F330737

General Info

Members Datasets Scaffolds Average Seq Length
219 144 438 361

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10029170|Ga0070691_100291702
Length 402
Sequence MDYVDNLRQCVRKTTFVLHWGRKIDFQPVQEPKKGRIAMVQQVRKSIIALAFLLPGPLLAQAPSAPLTIKPDAPDRYTVVPGDTLWGISQRYTDSPWRWPELWNLNREAIRNPHLIYPGYVIVLDRERGQLTIGAGTERAPGTTPPDIGGTVKIGPRIRAESLARQEIPSIPPSAIEPFLSRPLVIEPDGLEKGPTIIGTQSDRVILATGNAAYVRGIGKSKDDTWYVYRKGNPLVDPDTNQTLAYEAVYLGTAQVTRPGEPATVTLTETVVEVGAGDKLVAAGRPQSVSYAPRAPGSQIKGRVIGIYGGVGNVGEAGPQQVISINRGKANGVEVGHVLAVYNLGGTVRDTSKGAYDAGARIQLPDERAGLAFVFRVFDRVSYALIMQASKPVAPLDVVQTP

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
79 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
80 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
84 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.54
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10029170 3300005341 Bacteria 2581
2 Ga0070690_100000082 3300005330 Bacteria 46700
3 Ga0068869_100020833 3300005334 Bacteria 4503
4 Ga0070680_100033161 3300005336 Bacteria 4161
5 Ga0070680_100171705 3300005336 Bacteria 1824
6 Ga0070689_100059891 3300005340 Bacteria 2959
7 Ga0070689_100085406 3300005340 Bacteria 2482
8 Ga0070691_10087821 3300005341 Bacteria 1530
9 Ga0070687_100072942 3300005343 Bacteria 1848
10 Ga0070669_100011060 3300005353 Bacteria 6404
11 Ga0070675_100007884 3300005354 Bacteria 8254
12 Ga0070711_100189176 3300005439 Bacteria 1581
13 Ga0070705_100002962 3300005440 Bacteria 8397
14 Ga0070694_100005628 3300005444 Bacteria 7594
15 Ga0070694_100050962 3300005444 Bacteria 2793
16 Ga0070694_100112855 3300005444 Bacteria 1938
17 Ga0070681_10000257 3300005458 Bacteria 42143
18 Ga0070681_10047802 3300005458 Bacteria 4277
19 Ga0068867_100000126 3300005459 Bacteria 49231
20 Ga0070699_100147707 3300005518 Bacteria 2077
21 Ga0070679_100219861 3300005530 Bacteria 1861
22 Ga0070697_100001805 3300005536 Bacteria 16337
23 Ga0070695_100022771 3300005545 Bacteria 3845
24 Ga0068861_100000134 3300005719 Bacteria 38219
25 Ga0068860_100208977 3300005843 Bacteria 1893
26 Ga0081539_10002484 3300005985 Bacteria 25931
27 Ga0070715_10012474 3300006163 Bacteria 3095
28 Ga0070716_100040164 3300006173 Bacteria 2602
29 Ga0075428_100010741 3300006844 Bacteria 10178
30 Ga0075428_100153679 3300006844 Bacteria 2500
31 Ga0075430_100000063 3300006846 Bacteria 57435
32 Ga0075430_100003090 3300006846 Bacteria 13911
33 Ga0075430_100004248 3300006846 Bacteria 12107
34 Ga0075430_100006901 3300006846 Bacteria 9573
35 Ga0075431_100015155 3300006847 Bacteria 7809
36 Ga0075431_100020708 3300006847 Bacteria 6720
37 Ga0075433_10090150 3300006852 Bacteria 2710
38 Ga0075434_100029101 3300006871 Bacteria 5432
39 Ga0075429_100009223 3300006880 Bacteria 8567
40 Ga0068865_100006047 3300006881 Bacteria 7377
41 Ga0075436_100000050 3300006914 Bacteria 71245
42 Ga0075436_100023001 3300006914 Bacteria 4281
43 Ga0099794_10005971 3300007265 Bacteria 4913
44 Ga0099794_10016250 3300007265 Bacteria 3297
