931 | Ga0097620_100003454 | Ga0097620_10000345410 | 273 |
| 8 | 3300009101 | Ga0105247_10004806 | Ga0105247_100048065 | 273 |
| 9 | 3300025900 | Ga0207710_10005422 | Ga0207710_100054223 | 273 |
| 10 | 3300048903 | Ga0496100_0352431 | Ga0496100_0352431_127_1050 | 275 |
| 11 | 3300048905 | Ga0496102_0000044 | Ga0496102_0000044_29321_30244 | 275 |
| 12 | 3300048906 | Ga0496103_0000123 | Ga0496103_0000123_54315_55238 | 275 |
| 13 | 3300044693 | Ga0466961_0158949 | Ga0466961_0158949_544_1386 | 278 |
| 14 | 3300044684 | Ga0466966_0199977 | Ga0466966_0199977_249_1175 | 288 |
| 15 | 3300035091 | Ga0373951_0038710 | Ga0373951_0038710_80_958 | 291 |
| 16 | 3300049568 | Ga0501031_0001048 | Ga0501031_0001048_5165_6151 | 294 |
| 17 | 3300049569 | Ga0501032_0000955 | Ga0501032_0000955_11437_12423 | 294 |
| 18 | 3300049570 | Ga0501033_0001191 | Ga0501033_0001191_13297_14283 | 294 |
| 19 | 3300049571 | Ga0501034_0002839 | Ga0501034_0002839_12660_13646 | 294 |
| 20 | 3300049572 | Ga0501036_0003718 | Ga0501036_0003718_8565_9551 | 294 |
| 21 | 3300049573 | Ga0501037_0000344 | Ga0501037_0000344_8866_9852 | 294 |
| 22 | 3300049574 | Ga0501038_0000195 | Ga0501038_0000195_40461_41447 | 294 |
| 23 | 3300049575 | Ga0501039_0000355 | Ga0501039_0000355_22966_23952 | 294 |
| 24 | 3300049578 | Ga0501042_0049939 | Ga0501042_0049939_1853_2839 | 294 |
| 25 | 3300049579 | Ga0501043_0002157 | Ga0501043_0002157_10636_11622 | 294 |
| 26 | 3300049580 | Ga0501046_0001615 | Ga0501046_0001615_8466_9452 | 294 |
| 27 | 3300049581 | Ga0501047_0001634 | Ga0501047_0001634_8866_9852 | 294 |
| 28 | 3300049582 | Ga0501048_0000709 | Ga0501048_0000709_7731_8717 | 294 |
| 29 | 3300049583 | Ga0501067_0007944 | Ga0501067_0007944_2570_3556 | 294 |
| 30 | 3300049584 | Ga0501068_0004860 | Ga0501068_0004860_382_1368 | 294 |
| 31 | 3300049586 | Ga0501070_0001006 | Ga0501070_0001006_15188_16174 | 294 |
| 32 | 3300049587 | Ga0501071_0026249 | Ga0501071_0026249_863_1849 | 294 |
| 33 | 3300049589 | Ga0501073_0000569 | Ga0501073_0000569_14686_15672 | 294 |
| 34 | 3300049590 | Ga0501074_0003518 | Ga0501074_0003518_8310_9296 | 294 |
| 35 | 3300049742 | Ga0501080_0010337 | Ga0501080_0010337_538_1524 | 294 |
| 36 | 3300049822 | Ga0501035_0005521 | Ga0501035_0005521_8828_9814 | 294 |
| 37 | 3300049823 | Ga0501044_0011056 | Ga0501044_0011056_3640_4626 | 294 |
| 38 | 3300054114 | Ga0501084_0002679 | Ga0501084_0002679_10703_11689 | 294 |
| 39 | 3300009093 | Ga0105240_10341916 | Ga0105240_103419162 | 297 |
| 40 | 3300044719 | Ga0466971_0031274 | Ga0466971_0031274_67_969 | 298 |
| 41 | 3300045836 | Ga0466958_0015745 | Ga0466958_0015745_2584_3486 | 298 |
| 42 | 3300061719 | Ga0466962_0007126 | Ga0466962_0007126_2702_3604 | 298 |
| 43 | 3300048906 | Ga0496103_0078117 | Ga0496103_0078117_1107_2042 | 299 |
| 44 | 3300044694 | Ga0466963_0011245 | Ga0466963_0011245_22_933 | 301 |
