F330284

General Info

Members Datasets Scaffolds Average Seq Length
218 153 215 326

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0027253|Ga0466967_0027253_3348_4388
Length 346
Sequence MWTVVSARILHDRMKTMTTSVAAHRTTALRRAGVRATLAPSVHNTQPWRFVLSADQLRIYADRSRQLHVLDPTGRQLTISCGCALMNARVSLAGDGLDVTVERFPVADQPDLLARIRPTFGASSPAEGLAVLDHVLEIRQTNRRHFTGAEVPEEVLDVLEQAAAAEDSELYVIRDEATRLSVAALSQHADAIENLNPAYRAELRAWTTDDPGRRDGVPNLAVPHVDGTADDEVPIRDFDTRGTGGLPAATRSSKDQCLVLLCTRGDSPADWLRGGEALERVLLEITRHGFVASPLTQVTEVPSARAQLRRQLGMTAFPHVLLRIGRAPIAPQSRRRRLVEVLSEEA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.09
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10143873 3300005327 Bacteria 1993
2 Ga0070690_100102677 3300005330 Bacteria 1897
3 Ga0070666_10019145 3300005335 Bacteria 4416
4 Ga0070682_100037620 3300005337 Bacteria 2964
5 Ga0070660_100097036 3300005339 Bacteria 2331
6 Ga0070660_100221506 3300005339 Unclassified 1538
7 Ga0070692_10007963 3300005345 Bacteria 4700
8 Ga0070668_100024160 3300005347 Bacteria 4603
9 Ga0070668_100121837 3300005347 Bacteria 2085
10 Ga0070669_100083043 3300005353 Bacteria 2389
11 Ga0070671_100034745 3300005355 Bacteria 4174
12 Ga0070659_100054636 3300005366 Bacteria 3145
13 Ga0070667_100055994 3300005367 Bacteria 3330
14 Ga0070667_100097531 3300005367 Bacteria 2536
15 Ga0070714_100000008 3300005435 Bacteria 278734
16 Ga0070700_100278530 3300005441 Bacteria 1212
17 Ga0070663_100182558 3300005455 Bacteria 1629
18 Ga0070684_100280431 3300005535 Bacteria 1527
19 Ga0068853_100043539 3300005539 Bacteria 3841
20 Ga0070686_100067045 3300005544 Bacteria 2336
21 Ga0070665_100020781 3300005548 Bacteria 6598
22 Ga0070665_100433410 3300005548 Bacteria 1324
23 Ga0070704_100045421 3300005549 Bacteria 3056
24 Ga0068855_100015000 3300005563 Bacteria 9332
25 Ga0068855_100034220 3300005563 Bacteria 6060
26 Ga0068855_100085220 3300005563 Bacteria 3657
27 Ga0068855_100183845 3300005563 Bacteria 2362
28 Ga0068855_100336917 3300005563 Bacteria 1664
29 Ga0070664_100226534 3300005564 Bacteria 1674
30 Ga0068857_100069248 3300005577 Unclassified 3142
31 Ga0068854_100184756 3300005578 Bacteria 1630
32 Ga0068856_100064657 3300005614 Bacteria 3615
33 Ga0068856_100105123 3300005614 Bacteria 2817
34 Ga0070702_100008065 3300005615 Bacteria 5084
35 Ga0068852_100570302 3300005616 Bacteria 1134
36 Ga0068859_100002765 3300005617 Bacteria 17784
37 Ga0068859_100003454 3300005617 Bacteria 16063
38 Ga0068866_10076234 3300005718 Bacteria 1788
39 Ga0068861_100033105 3300005719 Bacteria 3811
40 Ga0068870_10056381 3300005840 Bacteria 2097
41 Ga0068863_100001131 3300005841 Bacteria 26659
42 Ga0068858_100018553 3300005842 Bacteria 6513
43 Ga0068858_100317874 3300005842 Bacteria 1487
44 Ga0068860_100000767 3300005843 Bacteria 36120
45 Ga0068860_100509232 3300005843 Bacteria 1202
46 Ga0081455_10007337 3300005937 Bacteria 11627
47 Ga0081455_10023348 3300005937 Bacteria 5757
48 Ga0070717_10033615 3300006028 Bacteria 4137
49 Ga0070716_100097175 3300006173 Bacteria 1797
50 Ga0068871_100179549 3300006358 Bacteria 1818
51 Ga0075434_100077176 3300006871 Bacteria 3326
52 Ga0097620_100002765 3300006931 Bacteria 17784
53 Ga0097620_100003454 3300006931 Bacteria 16063
54 Ga0105240_10041070 3300009093 Bacteria 5908
55 Ga0105240_10107451 3300009093 Bacteria 3383
56 Ga0105240_10112392 3300009093 Bacteria 3293
57 Ga0105240_10169743 3300009093 Bacteria 2585
58 Ga0105240_10341916 3300009093 Bacteria 1700
59 Ga0105240_10607411 3300009093 Bacteria 1203
60 Ga0111539_10352115 3300009094 Bacteria 1714
61 Ga0105245_10038034 3300009098 Bacteria 4279
62 Ga0105245_10151341 3300009098 Bacteria 2194
63 Ga0105247_10004806 3300009101 Bacteria 8598
64 Ga0105247_10007712 3300009101 Bacteria 6586
65 Ga0105247_10085605 3300009101 Bacteria 1993
66 Ga0105243_10370262 3300009148 Bacteria 1321
67 Ga0105241_10086618 3300009174 Bacteria 2464
68 Ga0105248_10061555 3300009177 Bacteria 4215
69 Ga0105248_10732367 3300009177 Unclassified 1116
70 Ga0105237_10050526 3300009545 Bacteria 4178
71 Ga0105237_10164943 3300009545 Bacteria 2214
72 Ga0105238_10131797 3300009551 Bacteria 2478
73 Ga0105238_10189931 3300009551 Bacteria 2030
74 Ga0105238_10250788 3300009551 Bacteria 1748
75 Ga0105239_10078026 3300010375 Bacteria 3645
76 Ga0105239_10168231 3300010375 Bacteria 2451
77 Ga0105246_10088773 3300011119 Bacteria 2222
78 Ga0157370_10076496 3300013104 Bacteria 3153
79 Ga0157370_10100806 3300013104 Bacteria 2705
80 Ga0157370_10236645 3300013104 Bacteria 1690
81 Ga0157369_10107373 3300013105 Bacteria 2969
82 Ga0157374_10008615 3300013296 Bacteria 8725
83 Ga0157374_10412530 3300013296 Bacteria 1348
84 Ga0157378_10182932 3300013297 Bacteria 1973
85 Ga0163162_10030123 3300013306 Bacteria 5375
86 Ga0157372_10000132 3300013307 Bacteria 82054
87 Ga0157372_10065744 3300013307 Bacteria 4072
88 Ga0157375_10098959 3300013308 Bacteria 2994
89 Ga0157379_10043081 3300014968 Bacteria 4030
90 Ga0163161_10013809 3300017792 Bacteria 5625
91 Ga0206353_10039200 3300020082 Unclassified 1653
92 Ga0224712_10028818 3300022467 Bacteria 1988
93 Ga0207710_10005422 3300025900 Bacteria 5494
94 Ga0207688_10021395 3300025901 Bacteria 3533
95 Ga0207680_10163513 3300025903 Bacteria 1494
96 Ga0207647_10030351 3300025904 Bacteria 3488
97 Ga0207654_10052324 3300025911 Bacteria 2353
98 Ga0207695_10080616 3300025913 Bacteria 3295
99 Ga0207695_10142801 3300025913 Bacteria 2340
100 Ga0207695_10359366 3300025913 Bacteria 1343
101 Ga0207695_10405694 3300025913 Bacteria 1247
102 Ga0207662_10031190 3300025918 Bacteria 3096
103 Ga0207657_10017912 3300025919 Bacteria 6777
104 Ga0207694_10093423 3300025924 Bacteria 2376
105 Ga0207694_10145461 3300025924 Bacteria 1908
106 Ga0207687_10053597 3300025927 Bacteria 2818
107 Ga0207700_10021332 3300025928 Bacteria 4420
108 Ga0207664_10000002 3300025929 Bacteria 657053
109 Ga0207644_10040135 3300025931 Bacteria 3307
110 Ga0207690_10212957 3300025932 Bacteria 1474
111 Ga0207706_10008795 3300025933 Bacteria 9296
112 Ga0207665_10007324 3300025939 Bacteria 7301
113 Ga0207711_10527916 3300025941 Unclassified 1101
114 Ga0207679_10380129 3300025945 Bacteria 1238
115 Ga0207667_10071374 3300025949 Bacteria 3611
116 Ga0207667_10080674 3300025949 Bacteria 3371
117 Ga0207667_10108052 3300025949 Bacteria 2870
118 Ga0207712_10007897 3300025961 Bacteria 6722
119 Ga0207703_10013971 3300026035 Bacteria 6259
120 Ga0207639_10350070 3300026041 Bacteria 1319
121 Ga0207678_10007538 3300026067 Bacteria 9617
122 Ga0207702_10045928 3300026078 Bacteria 3676
123 Ga0207641_10001260 3300026088 Bacteria 25231
124 Ga0207641_10463016 3300026088 Bacteria 1227
125 Ga0207675_100090910 3300026118 Bacteria 2870
126 Ga0207683_10096655 3300026121 Bacteria 2634
127 Ga0268266_10001159 3300028379 Bacteria 32594
128 Ga0268266_10053104 3300028379 Bacteria 3481
129 Ga0268264_10000147 3300028381 Bacteria 164790
130 Ga0307406_10012057 3300031901 Bacteria 4917
131 Ga0307407_10011431 3300031903 Bacteria 4225
132 Ga0307409_100029019 3300031995 Bacteria 3952
133 Ga0307416_100015807 3300032002 Bacteria 5224
134 Ga0307411_10091177 3300032005 Bacteria 2128
135 Ga0373940_0014326 3300035088 Bacteria 1933
136 Ga0373951_0038710 3300035091 Bacteria 1144
137 Ga0373941_0009002 3300035115 Bacteria 2503
138 Ga0373942_0039655 3300035207 Bacteria 1282
139 Ga0373931_0036482 3300035691 Bacteria 2562
140 Ga0466972_0036266 3300044658 Bacteria 2413
141 Ga0466965_0019157 3300044683 Bacteria 3286
142 Ga0466965_0069402 3300044683 Bacteria 1771
143 Ga0466966_0199977 3300044684 Bacteria 1209
144 Ga0466961_0158949 3300044693 Bacteria 1409
145 Ga0466961_0169161 3300044693 Bacteria 1360
146 Ga0466963_0010926 3300044694 Bacteria 5515
147 Ga0466963_0011245 3300044694 Bacteria 5447
148 Ga0466963_0085324 3300044694 Bacteria 2143
149 Ga0466971_0031274 3300044719 Bacteria 2383
150 Ga0466970_0019596 3300044765 Bacteria 3508
151 Ga0466957_0089548 3300044842 Bacteria 1926
152 Ga0466959_0004336 3300045049 Bacteria 9480
153 Ga0466958_0015745 3300045836 Bacteria 4341
154 Ga0466958_0060873 3300045836 Bacteria 2299
155 Ga0466958_0237127 3300045836 Bacteria 1165
156 Ga0466967_0014617 3300045976 Bacteria 6123
157 Ga0466967_0027253 3300045976 Bacteria 4750
158 Ga0466967_0041864 3300045976 Bacteria 3953
159 Ga0466967_0159491 3300045976 Bacteria 2116
160 Ga0495639_0091872 3300046475 Bacteria 1425
161 Ga0496100_0352431 3300048903 Bacteria 1112
162 Ga0496101_0124733 3300048904 Bacteria 1950
163 Ga0496102_0000044 3300048905 Bacteria 187834
164 Ga0496102_0000378 3300048905 Bacteria 53414
165 Ga0496102_0029210 3300048905 Bacteria 4932
166 Ga0496102_0072361 3300048905 Bacteria 3168
167 Ga0496102_0259764 3300048905 Bacteria 1637
168 Ga0496103_0000123 3300048906 Bacteria 83794
169 Ga0496103_0037288 3300048906 Bacteria 2978
170 Ga0496103_0078117 3300048906 Bacteria 2078
171 Ga0496103_0100346 3300048906 Bacteria 1832
172 Ga0496103_0199548 3300048906 Unclassified 1286
173 Ga0496104_0174679 3300048907 Bacteria 2059
174 Ga0496105_0115003 3300048908 Bacteria 2219
175 Ga0496109_0449950 3300048912 Bacteria 1216
176 Ga0496110_0038402 3300048913 Bacteria 4166
177 Ga0496111_0057758 3300048914 Bacteria 2809
178 Ga0496113_0000814 3300048916 Bacteria 16232
179 Ga0496113_0003253 3300048916 Bacteria 9689
180 Ga0496113_0096191 3300048916 Bacteria 2289
181 Ga0496114_0068255 3300048917 Bacteria 2985
182 Ga0496118_0003272 3300048921 Bacteria 20622
183 Ga0496119_0000305 3300048922 Bacteria 68548
184 Ga0496119_0037427 3300048922 Bacteria 3151
185 Ga0496120_0006093 3300048923 Bacteria 9353
186 Ga0496120_0011362 3300048923 Bacteria 6125
187 Ga0496121_0024755 3300048924 Bacteria 5727
188 Ga0496126_0048490 3300048929 Bacteria 3881
189 Ga0501031_0001048 3300049568 Bacteria 16785
190 Ga0501032_0000955 3300049569 Bacteria 23363
191 Ga0501033_0001191 3300049570 Bacteria 23501
192 Ga0501034_0002839 3300049571 Bacteria 20187
193 Ga0501036_0003718 3300049572 Bacteria 12231
194 Ga0501037_0000344 3300049573 Bacteria 39209
195 Ga0501037_0134300 3300049573 Bacteria 1773
196 Ga0501038_0000195 3300049574 Bacteria 52526
197 Ga0501039_0000355 3300049575 Bacteria 32637
198 Ga0501042_0049939 3300049578 Bacteria 2984
199 Ga0501043_0002157 3300049579 Bacteria 16786
200 Ga0501046_0001615 3300049580 Bacteria 21554
201 Ga0501047_0001634 3300049581 Bacteria 21880
202 Ga0501047_0175851 3300049581 Bacteria 2008
203 Ga0501048_0000709 3300049582 Bacteria 24346
204 Ga0501067_0007944 3300049583 Bacteria 5893
205 Ga0501068_0004860 3300049584 Bacteria 7318
206 Ga0501070_0001006 3300049586 Bacteria 25283
207 Ga0501071_0026249 3300049587 Bacteria 4087
208 Ga0501073_0000569 3300049589 Bacteria 26046
209 Ga0501074_0003518 3300049590 Bacteria 11116
210 Ga0501080_0010337 3300049742 Bacteria 8535
211 Ga0501035_0005521 3300049822 Bacteria 11950
212 Ga0501044_0011056 3300049823 Bacteria 9790
213 nmdc:mga0n895_222616_c1 3300050512 Bacteria 1916
214 Ga0501084_0002679 3300054114 Bacteria 14335
215 Ga0466962_0007126 3300061719 Bacteria 5356

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0449950 Ga0496109_0449950_60_863 266
2 3300009148 Ga0105243_10370262 Ga0105243_103702622 267
3 3300035207 Ga0373942_0039655 Ga0373942_0039655_409_1218 267
4 3300044683 Ga0466965_0019157 Ga0466965_0019157_1908_2741 270
5 3300044765 Ga0466970_0019596 Ga0466970_0019596_1623_2456 270
6 3300005617 Ga0068859_100003454 Ga0068859_1000034545 273
7 3300006931 Ga0097620_100003454 Ga0097620_10000345410 273
8 3300009101 Ga0105247_10004806 Ga0105247_100048065 273
9 3300025900 Ga0207710_10005422 Ga0207710_100054223 273
10 3300048903 Ga0496100_0352431 Ga0496100_0352431_127_1050 275
11 3300048905 Ga0496102_0000044 Ga0496102_0000044_29321_30244 275
12 3300048906 Ga0496103_0000123 Ga0496103_0000123_54315_55238 275
13 3300044693 Ga0466961_0158949 Ga0466961_0158949_544_1386 278
14 3300044684 Ga0466966_0199977 Ga0466966_0199977_249_1175 288
15 3300035091 Ga0373951_0038710 Ga0373951_0038710_80_958 291
16 3300049568 Ga0501031_0001048 Ga0501031_0001048_5165_6151 294
17 3300049569 Ga0501032_0000955 Ga0501032_0000955_11437_12423 294
18 3300049570 Ga0501033_0001191 Ga0501033_0001191_13297_14283 294
19 3300049571 Ga0501034_0002839 Ga0501034_0002839_12660_13646 294
20 3300049572 Ga0501036_0003718 Ga0501036_0003718_8565_9551 294
21 3300049573 Ga0501037_0000344 Ga0501037_0000344_8866_9852 294
22 3300049574 Ga0501038_0000195 Ga0501038_0000195_40461_41447 294
23 3300049575 Ga0501039_0000355 Ga0501039_0000355_22966_23952 294
24 3300049578 Ga0501042_0049939 Ga0501042_0049939_1853_2839 294
25 3300049579 Ga0501043_0002157 Ga0501043_0002157_10636_11622 294
26 3300049580 Ga0501046_0001615 Ga0501046_0001615_8466_9452 294
27 3300049581 Ga0501047_0001634 Ga0501047_0001634_8866_9852 294
28 3300049582 Ga0501048_0000709 Ga0501048_0000709_7731_8717 294
29 3300049583 Ga0501067_0007944 Ga0501067_0007944_2570_3556 294
30 3300049584 Ga0501068_0004860 Ga0501068_0004860_382_1368 294
31 3300049586 Ga0501070_0001006 Ga0501070_0001006_15188_16174 294
32 3300049587 Ga0501071_0026249 Ga0501071_0026249_863_1849 294
33 3300049589 Ga0501073_0000569 Ga0501073_0000569_14686_15672 294
34 3300049590 Ga0501074_0003518 Ga0501074_0003518_8310_9296 294
35 3300049742 Ga0501080_0010337 Ga0501080_0010337_538_1524 294
36 3300049822 Ga0501035_0005521 Ga0501035_0005521_8828_9814 294
37 3300049823 Ga0501044_0011056 Ga0501044_0011056_3640_4626 294
38 3300054114 Ga0501084_0002679 Ga0501084_0002679_10703_11689 294
39 3300009093 Ga0105240_10341916 Ga0105240_103419162 297
40 3300044719 Ga0466971_0031274 Ga0466971_0031274_67_969 298
41 3300045836 Ga0466958_0015745 Ga0466958_0015745_2584_3486 298
42 3300061719 Ga0466962_0007126 Ga0466962_0007126_2702_3604 298
43 3300048906 Ga0496103_0078117 Ga0496103_0078117_1107_2042 299
44 3300044694 Ga0466963_0011245 Ga0466963_0011245_22_933 301
45 3300048905 Ga0496102_0029210 Ga0496102_0029210_1186_2220 305
46 3300048906 Ga0496103_0037288 Ga0496103_0037288_236_1270 305
47 3300005564 Ga0070664_100226534 Ga0070664_1002265342 306
48 3300009098 Ga0105245_10151341 Ga0105245_101513412 306
49 3300005535 Ga0070684_100280431 Ga0070684_1002804312 312
50 3300048907 Ga0496104_0174679 Ga0496104_0174679_549_1562 313
51 3300005563 Ga0068855_100183845 Ga0068855_1001838452 314
52 3300031901 Ga0307406_10012057 Ga0307406_100120573 316
53 3300025913 Ga0207695_10142801 Ga0207695_101428012 317
54 3300025928 Ga0207700_10021332 Ga0207700_100213324 318
55 3300009093 Ga0105240_10169743 Ga0105240_101697432 322
56 3300009551 Ga0105238_10131797 Ga0105238_101317971 322
57 3300025924 Ga0207694_10093423 Ga0207694_100934233 322
58 3300009093 Ga0105240_10112392 Ga0105240_101123924 323
59 3300013296 Ga0157374_10412530 Ga0157374_104125302 323
60 3300025913 Ga0207695_10080616 Ga0207695_100806164 323
61 3300048905 Ga0496102_0072361 Ga0496102_0072361_1521_2510 323
62 3300048906 Ga0496103_0199548 Ga0496103_0199548_124_1113 323
63 3300048922 Ga0496119_0000305 Ga0496119_0000305_29177_30166 323
64 3300048923 Ga0496120_0006093 Ga0496120_0006093_3826_4815 323
65 3300005339 Ga0070660_100221506 Ga0070660_1002215062 324
66 3300005563 Ga0068855_100085220 Ga0068855_1000852204 324
67 3300005614 Ga0068856_100064657 Ga0068856_1000646572 324
68 3300005617 Ga0068859_100002765 Ga0068859_1000027658 324
69 3300006931 Ga0097620_100002765 Ga0097620_10000276515 324
70 3300009101 Ga0105247_10007712 Ga0105247_100077123 324
71 3300025945 Ga0207679_10380129 Ga0207679_103801291 324
72 3300026078 Ga0207702_10045928 Ga0207702_100459284 324
73 3300031903 Ga0307407_10011431 Ga0307407_100114312 324
74 3300031995 Ga0307409_100029019 Ga0307409_1000290192 324
75 3300032002 Ga0307416_100015807 Ga0307416_1000158075 324
76 3300032005 Ga0307411_10091177 Ga0307411_100911772 324
77 3300048904 Ga0496101_0124733 Ga0496101_0124733_470_1489 324
78 3300048905 Ga0496102_0000044 Ga0496102_0000044_84483_85502 324
79 3300048921 Ga0496118_0003272 Ga0496118_0003272_10587_11606 324
80 3300048922 Ga0496119_0037427 Ga0496119_0037427_1618_2637 324
81 3300048924 Ga0496121_0024755 Ga0496121_0024755_3039_4058 324
82 3300005563 Ga0068855_100015000 Ga0068855_1000150005 325
83 3300005616 Ga0068852_100570302 Ga0068852_1005703021 325
84 3300009177 Ga0105248_10732367 Ga0105248_107323671 325
85 3300009545 Ga0105237_10164943 Ga0105237_101649432 325
86 3300009551 Ga0105238_10189931 Ga0105238_101899312 325
87 3300010375 Ga0105239_10078026 Ga0105239_100780263 325
88 3300010375 Ga0105239_10168231 Ga0105239_101682312 325
89 3300025904 Ga0207647_10030351 Ga0207647_100303515 325
90 3300025911 Ga0207654_10052324 Ga0207654_100523241 325
91 3300025941 Ga0207711_10527916 Ga0207711_105279161 325
92 3300025949 Ga0207667_10080674 Ga0207667_100806742 325
93 3300025949 Ga0207667_10108052 Ga0207667_101080522 325
94 3300044683 Ga0466965_0069402 Ga0466965_0069402_736_1719 325
95 3300044693 Ga0466961_0169161 Ga0466961_0169161_337_1323 325
96 3300044694 Ga0466963_0010926 Ga0466963_0010926_76_1059 325
97 3300044842 Ga0466957_0089548 Ga0466957_0089548_88_1071 325
98 3300045976 Ga0466967_0014617 Ga0466967_0014617_4885_5868 325
99 3300045976 Ga0466967_0041864 Ga0466967_0041864_2426_3409 325
100 3300045976 Ga0466967_0159491 Ga0466967_0159491_260_1243 325
101 3300048917 Ga0496114_0068255 Ga0496114_0068255_1888_2916 325
102 3300049573 Ga0501037_0134300 Ga0501037_0134300_700_1683 325
103 3300049581 Ga0501047_0175851 Ga0501047_0175851_492_1475 325
104 3300005330 Ga0070690_100102677 Ga0070690_1001026771 326
105 3300005335 Ga0070666_10019145 Ga0070666_100191452 326
106 3300005337 Ga0070682_100037620 Ga0070682_1000376202 326
107 3300005347 Ga0070668_100024160 Ga0070668_1000241604 326
108 3300005355 Ga0070671_100034745 Ga0070671_1000347454 326
109 3300005366 Ga0070659_100054636 Ga0070659_1000546364 326
110 3300005367 Ga0070667_100055994 Ga0070667_1000559943 326
111 3300005367 Ga0070667_100097531 Ga0070667_1000975313 326
112 3300005455 Ga0070663_100182558 Ga0070663_1001825582 326
113 3300005544 Ga0070686_100067045 Ga0070686_1000670452 326
114 3300005548 Ga0070665_100020781 Ga0070665_1000207813 326
115 3300005549 Ga0070704_100045421 Ga0070704_1000454211 326
116 3300005577 Ga0068857_100069248 Ga0068857_1000692482 326
117 3300005578 Ga0068854_100184756 Ga0068854_1001847562 326
118 3300005614 Ga0068856_100105123 Ga0068856_1001051232 326
119 3300005718 Ga0068866_10076234 Ga0068866_100762341 326
120 3300005840 Ga0068870_10056381 Ga0068870_100563812 326
121 3300005841 Ga0068863_100001131 Ga0068863_10000113128 326
122 3300005842 Ga0068858_100018553 Ga0068858_1000185532 326
123 3300005842 Ga0068858_100317874 Ga0068858_1003178742 326
124 3300005843 Ga0068860_100000767 Ga0068860_1000007676 326
125 3300006358 Ga0068871_100179549 Ga0068871_1001795492 326
126 3300009093 Ga0105240_10607411 Ga0105240_106074112 326
127 3300009098 Ga0105245_10038034 Ga0105245_100380342 326
128 3300009177 Ga0105248_10061555 Ga0105248_100615554 326
129 3300011119 Ga0105246_10088773 Ga0105246_100887732 326
130 3300013104 Ga0157370_10236645 Ga0157370_102366452 326
131 3300013105 Ga0157369_10107373 Ga0157369_101073732 326
132 3300013297 Ga0157378_10182932 Ga0157378_101829322 326
133 3300013307 Ga0157372_10000132 Ga0157372_1000013257 326
134 3300013307 Ga0157372_10065744 Ga0157372_100657442 326
135 3300013308 Ga0157375_10098959 Ga0157375_100989592 326
136 3300014968 Ga0157379_10043081 Ga0157379_100430812 326
137 3300020082 Ga0206353_10039200 Ga0206353_100392002 326
138 3300025913 Ga0207695_10359366 Ga0207695_103593661 326
139 3300025918 Ga0207662_10031190 Ga0207662_100311902 326
140 3300025927 Ga0207687_10053597 Ga0207687_100535972 326
141 3300025931 Ga0207644_10040135 Ga0207644_100401352 326
142 3300025932 Ga0207690_10212957 Ga0207690_102129572 326
143 3300026035 Ga0207703_10013971 Ga0207703_100139715 326
144 3300026088 Ga0207641_10001260 Ga0207641_100012603 326
145 3300026088 Ga0207641_10463016 Ga0207641_104630161 326
146 3300026121 Ga0207683_10096655 Ga0207683_100966552 326
147 3300028379 Ga0268266_10001159 Ga0268266_1000115942 326
148 3300028381 Ga0268264_10000147 Ga0268264_10000147148 326
149 3300045049 Ga0466959_0004336 Ga0466959_0004336_5367_6353 326
150 3300048908 Ga0496105_0115003 Ga0496105_0115003_762_1745 326
151 3300048913 Ga0496110_0038402 Ga0496110_0038402_1866_2849 326
152 3300048914 Ga0496111_0057758 Ga0496111_0057758_763_1746 326
153 3300048916 Ga0496113_0000814 Ga0496113_0000814_7410_8396 326
154 3300048916 Ga0496113_0003253 Ga0496113_0003253_5164_6147 326
155 3300005339 Ga0070660_100097036 Ga0070660_1000970362 327
156 3300005345 Ga0070692_10007963 Ga0070692_100079634 327
157 3300005347 Ga0070668_100121837 Ga0070668_1001218371 327
158 3300005353 Ga0070669_100083043 Ga0070669_1000830432 327
159 3300005441 Ga0070700_100278530 Ga0070700_1002785301 327
160 3300005539 Ga0068853_100043539 Ga0068853_1000435394 327
161 3300005548 Ga0070665_100433410 Ga0070665_1004334102 327
162 3300005563 Ga0068855_100034220 Ga0068855_1000342202 327
163 3300005563 Ga0068855_100336917 Ga0068855_1003369172 327
164 3300005615 Ga0070702_100008065 Ga0070702_1000080654 327
165 3300005719 Ga0068861_100033105 Ga0068861_1000331052 327
166 3300005843 Ga0068860_100509232 Ga0068860_1005092321 327
167 3300005937 Ga0081455_10007337 Ga0081455_1000733711 327
168 3300005937 Ga0081455_10023348 Ga0081455_100233486 327
169 3300006028 Ga0070717_10033615 Ga0070717_100336153 327
170 3300006173 Ga0070716_100097175 Ga0070716_1000971752 327
171 3300006871 Ga0075434_100077176 Ga0075434_1000771764 327
172 3300009093 Ga0105240_10107451 Ga0105240_101074513 327
173 3300009094 Ga0111539_10352115 Ga0111539_103521152 327
174 3300009101 Ga0105247_10085605 Ga0105247_100856051 327
175 3300009545 Ga0105237_10050526 Ga0105237_100505262 327
176 3300013104 Ga0157370_10100806 Ga0157370_101008062 327
177 3300013296 Ga0157374_10008615 Ga0157374_100086151 327
178 3300013306 Ga0163162_10030123 Ga0163162_100301233 327
179 3300017792 Ga0163161_10013809 Ga0163161_100138092 327
180 3300022467 Ga0224712_10028818 Ga0224712_100288182 327
181 3300025901 Ga0207688_10021395 Ga0207688_100213952 327
182 3300025903 Ga0207680_10163513 Ga0207680_101635132 327
183 3300025919 Ga0207657_10017912 Ga0207657_100179129 327
184 3300025933 Ga0207706_10008795 Ga0207706_100087955 327
185 3300025939 Ga0207665_10007324 Ga0207665_100073244 327
186 3300025949 Ga0207667_10071374 Ga0207667_100713742 327
187 3300025961 Ga0207712_10007897 Ga0207712_100078973 327
188 3300026041 Ga0207639_10350070 Ga0207639_103500701 327
189 3300026067 Ga0207678_10007538 Ga0207678_100075388 327
190 3300026118 Ga0207675_100090910 Ga0207675_1000909102 327
191 3300028379 Ga0268266_10053104 Ga0268266_100531042 327
192 3300035088 Ga0373940_0014326 Ga0373940_0014326_814_1803 327
193 3300035115 Ga0373941_0009002 Ga0373941_0009002_1041_2030 327
194 3300035691 Ga0373931_0036482 Ga0373931_0036482_646_1635 327
195 3300044694 Ga0466963_0085324 Ga0466963_0085324_942_1943 327
196 3300045836 Ga0466958_0060873 Ga0466958_0060873_575_1576 327
197 3300045836 Ga0466958_0237127 Ga0466958_0237127_89_1114 327
198 3300045976 Ga0466967_0027253 Ga0466967_0027253_3348_4388 327
199 3300046475 Ga0495639_0091872 Ga0495639_0091872_97_1086 327
200 3300048905 Ga0496102_0000378 Ga0496102_0000378_46992_47987 327
201 3300048905 Ga0496102_0259764 Ga0496102_0259764_120_1109 327
202 3300048906 Ga0496103_0100346 Ga0496103_0100346_510_1499 327
203 3300048916 Ga0496113_0096191 Ga0496113_0096191_539_1528 327
204 3300048923 Ga0496120_0011362 Ga0496120_0011362_2287_3315 327
205 3300048929 Ga0496126_0048490 Ga0496126_0048490_1940_2959 327
206 3300050512 nmdc:mga0n895_222616_c1 nmdc:mga0n895_222616_c1_309_1298 327
207 3300013104 Ga0157370_10076496 Ga0157370_100764964 328
208 3300025913 Ga0207695_10405694 Ga0207695_104056941 328
209 3300044658 Ga0466972_0036266 Ga0466972_0036266_650_1669 328
210 3300005327 Ga0070658_10143873 Ga0070658_101438732 329
211 3300005435 Ga0070714_100000008 Ga0070714_100000008150 329
212 3300009093 Ga0105240_10041070 Ga0105240_100410701 329
213 3300009174 Ga0105241_10086618 Ga0105241_100866182 329
214 3300009551 Ga0105238_10250788 Ga0105238_102507882 329
215 3300013307 Ga0157372_10000132 Ga0157372_1000013244 329
216 3300013307 Ga0157372_10000132 Ga0157372_1000013254 329
217 3300025924 Ga0207694_10145461 Ga0207694_101454612 329
218 3300025929 Ga0207664_10000002 Ga0207664_10000002235 329

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ymv-assembly1.cif.gz_A structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg 0.8529 13 329
2ymv-assembly1.cif.gz_A structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg 0.8256 13 329
3gb5-assembly1.cif.gz_A-2 crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn 0.7221 114 325
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.6982 115 329
3kwk-assembly1.cif.gz_A-2 crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution 0.6974 115 320
ID Description Score Start End Superfamily
af_P9WL07_1_99_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8927 15 108 3.40.109.10
af_P9WIZ7_118_336_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8675 114 327 3.40.109.10
af_P9WL07_1_99_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8421 15 108 3.40.109.10
af_P9WIZ7_118_336_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8414 114 327 3.40.109.10
af_P95233_1_116_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8306 13 112 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A1G8TXZ4-F1-model_v4 Nitroreductase family protein 0.9746 8 329 GO:0016491
AF-A0A6P0GG74-F1-model_v4 Nitroreductase 0.9722 11 327 GO:0016491
AF-A0A7G7LF29-F1-model_v4 Nitroreductase 0.9679 8 327 GO:0016491
AF-F5XMY1-F1-model_v4 Uncharacterized protein 0.9586 1 329 GO:0016491
AF-A0A161LLR8-F1-model_v4 Nitroreductase 0.9576 5 160 GO:0016491

Feature Viewer

pLDDT pTM Quality
86.63 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map