45 Ga0099794_10033284 3300007265 Bacteria 2423
46 Ga0111539_10201387 3300009094 Bacteria 2321
47 Ga0114129_10192790 3300009147 Bacteria 2765
48 Ga0105243_10003894 3300009148 Bacteria 11915
49 Ga0105249_10015510 3300009553 Bacteria 6744
50 Ga0157372_10255231 3300013307 Bacteria 2035
51 Ga0157380_10003099 3300014326 Bacteria 11340
52 Ga0207642_10022800 3300025899 Bacteria 2490
53 Ga0207660_10044580 3300025917 Bacteria 3120
54 Ga0207660_10259911 3300025917 Bacteria 1373
55 Ga0207681_10000301 3300025923 Bacteria 36454
56 Ga0207681_10144453 3300025923 Bacteria 1776
57 Ga0207709_10002128 3300025935 Bacteria 12728
58 Ga0207704_10006144 3300025938 Bacteria 5573
59 Ga0207665_10058236 3300025939 Bacteria 2611
60 Ga0207689_10012667 3300025942 Bacteria 7205
61 Ga0207708_10000463 3300026075 Bacteria 31415
62 Ga0207708_10096405 3300026075 Bacteria 2285
63 Ga0207641_10451103 3300026088 Bacteria 1243
64 Ga0207648_10000352 3300026089 Bacteria 50550
65 Ga0207674_10083190 3300026116 Bacteria 3200
66 Ga0207675_100000223 3300026118 Bacteria 53251
67 Ga0207683_10125777 3300026121 Bacteria 2304
68 Ga0209969_1005769 3300027360 Bacteria 1742
69 Ga0209981_1001260 3300027378 Bacteria 3210
70 Ga0209981_1003750 3300027378 Bacteria 1976
71 Ga0209996_1002509 3300027395 Bacteria 2272
72 Ga0210000_1000261 3300027462 Bacteria 7505
73 Ga0209995_1000847 3300027471 Bacteria 4743
74 Ga0209968_1001718 3300027526 Bacteria 3312
75 Ga0209999_1007119 3300027543 Bacteria 2012
76 Ga0209971_1002952 3300027682 Bacteria 4065
77 Ga0209966_1001040 3300027695 Bacteria 5147
78 Ga0209998_10007760 3300027717 Bacteria 2227
79 Ga0209974_10009970 3300027876 Bacteria 3213
80 Ga0268265_10000579 3300028380 Bacteria 37090
81 Ga0265323_10023248 3300028653 Bacteria 2364
82 Ga0265316_10033905 3300031344 Bacteria 4152
83 Ga0265316_10051256 3300031344 Bacteria 3243
84 Ga0265316_10204519 3300031344 Bacteria 1462
85 Ga0307408_100190372 3300031548 Bacteria 1652
86 Ga0307508_10065074 3300031616 Bacteria 3213
87 Ga0307412_10059005 3300031911 Bacteria 2570
88 Ga0307411_10044150 3300032005 Bacteria 2857
89 Ga0373952_0008452 3300035092 Bacteria 1955
90 Ga0373954_0000002 3300035118 Bacteria 147478
91 Ga0373954_0057945 3300035118 Bacteria 1825
92 Ga0373957_0016333 3300035120 Bacteria 2568
93 Ga0373924_0020698 3300035410 Bacteria 2559
94 Ga0373924_0046000 3300035410 Bacteria 1796
95 Ga0373931_0043205 3300035691 Bacteria 2372
96 Ga0373933_0010281 3300035724 Bacteria 5127
97 Ga0373937_0000646 3300036401 Bacteria 30603
98 Ga0373937_0006721 3300036401 Bacteria 9921
99 Ga0373937_0018224 3300036401 Bacteria 6266
100 Ga0373925_0219966 3300037068 Bacteria 1516
101 Ga0436360_0117692 3300039438 Bacteria 2024
102 Ga0439441_001271 3300042001 Bacteria 3239
103 Ga0439441_011695 3300042001 Unclassified 1493
104 Ga0439443_000748 3300042003 Bacteria 3185
105 Ga0439443_003481 3300042003 Bacteria 1987
106 Ga0439451_003321 3300042009 Bacteria 3258
107 Ga0439446_0002409 3300042156 Bacteria 4483
108 Ga0439434_0000165 3300042435 Bacteria 17901
109 Ga0439435_0000132 3300042436 Bacteria 9910
110 Ga0439435_0001360 3300042436 Bacteria 4473
111 Ga0439444_0003083 3300042437 Bacteria 2331
112 Ga0439460_0001974 3300042461 Bacteria 4909
113 Ga0439460_0004773 3300042461 Bacteria 3307
114 Ga0451577_0209470 3300042876 Bacteria 1761
115 Ga0466968_0039582 3300044735 Bacteria 1985
116 Ga0451576_0094797 3300045051 Bacteria 3104
117 Ga0451576_0299530 3300045051 Bacteria 1681
118 Ga0466967_0014215 3300045976 Bacteria 6191
119 Ga0495662_0019257 3300046476 Bacteria 3301
120 Ga0495662_0044808 3300046476 Bacteria 2135
121 Ga0495584_0141413 3300046491 Bacteria 1222
122 Ga0495608_0000913 3300046511 Bacteria 20720
123 Ga0495652_0089994 3300046529 Bacteria 2512
124 Ga0495640_0020513 3300046533 Bacteria 4862
125 Ga0495640_0105791 3300046533 Bacteria 1843
126 Ga0495587_0036777 3300046536 Bacteria 2944
127 Ga0495621_0005661 3300046539 Bacteria 3606
128 Ga0495645_0065466 3300046543 Bacteria 2629
129 Ga0495667_0005087 3300046559 Bacteria 8891
130 Ga0495635_0061537 3300046663 Bacteria 2578
131 Ga0495657_0105870 3300046675 Bacteria 1787
132 Ga0495658_0006488 3300046683 Bacteria 5746
133 Ga0495658_0022885 3300046683 Bacteria 3311
134 Ga0495669_0007666 3300046684 Bacteria 4529
135 Ga0495613_0010916 3300046689 Bacteria 6744
136 Ga0495600_0021832 3300046809 Bacteria 4104
137 Ga0495636_0000587 3300047318 Bacteria 13396
138 Ga0495680_0001187 3300047322 Bacteria 28585
139 Ga0501031_0158846 3300049568 Bacteria 1478
140 Ga0501033_0004036 3300049570 Bacteria 11859
141 Ga0501036_0000314 3300049572 Bacteria 33786
142 Ga0501036_0091431 3300049572 Bacteria 2571
143 Ga0501037_0030461 3300049573 Bacteria 3987
144 Ga0501037_0245051 3300049573 Bacteria 1255
145 Ga0501038_0002946 3300049574 Bacteria 15875
146 Ga0501039_0000438 3300049575 Bacteria 30118
147 Ga0501040_0000261 3300049576 Bacteria 30880
148 Ga0501040_0128243 3300049576 Bacteria 1783
149 Ga0501040_0168997 3300049576 Bacteria 1548
150 Ga0501041_0000207 3300049577 Bacteria 27155
151 Ga0501041_0010313 3300049577 Bacteria 5506
152 Ga0501041_0014814 3300049577 Bacteria 4630
153 Ga0501042_0007514 3300049578 Bacteria 7145
154 Ga0501042_0023375 3300049578 Bacteria 4326
155 Ga0501043_0029692 3300049579 Bacteria 4296
156 Ga0501046_0000806 3300049580 Bacteria 30435
157 Ga0501046_0194665 3300049580 Bacteria 1511
158 Ga0501048_0001059 3300049582 Bacteria 20596
159 Ga0501048_0008233 3300049582 Bacteria 7888
160 Ga0501048_0138067 3300049582 Bacteria 1723
161 Ga0501068_0007615 3300049584 Bacteria 5992
162 Ga0501070_0015515 3300049586 Bacteria 6409
163 Ga0501071_0005768 3300049587 Bacteria 7994
164 Ga0501071_0021521 3300049587 Bacteria 4492
165 Ga0501071_0045721 3300049587 Bacteria 3143
166 Ga0501072_0000329 3300049588 Bacteria 33886
167 Ga0501072_0010417 3300049588 Bacteria 7084
168 Ga0501072_0018568 3300049588 Bacteria 5359
169 Ga0501072_0134116 3300049588 Bacteria 1974
170 Ga0501072_0167840 3300049588 Bacteria 1751
171 Ga0501075_0004029 3300049591 Bacteria 9907
172 Ga0501075_0006513 3300049591 Bacteria 8039
173 Ga0501075_0037937 3300049591 Bacteria 3602
174 Ga0501075_0054188 3300049591 Bacteria 3016
175 Ga0501076_0008568 3300049592 Bacteria 7501
176 Ga0501076_0012662 3300049592 Bacteria 6313
177 Ga0501076_0026011 3300049592 Bacteria 4529
178 Ga0501077_0001375 3300049593 Bacteria 14643
179 Ga0501077_0016538 3300049593 Bacteria 4648
180 Ga0501079_0000149 3300049741 Bacteria 38185
181 Ga0501079_0010299 3300049741 Bacteria 7101
182 Ga0501080_0000095 3300049742 Bacteria 59782
183 Ga0501080_0011915 3300049742 Bacteria 7963
184 Ga0501080_0012142 3300049742 Bacteria 7892
185 Ga0501081_0000497 3300049743 Bacteria 21992
186 Ga0501081_0000738 3300049743 Bacteria 19080
187 Ga0501083_0043389 3300049744 Bacteria 3047
188 Ga0501083_0136420 3300049744 Unclassified 1608
189 Ga0501035_0163310 3300049822 Bacteria 1927
190 Ga0501045_0000100 3300049824 Bacteria 42747
191 nmdc:mga05p37_157182_c1 3300050507 Bacteria 2778
192 nmdc:mga05p37_256261_c1 3300050507 Bacteria 2096
193 nmdc:mga09592_80471_c1 3300050508 Bacteria 2775
194 nmdc:mga0qj67_1671_c1 3300050509 Bacteria 15623
195 nmdc:mga0qj67_40285_c1 3300050509 Bacteria 3672
196 nmdc:mga0qj67_4064_c1 3300050509 Bacteria 10610
197 nmdc:mga0qj67_62166_c1 3300050509 Bacteria 2968
198 nmdc:mga06r32_123916_c1 3300050510 Bacteria 2551
199 nmdc:mga06r32_36255_c1 3300050510 Bacteria 4659
200 nmdc:mga06r32_70470_c1 3300050510 Bacteria 3381
201 nmdc:mga08y16_15880_c1 3300050511 Bacteria 7915
202 nmdc:mga08y16_18025_c1 3300050511 Bacteria 7437
203 nmdc:mga08y16_199179_c1 3300050511 Bacteria 2075
204 nmdc:mga08y16_36002_c1 3300050511 Bacteria 5198
205 nmdc:mga08y16_59380_c1 3300050511 Bacteria 3995
206 nmdc:mga0n895_10896_c1 3300050512 Bacteria 8075
207 nmdc:mga0n895_276105_c1 3300050512 Bacteria 1704
208 nmdc:mga0n895_50497_c1 3300050512 Bacteria 4078
209 nmdc:mga0rr50_1788_c1 3300050513 Bacteria 11874
210 nmdc:mga0rr50_258641_c1 3300050513 Bacteria 1448
211 nmdc:mga0rr50_270333_c1 3300050513 Bacteria 1416
212 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
213 Ga0495601_0145453 3300053077 Bacteria 1547
214 Ga0501084_0044072 3300054114 Bacteria 3734
215 Ga0501082_0005800 3300060353 Bacteria 10718
216 Ga0530510_0000579 3300061734 Bacteria 23494
217 Ga0530510_0001762 3300061734 Bacteria 14739
218 Ga0530510_0228775 3300061734 Unclassified 1383
219 2891635118 2891633521 Bacteria 4602265
220 Ga0070691_10029170
221 Ga0070690_100000082
222 Ga0068869_100020833
223 Ga0070680_100033161
224 Ga0070680_100171705
225 Ga0070689_100059891
226 Ga0070689_100085406
227 Ga0070691_10087821
228 Ga0070687_100072942
229 Ga0070669_100011060
230 Ga0070675_100007884
231 Ga0070711_100189176
232 Ga0070705_100002962
233 Ga0070694_100005628
234 Ga0070694_100050962
235 Ga0070694_100112855
236 Ga0070681_10000257
237 Ga0070681_10047802
238 Ga0068867_100000126
239 Ga0070699_100147707
240 Ga0070679_100219861
241 Ga0070697_100001805
242 Ga0070695_100022771
243 Ga0068861_100000134
244 Ga0068860_100208977
245 Ga0081539_10002484
246 Ga0070715_10012474
247 Ga0070716_100040164
248 Ga0075428_100010741
249 Ga0075428_100153679
250 Ga0075430_100000063
251 Ga0075430_100003090
252 Ga0075430_100004248
253 Ga0075430_100006901
254 Ga0075431_100015155
255 Ga0075431_100020708
256 Ga0075433_10090150
257 Ga0075434_100029101
258 Ga0075429_100009223
259 Ga0068865_100006047
260 Ga0075436_100000050
261 Ga0075436_100023001
262 Ga0099794_10005971
263 Ga0099794_10016250
264 Ga0099794_10033284
265 Ga0111539_10201387
266 Ga0114129_10192790
267 Ga0105243_10003894
268 Ga0105249_10015510
269 Ga0157372_10255231
270 Ga0157380_10003099
271 Ga0207642_10022800
272 Ga0207660_10044580
273 Ga0207660_10259911
274 Ga0207681_10000301
275 Ga0207681_10144453
276 Ga0207709_10002128
277 Ga0207704_10006144
278 Ga0207665_10058236
279 Ga0207689_10012667
280 Ga0207708_10000463
281 Ga0207708_10096405
282 Ga0207641_10451103
283 Ga0207648_10000352
284 Ga0207674_10083190
285 Ga0207675_100000223
286 Ga0207683_10125777
287 Ga0209969_1005769
288 Ga0209981_1001260
289 Ga0209981_1003750
290 Ga0209996_1002509
291 Ga0210000_1000261
292 Ga0209995_1000847
293 Ga0209968_1001718
294 Ga0209999_1007119
295 Ga0209971_1002952
296 Ga0209966_1001040
297 Ga0209998_10007760
298 Ga0209974_10009970
299 Ga0268265_10000579
300 Ga0265323_10023248
301 Ga0265316_10033905
302 Ga0265316_10051256
303 Ga0265316_10204519
304 Ga0307408_100190372
305 Ga0307508_10065074
306 Ga0307412_10059005
307 Ga0307411_10044150
308 Ga0373952_0008452
309 Ga0373954_0000002
310 Ga0373954_0057945
311 Ga0373957_0016333
312 Ga0373924_0020698
313 Ga0373924_0046000
314 Ga0373931_0043205
315 Ga0373933_0010281
316 Ga0373937_0000646
317 Ga0373937_0006721
318 Ga0373937_0018224
319 Ga0373925_0219966
320 Ga0436360_0117692
321 Ga0439441_001271
322 Ga0439441_011695
323 Ga0439443_000748
324 Ga0439443_003481
325 Ga0439451_003321
326 Ga0439446_0002409
327 Ga0439434_0000165
328 Ga0439435_0000132
329 Ga0439435_0001360
330 Ga0439444_0003083
331 Ga0439460_0001974
332 Ga0439460_0004773
333 Ga0451577_0209470
334 Ga0466968_0039582
335 Ga0451576_0094797
336 Ga0451576_0299530
337 Ga0466967_0014215
338 Ga0495662_0019257
339 Ga0495662_0044808
340 Ga0495584_0141413
341 Ga0495608_0000913
342 Ga0495652_0089994
343 Ga0495640_0020513
344 Ga0495640_0105791
345 Ga0495587_0036777
346 Ga0495621_0005661
347 Ga0495645_0065466
348 Ga0495667_0005087
349 Ga0495635_0061537
350 Ga0495657_0105870
351 Ga0495658_0006488
352 Ga0495658_0022885
353 Ga0495669_0007666
354 Ga0495613_0010916
355 Ga0495600_0021832
356 Ga0495636_0000587
357 Ga0495680_0001187
358 Ga0501031_0158846
359 Ga0501033_0004036
360 Ga0501036_0000314
361 Ga0501036_0091431
362 Ga0501037_0030461
363 Ga0501037_0245051
364 Ga0501038_0002946
365 Ga0501039_0000438
366 Ga0501040_0000261
367 Ga0501040_0128243
368 Ga0501040_0168997
369 Ga0501041_0000207
370 Ga0501041_0010313
371 Ga0501041_0014814
372 Ga0501042_0007514
373 Ga0501042_0023375
374 Ga0501043_0029692
375 Ga0501046_0000806
376 Ga0501046_0194665
377 Ga0501048_0001059
378 Ga0501048_0008233
379 Ga0501048_0138067
380 Ga0501068_0007615
381 Ga0501070_0015515
382 Ga0501071_0005768
383 Ga0501071_0021521
384 Ga0501071_0045721
385 Ga0501072_0000329
386 Ga0501072_0010417
387 Ga0501072_0018568
388 Ga0501072_0134116
389 Ga0501072_0167840
390 Ga0501075_0004029
391 Ga0501075_0006513
392 Ga0501075_0037937
393 Ga0501075_0054188
394 Ga0501076_0008568
395 Ga0501076_0012662
396 Ga0501076_0026011
397 Ga0501077_0001375
398 Ga0501077_0016538
399 Ga0501079_0000149
400 Ga0501079_0010299
401 Ga0501080_0000095
402 Ga0501080_0011915
403 Ga0501080_0012142
404 Ga0501081_0000497
405 Ga0501081_0000738
406 Ga0501083_0043389
407 Ga0501083_0136420
408 Ga0501035_0163310
409 Ga0501045_0000100
410 nmdc:mga05p37_157182_c1
411 nmdc:mga05p37_256261_c1
412 nmdc:mga09592_80471_c1
413 nmdc:mga0qj67_1671_c1
414 nmdc:mga0qj67_40285_c1
415 nmdc:mga0qj67_4064_c1
416 nmdc:mga0qj67_62166_c1
417 nmdc:mga06r32_123916_c1
418 nmdc:mga06r32_36255_c1
419 nmdc:mga06r32_70470_c1
420 nmdc:mga08y16_15880_c1
421 nmdc:mga08y16_18025_c1
422 nmdc:mga08y16_199179_c1
423 nmdc:mga08y16_36002_c1
424 nmdc:mga08y16_59380_c1
425 nmdc:mga0n895_10896_c1
426 nmdc:mga0n895_276105_c1
427 nmdc:mga0n895_50497_c1
428 nmdc:mga0rr50_1788_c1
429 nmdc:mga0rr50_258641_c1
430 nmdc:mga0rr50_270333_c1
431 nmdc:mga08x19_55_c1
432 Ga0495601_0145453
433 Ga0501084_0044072
434 Ga0501082_0005800
435 Ga0530510_0000579
436 Ga0530510_0001762
437 Ga0530510_0228775
438 2891635118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01476

LysM

LysM domain

77

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l1r-assembly1.cif.gz_C ps3 f1-atpase hydrolysis dwell 0.8154 259 359
5ik2-assembly1.cif.gz_C caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.8084 259 359
3oe7-assembly2.cif.gz_J structure of four mutant forms of yeast f1 atpase: gamma-i270t 0.8058 259 360
3fks-assembly3.cif.gz_T yeast f1 atpase in the absence of bound nucleotides 0.8027 259 360
1sky-assembly1.cif.gz_B crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3 0.7747 259 359
ID Description Score Start End Superfamily
af_Q9XPJ9_41_108_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.7734 259 359 2.40.30.20
af_O96252_32_131_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.7638 255 359 2.40.30.20
1fx0B01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7472 258 357 2.40.10.170
af_Q9XPJ9_41_108_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.724 259 359 2.40.30.20
af_Q57670_3_72_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.7124 258 359 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A519UB59-F1-model_v4 Peptidoglycan-binding protein LysM 0.9225 259 360
AF-A0A6N4DF57-F1-model_v4 deleted 0.914 246 360
AF-A0A355JS71-F1-model_v4 deleted 0.9116 191 360
AF-A0A3C0LZI0-F1-model_v4 deleted 0.9063 159 360
AF-A0A2E8VPG7-F1-model_v4 Peptidoglycan-binding protein 0.9024 164 360

Map