| 45 | 3300048905 | Ga0496102_0029210 | Ga0496102_0029210_1186_2220 | 305 |
| 46 | 3300048906 | Ga0496103_0037288 | Ga0496103_0037288_236_1270 | 305 |
| 47 | 3300005564 | Ga0070664_100226534 | Ga0070664_1002265342 | 306 |
| 48 | 3300009098 | Ga0105245_10151341 | Ga0105245_101513412 | 306 |
| 49 | 3300005535 | Ga0070684_100280431 | Ga0070684_1002804312 | 312 |
| 50 | 3300048907 | Ga0496104_0174679 | Ga0496104_0174679_549_1562 | 313 |
| 51 | 3300005563 | Ga0068855_100183845 | Ga0068855_1001838452 | 314 |
| 52 | 3300031901 | Ga0307406_10012057 | Ga0307406_100120573 | 316 |
| 53 | 3300025913 | Ga0207695_10142801 | Ga0207695_101428012 | 317 |
| 54 | 3300025928 | Ga0207700_10021332 | Ga0207700_100213324 | 318 |
| 55 | 3300009093 | Ga0105240_10169743 | Ga0105240_101697432 | 322 |
| 56 | 3300009551 | Ga0105238_10131797 | Ga0105238_101317971 | 322 |
| 57 | 3300025924 | Ga0207694_10093423 | Ga0207694_100934233 | 322 |
| 58 | 3300009093 | Ga0105240_10112392 | Ga0105240_101123924 | 323 |
| 59 | 3300013296 | Ga0157374_10412530 | Ga0157374_104125302 | 323 |
| 60 | 3300025913 | Ga0207695_10080616 | Ga0207695_100806164 | 323 |
| 61 | 3300048905 | Ga0496102_0072361 | Ga0496102_0072361_1521_2510 | 323 |
| 62 | 3300048906 | Ga0496103_0199548 | Ga0496103_0199548_124_1113 | 323 |
| 63 | 3300048922 | Ga0496119_0000305 | Ga0496119_0000305_29177_30166 | 323 |
| 64 | 3300048923 | Ga0496120_0006093 | Ga0496120_0006093_3826_4815 | 323 |
| 65 | 3300005339 | Ga0070660_100221506 | Ga0070660_1002215062 | 324 |
| 66 | 3300005563 | Ga0068855_100085220 | Ga0068855_1000852204 | 324 |
| 67 | 3300005614 | Ga0068856_100064657 | Ga0068856_1000646572 | 324 |
| 68 | 3300005617 | Ga0068859_100002765 | Ga0068859_1000027658 | 324 |
| 69 | 3300006931 | Ga0097620_100002765 | Ga0097620_10000276515 | 324 |
| 70 | 3300009101 | Ga0105247_10007712 | Ga0105247_100077123 | 324 |
| 71 | 3300025945 | Ga0207679_10380129 | Ga0207679_103801291 | 324 |
| 72 | 3300026078 | Ga0207702_10045928 | Ga0207702_100459284 | 324 |
| 73 | 3300031903 | Ga0307407_10011431 | Ga0307407_100114312 | 324 |
| 74 | 3300031995 | Ga0307409_100029019 | Ga0307409_1000290192 | 324 |
| 75 | 3300032002 | Ga0307416_100015807 | Ga0307416_1000158075 | 324 |
| 76 | 3300032005 | Ga0307411_10091177 | Ga0307411_100911772 | 324 |
| 77 | 3300048904 | Ga0496101_0124733 | Ga0496101_0124733_470_1489 | 324 |
| 78 | 3300048905 | Ga0496102_0000044 | Ga0496102_0000044_84483_85502 | 324 |
| 79 | 3300048921 | Ga0496118_0003272 | Ga0496118_0003272_10587_11606 | 324 |
| 80 | 3300048922 | Ga0496119_0037427 | Ga0496119_0037427_1618_2637 | 324 |
| 81 | 3300048924 | Ga0496121_0024755 | Ga0496121_0024755_3039_4058 | 324 |
| 82 | 3300005563 | Ga0068855_100015000 | Ga0068855_1000150005 | 325 |
| 83 | 3300005616 | Ga0068852_100570302 | Ga0068852_1005703021 | 325 |
