F330911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 219 | 152 | 219 | 83 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10595011|Ga0081455_105950111 |
| Length | 90 |
| Sequence | MAALVWFTMGVALWHFTVFVPDRFWGGIVGAFLGSTAGGMVSGTIAQIALGQGIGETDLATALYAVPGCLLGLAIVYGVGVRSGVEAEHI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 11 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 12 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 13 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 14 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 15 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 18 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 19 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 20 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 25 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 26 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 61 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 64 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 65 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 66 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 67 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 70 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 72 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 73 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 74 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 75 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 77 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 80 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 83 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 84 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 85 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 86 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 87 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 88 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 89 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 90 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 131 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 135 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 136 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 140 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 141 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 142 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 152 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.48 |
| Nodule | 0 |
| Rhizoplane | 8.68 |
| Rhizosphere | 84.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1001803 | 3300002074 | Bacteria | 2378 |
| 2 | JGI24034J26672_10002280 | 3300002239 | Bacteria | 2623 |
| 3 | JGI24742J22300_10010708 | 3300002244 | Unclassified | 1519 |
| 4 | Ga0070691_10000524 | 3300005341 | Bacteria | 14453 |
| 5 | Ga0070667_100105540 | 3300005367 | Bacteria | 2438 |
| 6 | Ga0070711_100016210 | 3300005439 | Bacteria | 4729 |
| 7 | Ga0070663_100069149 | 3300005455 | Bacteria | 2565 |
| 8 | Ga0070678_100138883 | 3300005456 | Bacteria | 1942 |
| 9 | Ga0070678_100756752 | 3300005456 | Bacteria | 879 |
| 10 | Ga0070665_100508699 | 3300005548 | Bacteria | 1216 |
| 11 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 12 | Ga0068866_10001583 | 3300005718 | Bacteria | 9651 |
| 13 | Ga0068866_10421409 | 3300005718 | Bacteria | 866 |
| 14 | Ga0068863_100016778 | 3300005841 | Bacteria | 7026 |
| 15 | Ga0068858_100000508 | 3300005842 | Bacteria | 40801 |
| 16 | Ga0068860_100004743 | 3300005843 | Bacteria | 13853 |
| 17 | Ga0068860_102116959 | 3300005843 | Bacteria | 584 |
| 18 | Ga0081455_10294076 | 3300005937 | Bacteria | 1168 |
| 19 | Ga0081455_10595011 | 3300005937 | Bacteria | 722 |
| 20 | Ga0081540_1191664 | 3300005983 | Bacteria | 753 |
| 21 | Ga0081539_10012453 | 3300005985 | Bacteria | 6554 |
| 22 | Ga0075365_10034615 | 3300006038 | Bacteria | 3262 |
| 23 | Ga0075365_10266418 | 3300006038 | Bacteria | 1205 |
| 24 | Ga0075363_100055830 | 3300006048 | Bacteria | 2116 |
| 25 | Ga0075363_100239388 | 3300006048 | Bacteria | 1043 |
| 26 | Ga0075364_10202783 | 3300006051 | Bacteria | 1345 |
| 27 | Ga0070715_10000029 | 3300006163 | Bacteria | 88994 |
| 28 | Ga0070716_101831203 | 3300006173 | Bacteria | 503 |
| 29 | Ga0070712_101876069 | 3300006175 | Bacteria | 525 |
| 30 | Ga0097621_100548549 | 3300006237 | Bacteria | 1052 |
| 31 | Ga0068871_100618854 | 3300006358 | Unclassified | 986 |
| 32 | Ga0075428_102523208 | 3300006844 | Unclassified | 526 |
| 33 | Ga0075431_100050709 | 3300006847 | Bacteria | 4279 |
| 34 | Ga0068865_100633343 | 3300006881 | Bacteria | 907 |
| 35 | Ga0075435_101763329 | 3300007076 | Bacteria | 543 |
| 36 | Ga0105240_10851304 | 3300009093 | Bacteria | 984 |
| 37 | Ga0105245_10006201 | 3300009098 | Bacteria | 10517 |
| 38 | Ga0105245_12754484 | 3300009098 | Bacteria | 544 |
| 39 | Ga0114129_10531086 | 3300009147 | Bacteria | 1533 |
| 40 | Ga0105243_10046930 | 3300009148 | Bacteria | 3399 |
| 41 | Ga0105243_10508117 | 3300009148 | Unclassified | 1143 |
| 42 | Ga0105242_10123196 | 3300009176 | Bacteria | 2228 |
| 43 | Ga0105239_10133047 | 3300010375 | Bacteria | 2767 |
| 44 | Ga0105239_10306236 | 3300010375 | Bacteria | 1790 |
| 45 | Ga0157370_10022403 | 3300013104 | Bacteria | 6286 |
| 46 | Ga0157374_10032041 | 3300013296 | Bacteria | 4783 |
| 47 | Ga0163162_12038267 | 3300013306 | Bacteria | 658 |
| 48 | Ga0157375_10003797 | 3300013308 | Bacteria | 13096 |
| 49 | Ga0157375_11170361 | 3300013308 | Bacteria | 901 |
| 50 | Ga0163163_11028760 | 3300014325 | Bacteria | 887 |
| 51 | Ga0157376_12088117 | 3300014969 | Unclassified | 605 |
| 52 | Ga0163161_11482038 | 3300017792 | Bacteria | 595 |
| 53 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 54 | Ga0207642_10000080 | 3300025899 | Bacteria | 25169 |
| 55 | Ga0207642_10335904 | 3300025899 | Bacteria | 887 |
| 56 | Ga0207647_10164778 | 3300025904 | Bacteria | 1292 |
| 57 | Ga0207685_10000054 | 3300025905 | Bacteria | 35900 |
| 58 | Ga0207643_10854289 | 3300025908 | Bacteria | 590 |
| 59 | Ga0207693_11106168 | 3300025915 | Bacteria | 602 |
| 60 | Ga0207663_10003583 | 3300025916 | Bacteria | 7620 |
| 61 | Ga0207687_10346587 | 3300025927 | Bacteria | 1209 |
| 62 | Ga0207687_10556304 | 3300025927 | Bacteria | 963 |
| 63 | Ga0207664_10159182 | 3300025929 | Bacteria | 1925 |
| 64 | Ga0207686_10043320 | 3300025934 | Bacteria | 2757 |
| 65 | Ga0207709_10034680 | 3300025935 | Bacteria | 2976 |
| 66 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 67 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 68 | Ga0207704_10396295 | 3300025938 | Bacteria | 1088 |
| 69 | Ga0207665_10510124 | 3300025939 | Unclassified | 930 |
| 70 | Ga0207665_11502518 | 3300025939 | Unclassified | 535 |
| 71 | Ga0207658_10157658 | 3300025986 | Bacteria | 1857 |
| 72 | Ga0207703_10000385 | 3300026035 | Bacteria | 47298 |
| 73 | Ga0207678_10124980 | 3300026067 | Bacteria | 2195 |
| 74 | Ga0207678_10195232 | 3300026067 | Bacteria | 1730 |
| 75 | Ga0207641_10005911 | 3300026088 | Bacteria | 10379 |
| 76 | Ga0207683_10139677 | 3300026121 | Bacteria | 2182 |
| 77 | Ga0207683_10548061 | 3300026121 | Bacteria | 1069 |
| 78 | Ga0207428_11062583 | 3300027907 | Bacteria | 567 |
| 79 | Ga0268266_10262479 | 3300028379 | Bacteria | 1601 |
| 80 | Ga0268264_10002435 | 3300028381 | Bacteria | 16359 |
| 81 | Ga0268264_11749384 | 3300028381 | Unclassified | 632 |
| 82 | Ga0265337_1000066 | 3300028556 | Bacteria | 48673 |
| 83 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 84 | Ga0265319_1229914 | 3300028563 | Bacteria | 566 |
| 85 | Ga0265334_10072981 | 3300028573 | Bacteria | 1275 |
| 86 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 87 | Ga0265336_10062495 | 3300028666 | Bacteria | 1116 |
| 88 | Ga0265338_10259892 | 3300028800 | Bacteria | 1277 |
| 89 | Ga0265324_10000283 | 3300029957 | Bacteria | 37587 |
| 90 | Ga0307511_10061741 | 3300030521 | Bacteria | 2852 |
| 91 | Ga0265330_10151780 | 3300031235 | Bacteria | 984 |
| 92 | Ga0265328_10003099 | 3300031239 | Bacteria | 7416 |
| 93 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 94 | Ga0265329_10100362 | 3300031242 | Bacteria | 921 |
| 95 | Ga0265331_10000858 | 3300031250 | Bacteria | 24739 |
| 96 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 97 | Ga0265314_10003522 | 3300031711 | Bacteria | 15112 |
| 98 | Ga0265342_10072828 | 3300031712 | Bacteria | 1999 |
| 99 | Ga0373955_0239168 | 3300035172 | Unclassified | 1087 |
| 100 | Ga0395900_0100344 | 3300037418 | Bacteria | 2974 |
| 101 | Ga0395900_1498112 | 3300037418 | Bacteria | 587 |
| 102 | Ga0395898_0158758 | 3300037466 | Bacteria | 2163 |
| 103 | Ga0395905_0135795 | 3300037471 | Bacteria | 2314 |
| 104 | Ga0395901_0049716 | 3300038443 | Bacteria | 4357 |
| 105 | Ga0395901_0297468 | 3300038443 | Bacteria | 1674 |
| 106 | Ga0395901_0613909 | 3300038443 | Bacteria | 1095 |
| 107 | Ga0451802_0657914 | 3300041460 | Bacteria | 510 |
| 108 | Ga0451802_1824591 | 3300041460 | Unclassified | 777 |
| 109 | Ga0451807_0339460 | 3300041486 | Bacteria | 639 |
| 110 | Ga0451807_1653004 | 3300041486 | Bacteria | 738 |
| 111 | Ga0451849_1037714 | 3300041505 | Bacteria | 1045 |
| 112 | Ga0466963_0010038 | 3300044694 | Bacteria | 5724 |
| 113 | Ga0466967_0111517 | 3300045976 | Bacteria | 2514 |
| 114 | Ga0466967_0333480 | 3300045976 | Bacteria | 1465 |
| 115 | Ga0495592_0001152 | 3300046454 | Bacteria | 18343 |
| 116 | Ga0495592_0110334 | 3300046454 | Bacteria | 1947 |
| 117 | Ga0495592_0186188 | 3300046454 | Unclassified | 1410 |
| 118 | Ga0495592_0423245 | 3300046454 | Bacteria | 839 |
| 119 | Ga0495603_0004009 | 3300046455 | Bacteria | 8766 |
| 120 | Ga0495603_0112601 | 3300046455 | Bacteria | 1587 |
| 121 | Ga0495629_0010707 | 3300046459 | Bacteria | 6669 |
| 122 | Ga0495629_0093927 | 3300046459 | Bacteria | 2093 |
| 123 | Ga0495629_0688366 | 3300046459 | Bacteria | 679 |
| 124 | Ga0495629_1032575 | 3300046459 | Bacteria | 534 |
| 125 | Ga0495651_0061533 | 3300046462 | Bacteria | 2873 |
| 126 | Ga0495651_0095765 | 3300046462 | Bacteria | 2219 |
| 127 | Ga0495653_0035887 | 3300046463 | Bacteria | 3910 |
| 128 | Ga0495653_0057544 | 3300046463 | Bacteria | 2958 |
| 129 | Ga0495653_0187720 | 3300046463 | Bacteria | 1413 |
| 130 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 131 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 132 | Ga0495618_0304635 | 3300046514 | Bacteria | 990 |
| 133 | Ga0495618_0456262 | 3300046514 | Bacteria | 775 |
| 134 | Ga0495620_0239835 | 3300046515 | Bacteria | 692 |
| 135 | Ga0495628_0011208 | 3300046516 | Bacteria | 7585 |
| 136 | Ga0495628_0082388 | 3300046516 | Bacteria | 2499 |
| 137 | Ga0495630_0002818 | 3300046517 | Bacteria | 12049 |
| 138 | Ga0495630_0017930 | 3300046517 | Bacteria | 5193 |
| 139 | Ga0495652_0011070 | 3300046529 | Bacteria | 8173 |
| 140 | Ga0495652_0040875 | 3300046529 | Bacteria | 4007 |
| 141 | Ga0495640_0023616 | 3300046533 | Bacteria | 4475 |
| 142 | Ga0495587_0035965 | 3300046536 | Bacteria | 2981 |
| 143 | Ga0495598_0008120 | 3300046537 | Bacteria | 2434 |
| 144 | Ga0495621_0065322 | 3300046539 | Unclassified | 1329 |
| 145 | Ga0495645_0008969 | 3300046543 | Bacteria | 6986 |
| 146 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 147 | Ga0495667_0162551 | 3300046559 | Bacteria | 1436 |
| 148 | Ga0495668_0028721 | 3300046616 | Bacteria | 3145 |
| 149 | Ga0495634_0000111 | 3300046642 | Bacteria | 67891 |
| 150 | Ga0495635_0000031 | 3300046663 | Bacteria | 110244 |
| 151 | Ga0495635_0136602 | 3300046663 | Bacteria | 1671 |
| 152 | Ga0495635_0313973 | 3300046663 | Bacteria | 1050 |
| 153 | Ga0495657_0121268 | 3300046675 | Bacteria | 1646 |
| 154 | Ga0495657_0226689 | 3300046675 | Bacteria | 1131 |
| 155 | Ga0495599_0687303 | 3300046678 | Bacteria | 591 |
| 156 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 157 | Ga0495647_0018607 | 3300046681 | Bacteria | 2475 |
| 158 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 159 | Ga0495624_0000019 | 3300046690 | Bacteria | 102237 |
| 160 | Ga0495624_0131163 | 3300046690 | Bacteria | 1536 |
| 161 | Ga0495624_0509208 | 3300046690 | Bacteria | 720 |
| 162 | Ga0495600_0004207 | 3300046809 | Bacteria | 8590 |
| 163 | Ga0495600_0253364 | 3300046809 | Bacteria | 1119 |
| 164 | Ga0495660_0490128 | 3300046810 | Unclassified | 527 |
| 165 | Ga0495604_0000067 | 3300047317 | Bacteria | 90345 |
| 166 | Ga0495604_0153398 | 3300047317 | Bacteria | 1634 |
| 167 | Ga0495674_1144714 | 3300047319 | Bacteria | 590 |
| 168 | Ga0495676_0266135 | 3300047321 | Bacteria | 1165 |
| 169 | Ga0495676_0356590 | 3300047321 | Bacteria | 977 |
| 170 | Ga0495680_0000143 | 3300047322 | Bacteria | 71946 |
| 171 | Ga0495680_0007905 | 3300047322 | Bacteria | 9704 |
| 172 | Ga0495680_0328302 | 3300047322 | Bacteria | 1069 |
| 173 | Ga0495684_0264384 | 3300047471 | Bacteria | 1247 |
| 174 | Ga0495593_0518242 | 3300047673 | Bacteria | 598 |
| 175 | Ga0495614_0298199 | 3300048089 | Bacteria | 744 |
| 176 | Ga0496102_0705334 | 3300048905 | Bacteria | 932 |
| 177 | Ga0496104_0000765 | 3300048907 | Bacteria | 27516 |
| 178 | Ga0496105_0000409 | 3300048908 | Bacteria | 28168 |
| 179 | Ga0496106_0000030 | 3300048909 | Bacteria | 136804 |
| 180 | Ga0496108_0006747 | 3300048911 | Bacteria | 9294 |
| 181 | Ga0496109_1297132 | 3300048912 | Bacteria | 664 |
| 182 | Ga0496110_0067110 | 3300048913 | Bacteria | 3174 |
| 183 | Ga0496111_0109678 | 3300048914 | Bacteria | 2032 |
| 184 | Ga0496111_1296273 | 3300048914 | Bacteria | 513 |
| 185 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 186 | Ga0496112_0511690 | 3300048915 | Bacteria | 1136 |
| 187 | Ga0496113_0169780 | 3300048916 | Bacteria | 1727 |
| 188 | Ga0496114_0108339 | 3300048917 | Bacteria | 2378 |
| 189 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 190 | Ga0496115_0007479 | 3300048918 | Bacteria | 8039 |
| 191 | Ga0501040_0237225 | 3300049576 | Bacteria | 1299 |
| 192 | Ga0501042_0035701 | 3300049578 | Bacteria | 3527 |
| 193 | Ga0501042_0411854 | 3300049578 | Unclassified | 979 |
| 194 | Ga0501046_0898657 | 3300049580 | Bacteria | 618 |
| 195 | nmdc:mga03n38_116704_c1 | 3300050490 | Bacteria | 1307 |
| 196 | nmdc:mga03n38_141704_c1 | 3300050490 | Bacteria | 1201 |
| 197 | nmdc:mga00v17_123412_c1 | 3300050491 | Bacteria | 1651 |
| 198 | nmdc:mga00v17_987630_c1 | 3300050491 | Bacteria | 530 |
| 199 | nmdc:mga0yw44_304313_c1 | 3300050492 | Bacteria | 1068 |
| 200 | nmdc:mga05p37_90215_c1 | 3300050507 | Bacteria | 3777 |
| 201 | nmdc:mga06r32_97159_c1 | 3300050510 | Bacteria | 2886 |
| 202 | nmdc:mga08y16_1337123_c1 | 3300050511 | Bacteria | 682 |
| 203 | nmdc:mga0rr50_1638572_c1 | 3300050513 | Bacteria | 543 |
| 204 | nmdc:mga0a205_43_c1 | 3300050515 | Bacteria | 51209 |
| 205 | Ga0495601_0000158 | 3300053077 | Bacteria | 37317 |
| 206 | Ga0495601_0045379 | 3300053077 | Bacteria | 2763 |
| 207 | Ga0495601_0102824 | 3300053077 | Bacteria | 1846 |
| 208 | Ga0495601_0133973 | 3300053077 | Bacteria | 1615 |
| 209 | Ga0495601_0146300 | 3300053077 | Bacteria | 1542 |
| 210 | Ga0495601_0612422 | 3300053077 | Unclassified | 698 |
| 211 | Ga0495601_0643122 | 3300053077 | Bacteria | 679 |
| 212 | Ga0495612_0002488 | 3300053078 | Bacteria | 7598 |
| 213 | Ga0495612_0018285 | 3300053078 | Bacteria | 2808 |
| 214 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 215 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 216 | Ga0495619_0000320 | 3300053085 | Bacteria | 33623 |
| 217 | Ga0495619_0591973 | 3300053085 | Bacteria | 759 |
| 218 | Ga0500566_0059735 | 3300053094 | Bacteria | 2161 |
| 219 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10294076 | Ga0081455_102940761 | 63 |
| 2 | 3300038443 | Ga0395901_0297468 | Ga0395901_0297468_595_867 | 66 |
| 3 | 3300006038 | Ga0075365_10266418 | Ga0075365_102664181 | 67 |
| 4 | 3300006048 | Ga0075363_100055830 | Ga0075363_1000558302 | 67 |
| 5 | 3300050490 | nmdc:mga03n38_116704_c1 | nmdc:mga03n38_116704_c1_799_1071 | 67 |
| 6 | 3300050492 | nmdc:mga0yw44_304313_c1 | nmdc:mga0yw44_304313_c1_128_400 | 67 |
| 7 | 3300025927 | Ga0207687_10556304 | Ga0207687_105563042 | 68 |
| 8 | 3300037418 | Ga0395900_0100344 | Ga0395900_0100344_525_797 | 68 |
| 9 | 3300037418 | Ga0395900_1498112 | Ga0395900_1498112_187_459 | 68 |
| 10 | 3300037471 | Ga0395905_0135795 | Ga0395905_0135795_1915_2187 | 68 |
| 11 | 3300038443 | Ga0395901_0613909 | Ga0395901_0613909_244_516 | 68 |
| 12 | 3300046455 | Ga0495603_0112601 | Ga0495603_0112601_949_1221 | 68 |
| 13 | 3300047321 | Ga0495676_0356590 | Ga0495676_0356590_65_337 | 68 |
| 14 | 3300048912 | Ga0496109_1297132 | Ga0496109_1297132_297_569 | 68 |
| 15 | 3300005983 | Ga0081540_1191664 | Ga0081540_11916642 | 69 |
| 16 | 3300006048 | Ga0075363_100239388 | Ga0075363_1002393882 | 69 |
| 17 | 3300046810 | Ga0495660_0490128 | Ga0495660_0490128_104_376 | 69 |
| 18 | 3300050490 | nmdc:mga03n38_141704_c1 | nmdc:mga03n38_141704_c1_685_957 | 69 |
| 19 | 3300005718 | Ga0068866_10421409 | Ga0068866_104214092 | 70 |
| 20 | 3300005841 | Ga0068863_100016778 | Ga0068863_1000167783 | 70 |
| 21 | 3300005842 | Ga0068858_100000508 | Ga0068858_1000005083 | 70 |
| 22 | 3300006844 | Ga0075428_102523208 | Ga0075428_1025232082 | 70 |
| 23 | 3300009093 | Ga0105240_10851304 | Ga0105240_108513042 | 70 |
| 24 | 3300025899 | Ga0207642_10335904 | Ga0207642_103359042 | 70 |
| 25 | 3300026035 | Ga0207703_10000385 | Ga0207703_100003858 | 70 |
| 26 | 3300026088 | Ga0207641_10005911 | Ga0207641_100059113 | 70 |
| 27 | 3300037466 | Ga0395898_0158758 | Ga0395898_0158758_476_748 | 70 |
| 28 | 3300038443 | Ga0395901_0049716 | Ga0395901_0049716_977_1249 | 70 |
| 29 | 3300041505 | Ga0451849_1037714 | Ga0451849_1037714_149_415 | 70 |
| 30 | 3300046454 | Ga0495592_0110334 | Ga0495592_0110334_782_1069 | 70 |
| 31 | 3300046459 | Ga0495629_0093927 | Ga0495629_0093927_802_1068 | 70 |
| 32 | 3300046514 | Ga0495618_0304635 | Ga0495618_0304635_439_726 | 70 |
| 33 | 3300046514 | Ga0495618_0456262 | Ga0495618_0456262_477_743 | 70 |
| 34 | 3300046516 | Ga0495628_0011208 | Ga0495628_0011208_1560_1856 | 70 |
| 35 | 3300046529 | Ga0495652_0011070 | Ga0495652_0011070_3795_4091 | 70 |
| 36 | 3300046543 | Ga0495645_0008969 | Ga0495645_0008969_4183_4479 | 70 |
| 37 | 3300053077 | Ga0495601_0133973 | Ga0495601_0133973_765_1061 | 70 |
| 38 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_142284_142550 | 70 |
| 39 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_230953_231219 | 70 |
| 40 | 3300006163 | Ga0070715_10000029 | Ga0070715_100000296 | 71 |
| 41 | 3300006237 | Ga0097621_100548549 | Ga0097621_1005485492 | 71 |
| 42 | 3300006358 | Ga0068871_100618854 | Ga0068871_1006188541 | 71 |
| 43 | 3300013308 | Ga0157375_10003797 | Ga0157375_100037974 | 71 |
| 44 | 3300025905 | Ga0207685_10000054 | Ga0207685_100000544 | 71 |
| 45 | 3300028556 | Ga0265337_1000066 | Ga0265337_100006611 | 71 |
| 46 | 3300028558 | Ga0265326_10000019 | Ga0265326_10000019131 | 71 |
| 47 | 3300028563 | Ga0265319_1229914 | Ga0265319_12299142 | 71 |
| 48 | 3300028573 | Ga0265334_10072981 | Ga0265334_100729812 | 71 |
| 49 | 3300028654 | Ga0265322_10000011 | Ga0265322_10000011131 | 71 |
| 50 | 3300028666 | Ga0265336_10062495 | Ga0265336_100624952 | 71 |
| 51 | 3300028800 | Ga0265338_10259892 | Ga0265338_102598922 | 71 |
| 52 | 3300029957 | Ga0265324_10000283 | Ga0265324_1000028313 | 71 |
| 53 | 3300031235 | Ga0265330_10151780 | Ga0265330_101517802 | 71 |
| 54 | 3300031239 | Ga0265328_10003099 | Ga0265328_100030992 | 71 |
| 55 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011131 | 71 |
| 56 | 3300031242 | Ga0265329_10100362 | Ga0265329_101003621 | 71 |
| 57 | 3300031250 | Ga0265331_10000858 | Ga0265331_100008589 | 71 |
| 58 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015239 | 71 |
| 59 | 3300031711 | Ga0265314_10003522 | Ga0265314_100035223 | 71 |
| 60 | 3300031712 | Ga0265342_10072828 | Ga0265342_100728282 | 71 |
| 61 | 3300041486 | Ga0451807_0339460 | Ga0451807_0339460_178_444 | 71 |
| 62 | 3300046559 | Ga0495667_0162551 | Ga0495667_0162551_478_744 | 71 |
| 63 | 3300006038 | Ga0075365_10034615 | Ga0075365_100346152 | 72 |
| 64 | 3300006051 | Ga0075364_10202783 | Ga0075364_102027832 | 72 |
| 65 | 3300006173 | Ga0070716_101831203 | Ga0070716_1018312032 | 72 |
| 66 | 3300013308 | Ga0157375_11170361 | Ga0157375_111703611 | 72 |
| 67 | 3300025904 | Ga0207647_10164778 | Ga0207647_101647782 | 72 |
| 68 | 3300025939 | Ga0207665_11502518 | Ga0207665_115025182 | 72 |
| 69 | 3300026121 | Ga0207683_10548061 | Ga0207683_105480612 | 72 |
| 70 | 3300028379 | Ga0268266_10262479 | Ga0268266_102624792 | 72 |
| 71 | 3300041486 | Ga0451807_1653004 | Ga0451807_1653004_33_299 | 72 |
| 72 | 3300046462 | Ga0495651_0061533 | Ga0495651_0061533_734_1000 | 72 |
| 73 | 3300046517 | Ga0495630_0002818 | Ga0495630_0002818_4237_4503 | 72 |
| 74 | 3300047322 | Ga0495680_0000143 | Ga0495680_0000143_18424_18690 | 72 |
| 75 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_122101_122367 | 72 |
| 76 | 3300048918 | Ga0496115_0007479 | Ga0496115_0007479_3048_3311 | 72 |
| 77 | 3300050491 | nmdc:mga00v17_123412_c1 | nmdc:mga00v17_123412_c1_1127_1393 | 72 |
| 78 | 3300053077 | Ga0495601_0612422 | Ga0495601_0612422_147_413 | 72 |
| 79 | 3300009147 | Ga0114129_10531086 | Ga0114129_105310862 | 73 |
| 80 | 3300025908 | Ga0207643_10854289 | Ga0207643_108542892 | 73 |
| 81 | 3300027907 | Ga0207428_11062583 | Ga0207428_110625831 | 73 |
| 82 | 3300041460 | Ga0451802_1824591 | Ga0451802_1824591_143_406 | 73 |
| 83 | 3300046681 | Ga0495647_0018607 | Ga0495647_0018607_1436_1702 | 73 |
| 84 | 3300050491 | nmdc:mga00v17_987630_c1 | nmdc:mga00v17_987630_c1_244_519 | 73 |
| 85 | 3300050507 | nmdc:mga05p37_90215_c1 | nmdc:mga05p37_90215_c1_1573_1845 | 73 |
| 86 | 3300050511 | nmdc:mga08y16_1337123_c1 | nmdc:mga08y16_1337123_c1_116_388 | 73 |
| 87 | 3300005455 | Ga0070663_100069149 | Ga0070663_1000691493 | 74 |
| 88 | 3300026067 | Ga0207678_10124980 | Ga0207678_101249802 | 74 |
| 89 | 3300047317 | Ga0495604_0000067 | Ga0495604_0000067_89277_89549 | 74 |
| 90 | 3300049578 | Ga0501042_0035701 | Ga0501042_0035701_380_655 | 74 |
| 91 | 3300046454 | Ga0495592_0186188 | Ga0495592_0186188_626_895 | 75 |
| 92 | 3300046663 | Ga0495635_0000031 | Ga0495635_0000031_104946_105212 | 75 |
| 93 | 3300046675 | Ga0495657_0226689 | Ga0495657_0226689_479_745 | 75 |
| 94 | 3300046678 | Ga0495599_0687303 | Ga0495599_0687303_43_309 | 75 |
| 95 | 3300005985 | Ga0081539_10012453 | Ga0081539_100124534 | 77 |
| 96 | 3300006175 | Ga0070712_101876069 | Ga0070712_1018760692 | 78 |
| 97 | 3300028381 | Ga0268264_11749384 | Ga0268264_117493841 | 78 |
| 98 | 3300030521 | Ga0307511_10061741 | Ga0307511_100617412 | 78 |
| 99 | 3300044694 | Ga0466963_0010038 | Ga0466963_0010038_3933_4196 | 78 |
| 100 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_54774_55037 | 78 |
| 101 | 3300046642 | Ga0495634_0000111 | Ga0495634_0000111_722_985 | 78 |
| 102 | 3300046663 | Ga0495635_0136602 | Ga0495635_0136602_494_757 | 78 |
| 103 | 3300047322 | Ga0495680_0007905 | Ga0495680_0007905_5751_6014 | 78 |
| 104 | 3300048089 | Ga0495614_0298199 | Ga0495614_0298199_146_409 | 78 |
| 105 | 3300049576 | Ga0501040_0237225 | Ga0501040_0237225_946_1209 | 78 |
| 106 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_180775_181038 | 78 |
| 107 | 3300002074 | JGI24748J21848_1001803 | JGI24748J21848_10018032 | 79 |
| 108 | 3300002239 | JGI24034J26672_10002280 | JGI24034J26672_100022802 | 79 |
| 109 | 3300002244 | JGI24742J22300_10010708 | JGI24742J22300_100107082 | 79 |
| 110 | 3300005341 | Ga0070691_10000524 | Ga0070691_100005244 | 79 |
| 111 | 3300005367 | Ga0070667_100105540 | Ga0070667_1001055402 | 79 |
| 112 | 3300005439 | Ga0070711_100016210 | Ga0070711_1000162103 | 79 |
| 113 | 3300005456 | Ga0070678_100138883 | Ga0070678_1001388832 | 79 |
| 114 | 3300005456 | Ga0070678_100756752 | Ga0070678_1007567522 | 79 |
| 115 | 3300005548 | Ga0070665_100508699 | Ga0070665_1005086992 | 79 |
| 116 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003288 | 79 |
| 117 | 3300005718 | Ga0068866_10001583 | Ga0068866_100015834 | 79 |
| 118 | 3300005843 | Ga0068860_100004743 | Ga0068860_10000474311 | 79 |
| 119 | 3300005843 | Ga0068860_102116959 | Ga0068860_1021169591 | 79 |
| 120 | 3300005937 | Ga0081455_10595011 | Ga0081455_105950111 | 79 |
| 121 | 3300006847 | Ga0075431_100050709 | Ga0075431_1000507094 | 79 |
| 122 | 3300006881 | Ga0068865_100633343 | Ga0068865_1006333432 | 79 |
| 123 | 3300007076 | Ga0075435_101763329 | Ga0075435_1017633292 | 79 |
| 124 | 3300009098 | Ga0105245_10006201 | Ga0105245_100062013 | 79 |
| 125 | 3300009098 | Ga0105245_12754484 | Ga0105245_127544841 | 79 |
| 126 | 3300009148 | Ga0105243_10046930 | Ga0105243_100469302 | 79 |
| 127 | 3300009148 | Ga0105243_10508117 | Ga0105243_105081172 | 79 |
| 128 | 3300009176 | Ga0105242_10123196 | Ga0105242_101231962 | 79 |
| 129 | 3300010375 | Ga0105239_10133047 | Ga0105239_101330472 | 79 |
| 130 | 3300010375 | Ga0105239_10306236 | Ga0105239_103062361 | 79 |
| 131 | 3300013104 | Ga0157370_10022403 | Ga0157370_100224034 | 79 |
| 132 | 3300013296 | Ga0157374_10032041 | Ga0157374_100320412 | 79 |
| 133 | 3300013306 | Ga0163162_12038267 | Ga0163162_120382671 | 79 |
| 134 | 3300014325 | Ga0163163_11028760 | Ga0163163_110287602 | 79 |
| 135 | 3300014969 | Ga0157376_12088117 | Ga0157376_120881172 | 79 |
| 136 | 3300017792 | Ga0163161_11482038 | Ga0163161_114820381 | 79 |
| 137 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002538 | 79 |
| 138 | 3300025899 | Ga0207642_10000080 | Ga0207642_1000008021 | 79 |
| 139 | 3300025915 | Ga0207693_11106168 | Ga0207693_111061681 | 79 |
| 140 | 3300025916 | Ga0207663_10003583 | Ga0207663_100035832 | 79 |
| 141 | 3300025927 | Ga0207687_10346587 | Ga0207687_103465872 | 79 |
| 142 | 3300025929 | Ga0207664_10159182 | Ga0207664_101591822 | 79 |
| 143 | 3300025934 | Ga0207686_10043320 | Ga0207686_100433202 | 79 |
| 144 | 3300025935 | Ga0207709_10034680 | Ga0207709_100346802 | 79 |
| 145 | 3300025937 | Ga0207669_10000001 | Ga0207669_100000014 | 79 |
| 146 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001710 | 79 |
| 147 | 3300025938 | Ga0207704_10396295 | Ga0207704_103962952 | 79 |
| 148 | 3300025939 | Ga0207665_10510124 | Ga0207665_105101242 | 79 |
| 149 | 3300025986 | Ga0207658_10157658 | Ga0207658_101576582 | 79 |
| 150 | 3300026067 | Ga0207678_10195232 | Ga0207678_101952322 | 79 |
| 151 | 3300026121 | Ga0207683_10139677 | Ga0207683_101396772 | 79 |
| 152 | 3300028381 | Ga0268264_10002435 | Ga0268264_100024355 | 79 |
| 153 | 3300035172 | Ga0373955_0239168 | Ga0373955_0239168_508_774 | 79 |
| 154 | 3300041460 | Ga0451802_0657914 | Ga0451802_0657914_160_426 | 79 |
| 155 | 3300045976 | Ga0466967_0111517 | Ga0466967_0111517_1949_2215 | 79 |
| 156 | 3300045976 | Ga0466967_0333480 | Ga0466967_0333480_1161_1427 | 79 |
| 157 | 3300046454 | Ga0495592_0001152 | Ga0495592_0001152_800_1066 | 79 |
| 158 | 3300046454 | Ga0495592_0423245 | Ga0495592_0423245_92_361 | 79 |
| 159 | 3300046455 | Ga0495603_0004009 | Ga0495603_0004009_7809_8075 | 79 |
| 160 | 3300046459 | Ga0495629_0010707 | Ga0495629_0010707_712_978 | 79 |
| 161 | 3300046459 | Ga0495629_0688366 | Ga0495629_0688366_62_328 | 79 |
| 162 | 3300046459 | Ga0495629_1032575 | Ga0495629_1032575_66_335 | 79 |
| 163 | 3300046462 | Ga0495651_0095765 | Ga0495651_0095765_925_1191 | 79 |
| 164 | 3300046463 | Ga0495653_0035887 | Ga0495653_0035887_545_811 | 79 |
| 165 | 3300046463 | Ga0495653_0057544 | Ga0495653_0057544_1371_1637 | 79 |
| 166 | 3300046463 | Ga0495653_0187720 | Ga0495653_0187720_201_467 | 79 |
| 167 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_33856_34122 | 79 |
| 168 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_101555_101821 | 79 |
| 169 | 3300046515 | Ga0495620_0239835 | Ga0495620_0239835_203_469 | 79 |
| 170 | 3300046516 | Ga0495628_0082388 | Ga0495628_0082388_744_1010 | 79 |
| 171 | 3300046517 | Ga0495630_0017930 | Ga0495630_0017930_1702_1968 | 79 |
| 172 | 3300046529 | Ga0495652_0040875 | Ga0495652_0040875_446_712 | 79 |
| 173 | 3300046533 | Ga0495640_0023616 | Ga0495640_0023616_3454_3720 | 79 |
| 174 | 3300046536 | Ga0495587_0035965 | Ga0495587_0035965_2565_2834 | 79 |
| 175 | 3300046537 | Ga0495598_0008120 | Ga0495598_0008120_1902_2168 | 79 |
| 176 | 3300046539 | Ga0495621_0065322 | Ga0495621_0065322_790_1059 | 79 |
| 177 | 3300046616 | Ga0495668_0028721 | Ga0495668_0028721_759_1025 | 79 |
| 178 | 3300046663 | Ga0495635_0313973 | Ga0495635_0313973_367_633 | 79 |
| 179 | 3300046675 | Ga0495657_0121268 | Ga0495657_0121268_378_644 | 79 |
| 180 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_49505_49771 | 79 |
| 181 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_120883_121149 | 79 |
| 182 | 3300046690 | Ga0495624_0000019 | Ga0495624_0000019_39428_39697 | 79 |
| 183 | 3300046690 | Ga0495624_0131163 | Ga0495624_0131163_771_1037 | 79 |
| 184 | 3300046690 | Ga0495624_0509208 | Ga0495624_0509208_300_566 | 79 |
| 185 | 3300046809 | Ga0495600_0004207 | Ga0495600_0004207_6518_6784 | 79 |
| 186 | 3300046809 | Ga0495600_0253364 | Ga0495600_0253364_544_810 | 79 |
| 187 | 3300047317 | Ga0495604_0153398 | Ga0495604_0153398_63_332 | 79 |
| 188 | 3300047319 | Ga0495674_1144714 | Ga0495674_1144714_250_516 | 79 |
| 189 | 3300047321 | Ga0495676_0266135 | Ga0495676_0266135_589_855 | 79 |
| 190 | 3300047322 | Ga0495680_0328302 | Ga0495680_0328302_682_948 | 79 |
| 191 | 3300047471 | Ga0495684_0264384 | Ga0495684_0264384_40_306 | 79 |
| 192 | 3300047673 | Ga0495593_0518242 | Ga0495593_0518242_180_449 | 79 |
| 193 | 3300048905 | Ga0496102_0705334 | Ga0496102_0705334_233_502 | 79 |
| 194 | 3300048907 | Ga0496104_0000765 | Ga0496104_0000765_15688_15954 | 79 |
| 195 | 3300048908 | Ga0496105_0000409 | Ga0496105_0000409_2828_3094 | 79 |
| 196 | 3300048909 | Ga0496106_0000030 | Ga0496106_0000030_759_1025 | 79 |
| 197 | 3300048911 | Ga0496108_0006747 | Ga0496108_0006747_113_379 | 79 |
| 198 | 3300048913 | Ga0496110_0067110 | Ga0496110_0067110_1957_2226 | 79 |
| 199 | 3300048914 | Ga0496111_0109678 | Ga0496111_0109678_1188_1457 | 79 |
| 200 | 3300048914 | Ga0496111_1296273 | Ga0496111_1296273_32_304 | 79 |
| 201 | 3300048915 | Ga0496112_0511690 | Ga0496112_0511690_708_974 | 79 |
| 202 | 3300048916 | Ga0496113_0169780 | Ga0496113_0169780_763_1029 | 79 |
| 203 | 3300048917 | Ga0496114_0108339 | Ga0496114_0108339_889_1155 | 79 |
| 204 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_117215_117481 | 79 |
| 205 | 3300049578 | Ga0501042_0411854 | Ga0501042_0411854_258_527 | 79 |
| 206 | 3300049580 | Ga0501046_0898657 | Ga0501046_0898657_71_337 | 79 |
| 207 | 3300050510 | nmdc:mga06r32_97159_c1 | nmdc:mga06r32_97159_c1_373_642 | 79 |
| 208 | 3300050513 | nmdc:mga0rr50_1638572_c1 | nmdc:mga0rr50_1638572_c1_65_331 | 79 |
| 209 | 3300050515 | nmdc:mga0a205_43_c1 | nmdc:mga0a205_43_c1_35259_35525 | 79 |
| 210 | 3300053077 | Ga0495601_0000158 | Ga0495601_0000158_14421_14687 | 79 |
| 211 | 3300053077 | Ga0495601_0045379 | Ga0495601_0045379_1499_1765 | 79 |
| 212 | 3300053077 | Ga0495601_0102824 | Ga0495601_0102824_721_987 | 79 |
| 213 | 3300053077 | Ga0495601_0146300 | Ga0495601_0146300_744_1010 | 79 |
| 214 | 3300053077 | Ga0495601_0643122 | Ga0495601_0643122_317_583 | 79 |
| 215 | 3300053078 | Ga0495612_0002488 | Ga0495612_0002488_1447_1713 | 79 |
| 216 | 3300053078 | Ga0495612_0018285 | Ga0495612_0018285_296_562 | 79 |
| 217 | 3300053085 | Ga0495619_0000320 | Ga0495619_0000320_1902_2168 | 79 |
| 218 | 3300053085 | Ga0495619_0591973 | Ga0495619_0591973_432_698 | 79 |
| 219 | 3300053094 | Ga0500566_0059735 | Ga0500566_0059735_696_962 | 79 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar