F330401

General Info

Members Datasets Scaffolds Average Seq Length
218 114 198 224

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000421|Ga0496124_0000421_49201_49932
Length 243
Sequence MDSKCYFHEAVGYEVCLMGYGLQFTNNSNTVILDSEFARLTILGSGRYAPTQESGLGSVTNFPQVITTQEPPLVFVRPDTVAGGIAGLCLMRVIGSPGAWTGFYVRAYDVNTLQPNGRWFAAAFTSRAAAAYGLRMWDGAGQVIFDSGNPVAVFTRSFQNWTYVKSGSSGSSVLHYYSVPFNFPENEYVMINNFGMNMVAGNNPGRTLYMLWNFAEGVLYAVTGSASNPQPFYLPAIFAKMTI

Samples

Sample ID Description Type Environment
1 2511231022 Pseudomonas sp. GM79 Isolate Nodule
2 2511231023 Pseudomonas sp. GM80 Isolate Nodule
3 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
4 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
5 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
6 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
7 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
8 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
9 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
10 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
11 2784132063 Pseudomonas sp. 424 Isolate Unclassified
12 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
13 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
14 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
15 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
16 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
17 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
18 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
53 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
54 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
55 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
56 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
57 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
58 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
59 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
60 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
61 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
62 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
63 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
77 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
78 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
113 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
114 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.83
Metatranscriptomes 0
Isolates 9.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 1.38
Rhizoplane 3.21
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10047840 3300003323 Bacteria 5423
2 Ga0055530_10000829 3300003791 Bacteria 25569
3 Ga0055540_1000609 3300003792 Bacteria 25569
4 Ga0055531_10037725 3300003794 Bacteria 1464
5 Ga0070670_100000495 3300005331 Bacteria 31488
6 Ga0075432_10000215 3300006058 Bacteria 15293
7 Ga0105251_10000255 3300009011 Bacteria 53695
8 Ga0105251_10011271 3300009011 Bacteria 5116
9 Ga0105244_10006911 3300009036 Bacteria 7277
10 Ga0105246_10106362 3300011119 Bacteria 2052
11 Ga0157373_10005956 3300013100 Bacteria 9116
12 Ga0157373_10041304 3300013100 Bacteria 3299
13 Ga0157373_10136145 3300013100 Bacteria 1727
14 Ga0157371_10005156 3300013102 Bacteria 11133
15 Ga0157371_10011779 3300013102 Bacteria 6716
16 Ga0157371_10086330 3300013102 Bacteria 2222
17 Ga0157370_10011330 3300013104 Bacteria 9341
18 Ga0157370_10014174 3300013104 Bacteria 8173
19 Ga0157370_10026771 3300013104 Bacteria 5689
20 Ga0157370_10033877 3300013104 Bacteria 4978
21 Ga0157369_10007767 3300013105 Bacteria 12339
22 Ga0157369_10053065 3300013105 Bacteria 4382
23 Ga0157369_10102447 3300013105 Bacteria 3051
24 Ga0157369_10121829 3300013105 Bacteria 2767
25 Ga0163162_10037010 3300013306 Bacteria 4868
26 Ga0157375_10000390 3300013308 Bacteria 39903
27 Ga0157375_10027260 3300013308 Bacteria 5338
28 Ga0182008_10002463 3300014497 Bacteria 11586
29 Ga0182008_10060834 3300014497 Bacteria 1861
30 Ga0182006_1000985 3300015261 Bacteria 18750
31 Ga0182007_10014279 3300015262 Bacteria 3001
32 Ga0182005_1000556 3300015265 Bacteria 18676
33 Ga0182005_1002149 3300015265 Bacteria 7282
34 Ga0182005_1003039 3300015265 Bacteria 5796
35 Ga0182005_1005333 3300015265 Bacteria 4027
36 Ga0163161_10092630 3300017792 Bacteria 2238
37 Ga0209676_1004620 3300025292 Bacteria 7584
38 Ga0209050_1000079 3300025298 Bacteria 277803
39 Ga0209051_1000054 3300025303 Bacteria 280804
40 Ga0209257_1007132 3300025304 Bacteria 6874
41 Ga0207655_1012066 3300025728 Bacteria 5081
42 Ga0207655_1040476 3300025728 Bacteria 2010
43 Ga0207713_1000259 3300025735 Bacteria 65068
44 Ga0207650_10000750 3300025925 Bacteria 24996
45 Ga0209281_1010026 3300027111 Bacteria 2191
46 Ga0207428_10001873 3300027907 Bacteria 21422
47 Ga0307408_100005845 3300031548 Bacteria 8184
48 Ga0307408_100086180 3300031548 Bacteria 2360
49 Ga0307408_100277003 3300031548 Bacteria 1395
50 Ga0307406_10223114 3300031901 Bacteria 1402
51 Ga0307412_10000125 3300031911 Bacteria 57204
52 Ga0307412_10000478 3300031911 Bacteria 23942
53 Ga0307412_10162885 3300031911 Bacteria 1659
54 Ga0307414_10012048 3300032004 Bacteria 5099
55 Ga0439447_000006 3300041407 Bacteria 101894
56 Ga0439447_003683 3300041407 Bacteria 5404
57 Ga0439466_0000036 3300041411 Bacteria 54279
58 Ga0439466_0001034 3300041411 Bacteria 10732
59 Ga0439466_0077909 3300041411 Bacteria 1048
60 Ga0439466_0087078 3300041411 Bacteria 981
61 Ga0439445_0016560 3300042004 Bacteria 1814
62 Ga0439432_000033 3300042006 Bacteria 44275
63 Ga0439432_041527 3300042006 Bacteria 1456
64 Ga0439451_000359 3300042009 Bacteria 8842
65 Ga0439452_000241 3300042010 Bacteria 37760
66 Ga0439452_024901 3300042010 Bacteria 1524
67 Ga0439456_020888 3300042013 Bacteria 1383
68 Ga0439463_014401 3300042016 Bacteria 1949
69 Ga0450906_000031 3300042145 Bacteria 22793
70 Ga0495617_000630 3300046452 Bacteria 17680
71 Ga0495627_000188 3300046453 Bacteria 68201
72 Ga0495627_000369 3300046453 Bacteria 41831
73 Ga0495590_0000093 3300046457 Bacteria 55139
74 Ga0495650_0001471 3300046471 Bacteria 22602
75 Ga0495650_0001884 3300046471 Bacteria 18660
76 Ga0495605_0005851 3300046474 Bacteria 7112
77 Ga0495605_0033930 3300046474 Bacteria 2588
78 Ga0495584_0000099 3300046491 Bacteria 57784
79 Ga0495584_0000108 3300046491 Bacteria 56594
80 Ga0495584_0000548 3300046491 Bacteria 25464
81 Ga0495584_0002104 3300046491 Bacteria 11406
82 Ga0495584_0002904 3300046491 Bacteria 9563
83 Ga0495584_0003414 3300046491 Bacteria 8751
84 Ga0495584_0013163 3300046491 Bacteria 4221
85 Ga0495585_0000044 3300046492 Bacteria 123462
86 Ga0495585_0000137 3300046492 Bacteria 79585
87 Ga0495585_0000311 3300046492 Bacteria 48318
88 Ga0495585_0002631 3300046492 Bacteria 12646
89 Ga0495585_0099134 3300046492 Bacteria 1560
90 Ga0495596_0000080 3300046500 Bacteria 66323
91 Ga0495596_0000122 3300046500 Bacteria 53601
92 Ga0495607_0020611 3300046501 Bacteria 4164
93 Ga0495607_0034145 3300046501 Bacteria 3088
94 Ga0495583_0000371 3300046506 Bacteria 69919
95 Ga0495606_0000604 3300046507 Bacteria 56852
96 Ga0495606_0005256 3300046507 Bacteria 12488
97 Ga0495610_0000551 3300046512 Bacteria 37502
98 Ga0495610_0033610 3300046512 Bacteria 2649
99 Ga0495610_0043547 3300046512 Bacteria 2235
100 Ga0495610_0044341 3300046512 Bacteria 2207
101 Ga0495616_0000275 3300046513 Bacteria 41769
102 Ga0495616_0000922 3300046513 Bacteria 21148
103 Ga0495616_0015384 3300046513 Bacteria 4255
104 Ga0495620_0001670 3300046515 Bacteria 13085
105 Ga0495620_0005702 3300046515 Bacteria 6932
106 Ga0495631_0007695 3300046518 Bacteria 5468
107 Ga0495631_0153306 3300046518 Bacteria 989
108 Ga0495632_0000188 3300046519 Bacteria 63066
109 Ga0495632_0001826 3300046519 Bacteria 17146
110 Ga0495632_0003563 3300046519 Bacteria 10985
111 Ga0495632_0016046 3300046519 Bacteria 4177
112 Ga0495632_0084161 3300046519 Bacteria 1514
113 Ga0495637_0000030 3300046520 Bacteria 138704
114 Ga0495637_0000130 3300046520 Bacteria 55897
115 Ga0495637_0000355 3300046520 Bacteria 34901
116 Ga0495637_0001292 3300046520 Bacteria 15050
117 Ga0495644_0003073 3300046523 Bacteria 6607
118 Ga0495644_0006516 3300046523 Bacteria 4521
119 Ga0495648_0000314 3300046524 Bacteria 53429
120 Ga0495648_0002615 3300046524 Bacteria 16440
121 Ga0495648_0008893 3300046524 Bacteria 7848
122 Ga0495648_0010256 3300046524 Bacteria 7155
123 Ga0495648_0204494 3300046524 Bacteria 986
124 Ga0495654_0000177 3300046530 Bacteria 62703
125 Ga0495654_0000229 3300046530 Bacteria 52203
126 Ga0495654_0011989 3300046530 Bacteria 4672
127 Ga0495609_0000037 3300046538 Bacteria 185912
128 Ga0495609_0000043 3300046538 Bacteria 166590
129 Ga0495597_0000020 3300046542 Bacteria 161793
130 Ga0495597_0005315 3300046542 Bacteria 6828
131 Ga0495622_0001417 3300046557 Bacteria 12117
132 Ga0495668_0000328 3300046616 Bacteria 64806
133 Ga0495668_0000594 3300046616 Bacteria 43998
134 Ga0495668_0002338 3300046616 Bacteria 15791
135 Ga0495668_0007788 3300046616 Bacteria 6791
136 Ga0495611_0245289 3300046648 Bacteria 831
137 Ga0495625_0000790 3300046660 Bacteria 43942
138 Ga0495661_0000024 3300046665 Bacteria 188844
139 Ga0495661_0007847 3300046665 Bacteria 7426
140 Ga0495670_0025686 3300046691 Bacteria 2914
141 Ga0495671_0000284 3300046692 Bacteria 42448
142 Ga0495671_0001300 3300046692 Bacteria 17032
143 Ga0495671_0003311 3300046692 Bacteria 9956
144 Ga0495671_0005255 3300046692 Bacteria 7602
145 Ga0495671_0009041 3300046692 Bacteria 5587
146 Ga0495649_0000103 3300046694 Bacteria 75113
147 Ga0495660_0000161 3300046810 Bacteria 72505
148 Ga0495660_0000469 3300046810 Bacteria 33478
149 Ga0495660_0000487 3300046810 Bacteria 33011
150 Ga0495660_0000671 3300046810 Bacteria 26323
151 Ga0495660_0000833 3300046810 Bacteria 22922
152 Ga0495660_0001020 3300046810 Bacteria 20338
153 Ga0495660_0002039 3300046810 Bacteria 13132
154 Ga0495660_0022776 3300046810 Bacteria 3574
155 Ga0495672_0193898 3300047320 Bacteria 1020
156 Ga0495676_0000203 3300047321 Bacteria 46830
157 Ga0495680_0001090 3300047322 Bacteria 30098
158 Ga0495680_0023584 3300047322 Bacteria 5113
159 Ga0495683_0001214 3300047323 Bacteria 17559
160 Ga0495687_000321 3300047443 Bacteria 62292
161 Ga0495675_0317026 3300047444 Bacteria 923
162 Ga0495673_0003454 3300047469 Bacteria 10396
163 Ga0495673_0003499 3300047469 Bacteria 10335
164 Ga0495673_0003585 3300047469 Bacteria 10187
165 Ga0495673_0004543 3300047469 Bacteria 8661
166 Ga0495673_0013393 3300047469 Bacteria 4310
167 Ga0495681_0000087 3300047470 Bacteria 81287
168 Ga0495681_0000521 3300047470 Bacteria 29424
169 Ga0495681_0002245 3300047470 Bacteria 13902
170 Ga0495681_0011840 3300047470 Bacteria 5162
171 Ga0495626_0000045 3300048091 Bacteria 164931
172 Ga0496116_0000207 3300048919 Bacteria 111531
173 Ga0496116_0002565 3300048919 Bacteria 18966
174 Ga0496117_0000604 3300048920 Bacteria 58763
175 Ga0496117_0002707 3300048920 Bacteria 21868
176 Ga0496117_0009622 3300048920 Bacteria 8946
177 Ga0496118_0000613 3300048921 Bacteria 58782
178 Ga0496118_0002747 3300048921 Bacteria 23129
179 Ga0496118_0015563 3300048921 Bacteria 7034
180 Ga0496119_0004487 3300048922 Bacteria 13873
181 Ga0496120_0003616 3300048923 Bacteria 13875
182 Ga0496121_0001514 3300048924 Bacteria 38991
183 Ga0496122_0009469 3300048925 Bacteria 10261
184 Ga0496123_0003674 3300048926 Bacteria 16926
185 Ga0496123_0011135 3300048926 Bacteria 7839
186 Ga0496124_0000421 3300048927 Bacteria 75739
187 Ga0496124_0000825 3300048927 Bacteria 50490
188 Ga0496124_0010920 3300048927 Bacteria 9136
189 Ga0496124_0029510 3300048927 Bacteria 4885
190 Ga0496124_0168871 3300048927 Bacteria 1697
191 Ga0495678_000289 3300049459 Bacteria 55364
192 Ga0495678_000855 3300049459 Bacteria 27161
193 Ga0495682_0000079 3300049460 Bacteria 85081
194 Ga0495682_0000123 3300049460 Bacteria 67837
195 Ga0495682_0000143 3300049460 Bacteria 62210
196 Ga0495682_0007897 3300049460 Bacteria 4209
197 Ga0500572_000011 3300053111 Bacteria 64261
198 Ga0500618_000702 3300053125 Bacteria 19673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100000495 Ga0070670_10000049513 192
2 3300025925 Ga0207650_10000750 Ga0207650_1000075023 192
3 3300046474 Ga0495605_0005851 Ga0495605_0005851_1636_2223 192
4 3300046530 Ga0495654_0000229 Ga0495654_0000229_12217_12846 194
5 3300013104 Ga0157370_10011330 Ga0157370_100113302 203
6 3300048919 Ga0496116_0002565 Ga0496116_0002565_10181_10792 203
7 3300048920 Ga0496117_0009622 Ga0496117_0009622_5338_5949 203
8 3300048921 Ga0496118_0015563 Ga0496118_0015563_3426_4037 203
9 3300048922 Ga0496119_0004487 Ga0496119_0004487_7971_8582 203
10 3300048923 Ga0496120_0003616 Ga0496120_0003616_5292_5903 203
11 3300048927 Ga0496124_0010920 Ga0496124_0010920_555_1166 203
12 3300053111 Ga0500572_000011 Ga0500572_000011_13927_14538 203
13 3300013308 Ga0157375_10000390 Ga0157375_1000039050 207
14 iso_pu_bacteria 2784132063 2784263712 218
15 iso_pu_bacteria 2599185309 2599982330 220
16 iso_pu_bacteria 2599185311 2599997009 220
17 iso_pu_bacteria 2599185313 2600007248 220
18 iso_pu_bacteria 2599185323 2600068861 220
19 iso_pu_bacteria 2600255283 2601626827 220
20 iso_pu_bacteria 2791355520 2794597430 220
21 iso_pu_bacteria 2988728565 2988728763 220
22 iso_pu_bacteria 3007866637 3007869515 220
23 3300047321 Ga0495676_0000203 Ga0495676_0000203_4285_4956 221
24 iso_pu_bacteria 2599185155 2599328799 221
25 iso_pu_bacteria 2599185318 2600037446 221
26 iso_pu_bacteria 2808606376 2808927046 221
27 iso_pu_bacteria 2808606380 2808949165 221
28 iso_pu_bacteria 8056177738 8056177860 221
29 iso_pu_bacteria 2511231022 2511365774 222
30 iso_pu_bacteria 2511231023 2511366450 222
31 iso_pu_bacteria 2582580891 2583792157 222
32 iso_pu_bacteria 2919385768 2919390339 222
33 iso_pu_bacteria 2998139840 2998142041 222
34 iso_pu_bacteria 2784132063 2784264714 223
35 3300003791 Ga0055530_10000829 Ga0055530_1000082930 224
36 3300003792 Ga0055540_1000609 Ga0055540_100060930 224
37 3300003794 Ga0055531_10037725 Ga0055531_100377252 224
38 3300025292 Ga0209676_1004620 Ga0209676_10046206 224
39 3300025298 Ga0209050_1000079 Ga0209050_100007995 224
40 3300025303 Ga0209051_1000054 Ga0209051_100005498 224
41 3300025304 Ga0209257_1007132 Ga0209257_10071327 224
42 3300031548 Ga0307408_100005845 Ga0307408_1000058457 224
43 3300031548 Ga0307408_100086180 Ga0307408_1000861803 224
44 3300031901 Ga0307406_10223114 Ga0307406_102231143 224
45 3300031911 Ga0307412_10000125 Ga0307412_100001259 224
46 3300031911 Ga0307412_10162885 Ga0307412_101628853 224
47 3300041411 Ga0439466_0000036 Ga0439466_0000036_48528_49202 224
48 3300046474 Ga0495605_0033930 Ga0495605_0033930_1865_2539 224
49 3300046491 Ga0495584_0000108 Ga0495584_0000108_22351_23025 224
50 3300046507 Ga0495606_0000604 Ga0495606_0000604_50848_51522 224
51 3300046520 Ga0495637_0000130 Ga0495637_0000130_6493_7167 224
52 3300046542 Ga0495597_0005315 Ga0495597_0005315_5570_6244 224
53 3300047320 Ga0495672_0193898 Ga0495672_0193898_78_752 224
54 3300047469 Ga0495673_0004543 Ga0495673_0004543_1384_2058 224
55 3300006058 Ga0075432_10000215 Ga0075432_100002155 225
56 3300009011 Ga0105251_10011271 Ga0105251_100112713 225
57 3300009036 Ga0105244_10006911 Ga0105244_100069113 225
58 3300013105 Ga0157369_10102447 Ga0157369_101024473 225
59 3300013306 Ga0163162_10037010 Ga0163162_100370107 225
60 3300015262 Ga0182007_10014279 Ga0182007_100142792 225
61 3300025728 Ga0207655_1012066 Ga0207655_10120663 225
62 3300025728 Ga0207655_1040476 Ga0207655_10404762 225
63 3300027907 Ga0207428_10001873 Ga0207428_100018736 225
64 3300041407 Ga0439447_000006 Ga0439447_000006_5059_5736 225
65 3300041411 Ga0439466_0001034 Ga0439466_0001034_5043_5720 225
66 3300042004 Ga0439445_0016560 Ga0439445_0016560_914_1591 225
67 3300042010 Ga0439452_000241 Ga0439452_000241_5771_6448 225
68 3300042016 Ga0439463_014401 Ga0439463_014401_165_845 225
69 3300046491 Ga0495584_0000548 Ga0495584_0000548_1975_2652 225
70 3300046491 Ga0495584_0002104 Ga0495584_0002104_9272_9949 225
71 3300046491 Ga0495584_0003414 Ga0495584_0003414_2060_2737 225
72 3300046491 Ga0495584_0013163 Ga0495584_0013163_2223_2900 225
73 3300046492 Ga0495585_0000044 Ga0495585_0000044_16280_16963 225
74 3300046492 Ga0495585_0000311 Ga0495585_0000311_41289_41966 225
75 3300046512 Ga0495610_0033610 Ga0495610_0033610_124_801 225
76 3300046518 Ga0495631_0153306 Ga0495631_0153306_122_799 225
77 3300046519 Ga0495632_0001826 Ga0495632_0001826_8255_8932 225
78 3300046524 Ga0495648_0008893 Ga0495648_0008893_4512_5189 225
79 3300046616 Ga0495668_0000594 Ga0495668_0000594_12580_13257 225
80 3300046616 Ga0495668_0007788 Ga0495668_0007788_4287_4967 225
81 3300046692 Ga0495671_0003311 Ga0495671_0003311_7699_8385 225
82 3300046810 Ga0495660_0000833 Ga0495660_0000833_13852_14529 225
83 3300047322 Ga0495680_0001090 Ga0495680_0001090_5991_6668 225
84 3300047443 Ga0495687_000321 Ga0495687_000321_4562_5239 225
85 3300047444 Ga0495675_0317026 Ga0495675_0317026_14_691 225
86 3300047470 Ga0495681_0011840 Ga0495681_0011840_4271_4948 225
87 3300048924 Ga0496121_0001514 Ga0496121_0001514_16786_17466 225
88 3300049459 Ga0495678_000855 Ga0495678_000855_10883_11560 225
89 3300049460 Ga0495682_0000123 Ga0495682_0000123_10991_11671 225
90 3300049460 Ga0495682_0007897 Ga0495682_0007897_3016_3693 225
91 3300053125 Ga0500618_000702 Ga0500618_000702_606_1289 225
92 3300013100 Ga0157373_10005956 Ga0157373_100059563 226
93 3300013100 Ga0157373_10136145 Ga0157373_101361453 226
94 3300013102 Ga0157371_10086330 Ga0157371_100863303 226
95 3300013104 Ga0157370_10014174 Ga0157370_100141744 226
96 3300013104 Ga0157370_10026771 Ga0157370_100267714 226
97 3300013104 Ga0157370_10033877 Ga0157370_100338776 226
98 3300013105 Ga0157369_10053065 Ga0157369_100530653 226
99 3300013105 Ga0157369_10121829 Ga0157369_101218291 226
100 3300013308 Ga0157375_10027260 Ga0157375_100272607 226
101 3300014497 Ga0182008_10060834 Ga0182008_100608342 226
102 3300015261 Ga0182006_1000985 Ga0182006_100098519 226
103 3300015265 Ga0182005_1002149 Ga0182005_10021493 226
104 3300015265 Ga0182005_1003039 Ga0182005_10030396 226
105 3300015265 Ga0182005_1005333 Ga0182005_10053333 226
106 3300017792 Ga0163161_10092630 Ga0163161_100926303 226
107 3300027111 Ga0209281_1010026 Ga0209281_10100262 226
108 3300031548 Ga0307408_100277003 Ga0307408_1002770032 226
109 3300031911 Ga0307412_10000478 Ga0307412_1000047812 226
110 3300032004 Ga0307414_10012048 Ga0307414_100120483 226
111 3300041407 Ga0439447_003683 Ga0439447_003683_3791_4471 226
112 3300042009 Ga0439451_000359 Ga0439451_000359_3281_3961 226
113 3300042013 Ga0439456_020888 Ga0439456_020888_341_1021 226
114 3300042145 Ga0450906_000031 Ga0450906_000031_5952_6632 226
115 3300046452 Ga0495617_000630 Ga0495617_000630_1723_2403 226
116 3300046453 Ga0495627_000188 Ga0495627_000188_49024_49704 226
117 3300046453 Ga0495627_000369 Ga0495627_000369_27590_28270 226
118 3300046457 Ga0495590_0000093 Ga0495590_0000093_50694_51374 226
119 3300046471 Ga0495650_0001471 Ga0495650_0001471_3756_4436 226
120 3300046471 Ga0495650_0001884 Ga0495650_0001884_12880_13560 226
121 3300046491 Ga0495584_0000099 Ga0495584_0000099_6420_7100 226
122 3300046491 Ga0495584_0002904 Ga0495584_0002904_6190_6870 226
123 3300046492 Ga0495585_0002631 Ga0495585_0002631_5310_5993 226
124 3300046492 Ga0495585_0099134 Ga0495585_0099134_341_1021 226
125 3300046500 Ga0495596_0000080 Ga0495596_0000080_16832_17512 226
126 3300046500 Ga0495596_0000122 Ga0495596_0000122_46321_47001 226
127 3300046501 Ga0495607_0020611 Ga0495607_0020611_2711_3391 226
128 3300046501 Ga0495607_0034145 Ga0495607_0034145_629_1309 226
129 3300046506 Ga0495583_0000371 Ga0495583_0000371_16620_17300 226
130 3300046507 Ga0495606_0005256 Ga0495606_0005256_9611_10291 226
131 3300046512 Ga0495610_0000551 Ga0495610_0000551_31098_31778 226
132 3300046512 Ga0495610_0043547 Ga0495610_0043547_968_1648 226
133 3300046512 Ga0495610_0044341 Ga0495610_0044341_458_1138 226
134 3300046513 Ga0495616_0000275 Ga0495616_0000275_36966_37646 226
135 3300046513 Ga0495616_0000922 Ga0495616_0000922_6620_7300 226
136 3300046513 Ga0495616_0015384 Ga0495616_0015384_3442_4122 226
137 3300046515 Ga0495620_0005702 Ga0495620_0005702_1861_2541 226
138 3300046518 Ga0495631_0007695 Ga0495631_0007695_4364_5044 226
139 3300046519 Ga0495632_0000188 Ga0495632_0000188_36744_37424 226
140 3300046519 Ga0495632_0003563 Ga0495632_0003563_4838_5518 226
141 3300046519 Ga0495632_0016046 Ga0495632_0016046_174_854 226
142 3300046519 Ga0495632_0084161 Ga0495632_0084161_337_1017 226
143 3300046520 Ga0495637_0000030 Ga0495637_0000030_117645_118325 226
144 3300046520 Ga0495637_0000355 Ga0495637_0000355_4854_5534 226
145 3300046520 Ga0495637_0001292 Ga0495637_0001292_5004_5684 226
146 3300046523 Ga0495644_0003073 Ga0495644_0003073_2990_3670 226
147 3300046523 Ga0495644_0006516 Ga0495644_0006516_996_1676 226
148 3300046524 Ga0495648_0000314 Ga0495648_0000314_5303_5983 226
149 3300046524 Ga0495648_0002615 Ga0495648_0002615_4310_4990 226
150 3300046524 Ga0495648_0010256 Ga0495648_0010256_2999_3679 226
151 3300046524 Ga0495648_0204494 Ga0495648_0204494_148_828 226
152 3300046530 Ga0495654_0000177 Ga0495654_0000177_50449_51129 226
153 3300046530 Ga0495654_0011989 Ga0495654_0011989_3855_4535 226
154 3300046538 Ga0495609_0000037 Ga0495609_0000037_43233_43913 226
155 3300046538 Ga0495609_0000043 Ga0495609_0000043_58416_59096 226
156 3300046542 Ga0495597_0000020 Ga0495597_0000020_63495_64178 226
157 3300046557 Ga0495622_0001417 Ga0495622_0001417_1143_1823 226
158 3300046616 Ga0495668_0000328 Ga0495668_0000328_51120_51800 226
159 3300046616 Ga0495668_0002338 Ga0495668_0002338_4116_4796 226
160 3300046660 Ga0495625_0000790 Ga0495625_0000790_15676_16356 226
161 3300046665 Ga0495661_0000024 Ga0495661_0000024_55071_55751 226
162 3300046665 Ga0495661_0007847 Ga0495661_0007847_1459_2139 226
163 3300046691 Ga0495670_0025686 Ga0495670_0025686_770_1450 226
164 3300046692 Ga0495671_0000284 Ga0495671_0000284_12881_13564 226
165 3300046692 Ga0495671_0001300 Ga0495671_0001300_11949_12629 226
166 3300046692 Ga0495671_0005255 Ga0495671_0005255_1631_2311 226
167 3300046692 Ga0495671_0009041 Ga0495671_0009041_988_1668 226
168 3300046694 Ga0495649_0000103 Ga0495649_0000103_68695_69375 226
169 3300046810 Ga0495660_0000161 Ga0495660_0000161_57722_58405 226
170 3300046810 Ga0495660_0000469 Ga0495660_0000469_14290_14970 226
171 3300046810 Ga0495660_0000487 Ga0495660_0000487_12014_12694 226
172 3300046810 Ga0495660_0000671 Ga0495660_0000671_6551_7231 226
173 3300046810 Ga0495660_0002039 Ga0495660_0002039_902_1582 226
174 3300046810 Ga0495660_0022776 Ga0495660_0022776_224_904 226
175 3300047323 Ga0495683_0001214 Ga0495683_0001214_5137_5817 226
176 3300047469 Ga0495673_0003454 Ga0495673_0003454_7008_7688 226
177 3300047469 Ga0495673_0003499 Ga0495673_0003499_1774_2454 226
178 3300047469 Ga0495673_0003585 Ga0495673_0003585_1405_2085 226
179 3300047469 Ga0495673_0013393 Ga0495673_0013393_1266_1946 226
180 3300047470 Ga0495681_0000087 Ga0495681_0000087_31894_32574 226
181 3300047470 Ga0495681_0000521 Ga0495681_0000521_26086_26766 226
182 3300047470 Ga0495681_0002245 Ga0495681_0002245_4649_5329 226
183 3300048091 Ga0495626_0000045 Ga0495626_0000045_107626_108306 226
184 3300048919 Ga0496116_0000207 Ga0496116_0000207_49900_50580 226
185 3300048926 Ga0496123_0011135 Ga0496123_0011135_3441_4121 226
186 3300048927 Ga0496124_0000421 Ga0496124_0000421_49201_49932 226
187 3300048927 Ga0496124_0029510 Ga0496124_0029510_3653_4333 226
188 3300049460 Ga0495682_0000079 Ga0495682_0000079_14736_15416 226
189 3300049460 Ga0495682_0000143 Ga0495682_0000143_11228_11908 226
190 3300003323 rootH1_10047840 rootH1_100478406 227
191 3300009011 Ga0105251_10000255 Ga0105251_100002559 227
192 3300011119 Ga0105246_10106362 Ga0105246_101063621 227
193 3300013100 Ga0157373_10041304 Ga0157373_100413042 227
194 3300013102 Ga0157371_10005156 Ga0157371_1000515611 227
195 3300013102 Ga0157371_10011779 Ga0157371_100117798 227
196 3300013105 Ga0157369_10007767 Ga0157369_1000776712 227
197 3300014497 Ga0182008_10002463 Ga0182008_100024632 227
198 3300015265 Ga0182005_1000556 Ga0182005_100055613 227
199 3300025735 Ga0207713_1000259 Ga0207713_100025990 227
200 3300041411 Ga0439466_0077909 Ga0439466_0077909_135_818 227
201 3300041411 Ga0439466_0087078 Ga0439466_0087078_239_922 227
202 3300042006 Ga0439432_000033 Ga0439432_000033_38815_39504 227
203 3300042006 Ga0439432_041527 Ga0439432_041527_38_721 227
204 3300042010 Ga0439452_024901 Ga0439452_024901_517_1200 227
205 3300046492 Ga0495585_0000137 Ga0495585_0000137_64498_65217 227
206 3300046515 Ga0495620_0001670 Ga0495620_0001670_10866_11558 227
207 3300046648 Ga0495611_0245289 Ga0495611_0245289_136_819 227
208 3300046810 Ga0495660_0001020 Ga0495660_0001020_15374_16066 227
209 3300047322 Ga0495680_0023584 Ga0495680_0023584_2653_3342 227
210 3300048920 Ga0496117_0000604 Ga0496117_0000604_46916_47599 227
211 3300048920 Ga0496117_0002707 Ga0496117_0002707_14091_14774 227
212 3300048921 Ga0496118_0000613 Ga0496118_0000613_46916_47599 227
213 3300048921 Ga0496118_0002747 Ga0496118_0002747_7147_7830 227
214 3300048925 Ga0496122_0009469 Ga0496122_0009469_6369_7052 227
215 3300048926 Ga0496123_0003674 Ga0496123_0003674_5340_6023 227
216 3300048927 Ga0496124_0000825 Ga0496124_0000825_5293_5976 227
217 3300048927 Ga0496124_0168871 Ga0496124_0168871_249_935 227
218 3300049459 Ga0495678_000289 Ga0495678_000289_43751_44470 227

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eea-assembly1.cif.gz_B cyanophage pam1 tailspike receptor-binding domain 0.5771 27 106
4ru5-assembly1.cif.gz_B crystal structure of the pseudomonas phage phi297 tailspike gp61 0.4943 23 105
1zup-assembly1.cif.gz_A crystal structure of a putative nuclease with a ribonuclease h-like motif fold (tm1739) from thermotoga maritima at 2.20 a resolution 0.4912 140 202
1zup-assembly1.cif.gz_B crystal structure of a putative nuclease with a ribonuclease h-like motif fold (tm1739) from thermotoga maritima at 2.20 a resolution 0.4872 140 202
5x4a-assembly1.cif.gz_D sll-2-forssman antigen tetrasaccharides complex 0.486 23 105
ID Description Score Start End Superfamily
af_P76508_81_171_2.60.40.3940 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5794 29 105 2.60.40.3940
af_O44523_150_266_2.60.120.380 Mainly Beta;Sandwich;Jelly Rolls; 0.5507 25 113 2.60.120.380
3wmpA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5309 23 105 2.60.40.2080
af_H2FLJ7_70_256_3.40.525.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphatidylinositol Transfer Protein Sec14p;CRAL-TRIO lipid binding domain 0.5221 25 108 3.40.525.10
2w94A02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5195 24 108 2.60.40.2080
ID Description Score Start End GO Terms
AF-A0A3M3KXZ2-F1-model_v4 Uncharacterized protein 0.9079 129 227 GO:0016020
AF-A0A3M3KXZ2-F1-model_v4 Uncharacterized protein 0.8994 129 227 GO:0016020
AF-A0A5C5PXW6-F1-model_v4 Uncharacterized protein 0.8729 131 227
AF-A0A560ZDU5-F1-model_v4 Uncharacterized protein 0.87 59 227
AF-A0A5C5PXW6-F1-model_v4 Uncharacterized protein 0.8649 131 227

Feature Viewer

pLDDT pTM Quality
84.82 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map