| 84 | 3300009177 | Ga0105248_10732367 | Ga0105248_107323671 | 325 |
| 85 | 3300009545 | Ga0105237_10164943 | Ga0105237_101649432 | 325 |
| 86 | 3300009551 | Ga0105238_10189931 | Ga0105238_101899312 | 325 |
| 87 | 3300010375 | Ga0105239_10078026 | Ga0105239_100780263 | 325 |
| 88 | 3300010375 | Ga0105239_10168231 | Ga0105239_101682312 | 325 |
| 89 | 3300025904 | Ga0207647_10030351 | Ga0207647_100303515 | 325 |
| 90 | 3300025911 | Ga0207654_10052324 | Ga0207654_100523241 | 325 |
| 91 | 3300025941 | Ga0207711_10527916 | Ga0207711_105279161 | 325 |
| 92 | 3300025949 | Ga0207667_10080674 | Ga0207667_100806742 | 325 |
| 93 | 3300025949 | Ga0207667_10108052 | Ga0207667_101080522 | 325 |
| 94 | 3300044683 | Ga0466965_0069402 | Ga0466965_0069402_736_1719 | 325 |
| 95 | 3300044693 | Ga0466961_0169161 | Ga0466961_0169161_337_1323 | 325 |
| 96 | 3300044694 | Ga0466963_0010926 | Ga0466963_0010926_76_1059 | 325 |
| 97 | 3300044842 | Ga0466957_0089548 | Ga0466957_0089548_88_1071 | 325 |
| 98 | 3300045976 | Ga0466967_0014617 | Ga0466967_0014617_4885_5868 | 325 |
| 99 | 3300045976 | Ga0466967_0041864 | Ga0466967_0041864_2426_3409 | 325 |
| 100 | 3300045976 | Ga0466967_0159491 | Ga0466967_0159491_260_1243 | 325 |
| 101 | 3300048917 | Ga0496114_0068255 | Ga0496114_0068255_1888_2916 | 325 |
| 102 | 3300049573 | Ga0501037_0134300 | Ga0501037_0134300_700_1683 | 325 |
| 103 | 3300049581 | Ga0501047_0175851 | Ga0501047_0175851_492_1475 | 325 |
| 104 | 3300005330 | Ga0070690_100102677 | Ga0070690_1001026771 | 326 |
| 105 | 3300005335 | Ga0070666_10019145 | Ga0070666_100191452 | 326 |
| 106 | 3300005337 | Ga0070682_100037620 | Ga0070682_1000376202 | 326 |
| 107 | 3300005347 | Ga0070668_100024160 | Ga0070668_1000241604 | 326 |
| 108 | 3300005355 | Ga0070671_100034745 | Ga0070671_1000347454 | 326 |
| 109 | 3300005366 | Ga0070659_100054636 | Ga0070659_1000546364 | 326 |
| 110 | 3300005367 | Ga0070667_100055994 | Ga0070667_1000559943 | 326 |
| 111 | 3300005367 | Ga0070667_100097531 | Ga0070667_1000975313 | 326 |
| 112 | 3300005455 | Ga0070663_100182558 | Ga0070663_1001825582 | 326 |
| 113 | 3300005544 | Ga0070686_100067045 | Ga0070686_1000670452 | 326 |
| 114 | 3300005548 | Ga0070665_100020781 | Ga0070665_1000207813 | 326 |
| 115 | 3300005549 | Ga0070704_100045421 | Ga0070704_1000454211 | 326 |
| 116 | 3300005577 | Ga0068857_100069248 | Ga0068857_1000692482 | 326 |
| 117 | 3300005578 | Ga0068854_100184756 | Ga0068854_1001847562 | 326 |
| 118 | 3300005614 | Ga0068856_100105123 | Ga0068856_1001051232 | 326 |
| 119 | 3300005718 | Ga0068866_10076234 | Ga0068866_100762341 | 326 |
| 120 | 3300005840 | Ga0068870_10056381 | Ga0068870_100563812 | 326 |
| 121 | 3300005841 | Ga0068863_100001131 | Ga0068863_10000113128 | 326 |
| 122 | 3300005842 | Ga0068858_100018553 | Ga0068858_1000185532 | 326 |
| 123 | 3300005842 | Ga0068858_100317874 | Ga0068858_1003178742 | 326 |
| 124 | 3300005843 | Ga0068860_100000767 | Ga0068860_1000007676 | 326 |
| 125 | 3300006358 | Ga0068871_100179549 | Ga0068871_1001795492 | 326 |
| 126 | 3300009093 | Ga0105240_10607411 | Ga0105240_106074112 | 326 |
| 127 | 3300009098 | Ga0105245_10038034 | Ga0105245_100380342 | 326 |
| 128 | 3300009177 | Ga0105248_10061555 | Ga0105248_100615554 | 326 |
| 129 | 3300011119 | Ga0105246_10088773 | Ga0105246_100887732 | 326 |
| 130 | 3300013104 | Ga0157370_10236645 | Ga0157370_102366452 | 326 |
| 131 | 3300013105 | Ga0157369_10107373 | Ga0157369_101073732 | 326 |
| 132 | 3300013297 | Ga0157378_10182932 | Ga0157378_101829322 | 326 |
| 133 | 3300013307 | Ga0157372_10000132 | Ga0157372_1000013257 | 326 |
| 134 | 3300013307 | Ga0157372_10065744 | Ga0157372_100657442 | 326 |
| 135 | 3300013308 | Ga0157375_10098959 | Ga0157375_100989592 | 326 |
| 136 | 3300014968 | Ga0157379_10043081 | Ga0157379_100430812 | 326 |
| 137 | 3300020082 | Ga0206353_10039200 | Ga0206353_100392002 | 326 |
| 138 | 3300025913 | Ga0207695_10359366 | Ga0207695_103593661 | 326 |
| 139 | 3300025918 | Ga0207662_10031190 | Ga0207662_100311902 | 326 |
| 140 | 3300025927 | Ga0207687_10053597 | Ga0207687_100535972 | 326 |
| 141 | 3300025931 | Ga0207644_10040135 | Ga0207644_100401352 | 326 |
| 142 | 3300025932 | Ga0207690_10212957 | Ga0207690_102129572 | 326 |
| 143 | 3300026035 | Ga0207703_10013971 | Ga0207703_100139715 | 326 |
| 144 | 3300026088 | Ga0207641_10001260 | Ga0207641_100012603 | 326 |
| 145 | 3300026088 | Ga0207641_10463016 | Ga0207641_104630161 | 326 |
| 146 | 3300026121 | Ga0207683_10096655 | Ga0207683_100966552 | 326 |
| 147 | 3300028379 | Ga0268266_10001159 | Ga0268266_1000115942 | 326 |
| 148 | 3300028381 | Ga0268264_10000147 | Ga0268264_10000147148 | 326 |
| 149 | 3300045049 | Ga0466959_0004336 | Ga0466959_0004336_5367_6353 | 326 |
| 150 | 3300048908 | Ga0496105_0115003 | Ga0496105_0115003_762_1745 | 326 |
| 151 | 3300048913 | Ga0496110_0038402 | Ga0496110_0038402_1866_2849 | 326 |
| 152 | 3300048914 | Ga0496111_0057758 | Ga0496111_0057758_763_1746 | 326 |
| 153 | 3300048916 | Ga0496113_0000814 | Ga0496113_0000814_7410_8396 | 326 |
| 154 | 3300048916 | Ga0496113_0003253 | Ga0496113_0003253_5164_6147 | 326 |
| 155 | 3300005339 | Ga0070660_100097036 | Ga0070660_1000970362 | 327 |
| 156 | 3300005345 | Ga0070692_10007963 | Ga0070692_100079634 | 327 |
| 157 | 3300005347 | Ga0070668_100121837 | Ga0070668_1001218371 | 327 |
| 158 | 3300005353 | Ga0070669_100083043 | Ga0070669_1000830432 | 327 |
| 159 | 3300005441 | Ga0070700_100278530 | Ga0070700_1002785301 | 327 |
| 160 | 3300005539 | Ga0068853_100043539 | Ga0068853_1000435394 | 327 |
| 161 | 3300005548 | Ga0070665_100433410 | Ga0070665_1004334102 | 327 |
| 162 | 3300005563 | Ga0068855_100034220 | Ga0068855_1000342202 | 327 |
| 163 | 3300005563 | Ga0068855_100336917 | Ga0068855_1003369172 | 327 |
| 164 | 3300005615 | Ga0070702_100008065 | Ga0070702_1000080654 | 327 |
| 165 | 3300005719 | Ga0068861_100033105 | Ga0068861_1000331052 | 327 |
| 166 | 3300005843 | Ga0068860_100509232 | Ga0068860_1005092321 | 327 |
| 167 | 3300005937 | Ga0081455_10007337 | Ga0081455_1000733711 | 327 |
| 168 | 3300005937 | Ga0081455_10023348 | Ga0081455_100233486 | 327 |
| 169 | 3300006028 | Ga0070717_10033615 | Ga0070717_100336153 | 327 |
| 170 | 3300006173 | Ga0070716_100097175 | Ga0070716_1000971752 | 327 |
| 171 | 3300006871 | Ga0075434_100077176 | Ga0075434_1000771764 | 327 |
| 172 | 3300009093 | Ga0105240_10107451 | Ga0105240_101074513 | 327 |
| 173 | 3300009094 | Ga0111539_10352115 | Ga0111539_103521152 | 327 |
| 174 | 3300009101 | Ga0105247_10085605 | Ga0105247_100856051 | 327 |
| 175 | 3300009545 | Ga0105237_10050526 | Ga0105237_100505262 | 327 |
| 176 | 3300013104 | Ga0157370_10100806 | Ga0157370_101008062 | 327 |
| 177 | 3300013296 | Ga0157374_10008615 | Ga0157374_100086151 | 327 |
| 178 | 3300013306 | Ga0163162_10030123 | Ga0163162_100301233 | 327 |
| 179 | 3300017792 | Ga0163161_10013809 | Ga0163161_100138092 | 327 |
| 180 | 3300022467 | Ga0224712_10028818 | Ga0224712_100288182 | 327 |
| 181 | 3300025901 | Ga0207688_10021395 | Ga0207688_100213952 | 327 |
| 182 | 3300025903 | Ga0207680_10163513 | Ga0207680_101635132 | 327 |
| 183 | 3300025919 | Ga0207657_10017912 | Ga0207657_100179129 | 327 |
| 184 | 3300025933 | Ga0207706_10008795 | Ga0207706_100087955 | 327 |
| 185 | 3300025939 | Ga0207665_10007324 | Ga0207665_100073244 | 327 |
| 186 | 3300025949 | Ga0207667_10071374 | Ga0207667_100713742 | 327 |
| 187 | 3300025961 | Ga0207712_10007897 | Ga0207712_100078973 | 327 |
| 188 | 3300026041 | Ga0207639_10350070 | Ga0207639_103500701 | 327 |
| 189 | 3300026067 | Ga0207678_10007538 | Ga0207678_100075388 | 327 |
| 190 | 3300026118 | Ga0207675_100090910 | Ga0207675_1000909102 | 327 |
| 191 | 3300028379 | Ga0268266_10053104 | Ga0268266_100531042 | 327 |
| 192 | 3300035088 | Ga0373940_0014326 | Ga0373940_0014326_814_1803 | 327 |
| 193 | 3300035115 | Ga0373941_0009002 | Ga0373941_0009002_1041_2030 | 327 |
| 194 | 3300035691 | Ga0373931_0036482 | Ga0373931_0036482_646_1635 | 327 |
| 195 | 3300044694 | Ga0466963_0085324 | Ga0466963_0085324_942_1943 | 327 |
| 196 | 3300045836 | Ga0466958_0060873 | Ga0466958_0060873_575_1576 | 327 |
| 197 | 3300045836 | Ga0466958_0237127 | Ga0466958_0237127_89_1114 | 327 |
| 198 | 3300045976 | Ga0466967_0027253 | Ga0466967_0027253_3348_4388 | 327 |
| 199 | 3300046475 | Ga0495639_0091872 | Ga0495639_0091872_97_1086 | 327 |
| 200 | 3300048905 | Ga0496102_0000378 | Ga0496102_0000378_46992_47987 | 327 |
| 201 | 3300048905 | Ga0496102_0259764 | Ga0496102_0259764_120_1109 | 327 |
| 202 | 3300048906 | Ga0496103_0100346 | Ga0496103_0100346_510_1499 | 327 |
| 203 | 3300048916 | Ga0496113_0096191 | Ga0496113_0096191_539_1528 | 327 |
| 204 | 3300048923 | Ga0496120_0011362 | Ga0496120_0011362_2287_3315 | 327 |
| 205 | 3300048929 | Ga0496126_0048490 | Ga0496126_0048490_1940_2959 | 327 |
| 206 | 3300050512 | nmdc:mga0n895_222616_c1 | nmdc:mga0n895_222616_c1_309_1298 | 327 |
| 207 | 3300013104 | Ga0157370_10076496 | Ga0157370_100764964 | 328 |
| 208 | 3300025913 | Ga0207695_10405694 | Ga0207695_104056941 | 328 |
| 209 | 3300044658 | Ga0466972_0036266 | Ga0466972_0036266_650_1669 | 328 |
| 210 | 3300005327 | Ga0070658_10143873 | Ga0070658_101438732 | 329 |
| 211 | 3300005435 | Ga0070714_100000008 | Ga0070714_100000008150 | 329 |
| 212 | 3300009093 | Ga0105240_10041070 | Ga0105240_100410701 | 329 |
| 213 | 3300009174 | Ga0105241_10086618 | Ga0105241_100866182 | 329 |
| 214 | 3300009551 | Ga0105238_10250788 | Ga0105238_102507882 | 329 |
| 215 | 3300013307 | Ga0157372_10000132 | Ga0157372_1000013244 | 329 |
| 216 | 3300013307 | Ga0157372_10000132 | Ga0157372_1000013254 | 329 |
| 217 | 3300025924 | Ga0207694_10145461 | Ga0207694_101454612 | 329 |
| 218 | 3300025929 | Ga0207664_10000002 | Ga0207664_10000002235 | 329 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ymv-assembly1.cif.gz_A | structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg | 0.8529 | 13 | 329 |
| 2ymv-assembly1.cif.gz_A | structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg | 0.8256 | 13 | 329 |
| 3gb5-assembly1.cif.gz_A-2 | crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn | 0.7221 | 114 | 325 |
| 3m5k-assembly1.cif.gz_B | crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution | 0.6982 | 115 | 329 |
| 3kwk-assembly1.cif.gz_A-2 | crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution | 0.6974 | 115 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WL07_1_99_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8927 | 15 | 108 | 3.40.109.10 |
| af_P9WIZ7_118_336_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8675 | 114 | 327 | 3.40.109.10 |
| af_P9WL07_1_99_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8421 | 15 | 108 | 3.40.109.10 |
| af_P9WIZ7_118_336_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8414 | 114 | 327 | 3.40.109.10 |
| af_P95233_1_116_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8306 | 13 | 112 | 3.40.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G8TXZ4-F1-model_v4 | Nitroreductase family protein | 0.9746 | 8 | 329 |
GO:0016491
|
| AF-A0A6P0GG74-F1-model_v4 | Nitroreductase | 0.9722 | 11 | 327 |
GO:0016491
|
| AF-A0A7G7LF29-F1-model_v4 | Nitroreductase | 0.9679 | 8 | 327 |
GO:0016491
|
| AF-F5XMY1-F1-model_v4 | Uncharacterized protein | 0.9586 | 1 | 329 |
GO:0016491
|
| AF-A0A161LLR8-F1-model_v4 | Nitroreductase | 0.9576 | 5 | 160 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar