F330911

General Info

Members Datasets Scaffolds Average Seq Length
219 152 219 83

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10595011|Ga0081455_105950111
Length 90
Sequence MAALVWFTMGVALWHFTVFVPDRFWGGIVGAFLGSTAGGMVSGTIAQIALGQGIGETDLATALYAVPGCLLGLAIVYGVGVRSGVEAEHI

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
104 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
152 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 8.68
Rhizosphere 84.93
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1001803 3300002074 Bacteria 2378
2 JGI24034J26672_10002280 3300002239 Bacteria 2623
3 JGI24742J22300_10010708 3300002244 Unclassified 1519
4 Ga0070691_10000524 3300005341 Bacteria 14453
5 Ga0070667_100105540 3300005367 Bacteria 2438
6 Ga0070711_100016210 3300005439 Bacteria 4729
7 Ga0070663_100069149 3300005455 Bacteria 2565
8 Ga0070678_100138883 3300005456 Bacteria 1942
9 Ga0070678_100756752 3300005456 Bacteria 879
10 Ga0070665_100508699 3300005548 Bacteria 1216
11 Ga0068866_10000003 3300005718 Bacteria 281675
12 Ga0068866_10001583 3300005718 Bacteria 9651
13 Ga0068866_10421409 3300005718 Bacteria 866
14 Ga0068863_100016778 3300005841 Bacteria 7026
15 Ga0068858_100000508 3300005842 Bacteria 40801
16 Ga0068860_100004743 3300005843 Bacteria 13853
17 Ga0068860_102116959 3300005843 Bacteria 584
18 Ga0081455_10294076 3300005937 Bacteria 1168
19 Ga0081455_10595011 3300005937 Bacteria 722
20 Ga0081540_1191664 3300005983 Bacteria 753
21 Ga0081539_10012453 3300005985 Bacteria 6554
22 Ga0075365_10034615 3300006038 Bacteria 3262
23 Ga0075365_10266418 3300006038 Bacteria 1205
24 Ga0075363_100055830 3300006048 Bacteria 2116
25 Ga0075363_100239388 3300006048 Bacteria 1043
26 Ga0075364_10202783 3300006051 Bacteria 1345
27 Ga0070715_10000029 3300006163 Bacteria 88994
28 Ga0070716_101831203 3300006173 Bacteria 503
29 Ga0070712_101876069 3300006175 Bacteria 525
30 Ga0097621_100548549 3300006237 Bacteria 1052
31 Ga0068871_100618854 3300006358 Unclassified 986
32 Ga0075428_102523208 3300006844 Unclassified 526
33 Ga0075431_100050709 3300006847 Bacteria 4279
34 Ga0068865_100633343 3300006881 Bacteria 907
35 Ga0075435_101763329 3300007076 Bacteria 543
36 Ga0105240_10851304 3300009093 Bacteria 984
37 Ga0105245_10006201 3300009098 Bacteria 10517
38 Ga0105245_12754484 3300009098 Bacteria 544
39 Ga0114129_10531086 3300009147 Bacteria 1533
40 Ga0105243_10046930 3300009148 Bacteria 3399
41 Ga0105243_10508117 3300009148 Unclassified 1143
42 Ga0105242_10123196 3300009176 Bacteria 2228
43 Ga0105239_10133047 3300010375 Bacteria 2767
44 Ga0105239_10306236 3300010375 Bacteria 1790
45 Ga0157370_10022403 3300013104 Bacteria 6286
46 Ga0157374_10032041 3300013296 Bacteria 4783
47 Ga0163162_12038267 3300013306 Bacteria 658
48 Ga0157375_10003797 3300013308 Bacteria 13096
49 Ga0157375_11170361 3300013308 Bacteria 901
50 Ga0163163_11028760 3300014325 Bacteria 887
51 Ga0157376_12088117 3300014969 Unclassified 605
52 Ga0163161_11482038 3300017792 Bacteria 595
53 Ga0207642_10000002 3300025899 Bacteria 658166
54 Ga0207642_10000080 3300025899 Bacteria 25169
55 Ga0207642_10335904 3300025899 Bacteria 887
56 Ga0207647_10164778 3300025904 Bacteria 1292
57 Ga0207685_10000054 3300025905 Bacteria 35900
58 Ga0207643_10854289 3300025908 Bacteria 590
59 Ga0207693_11106168 3300025915 Bacteria 602
60 Ga0207663_10003583 3300025916 Bacteria 7620
61 Ga0207687_10346587 3300025927 Bacteria 1209
62 Ga0207687_10556304 3300025927 Bacteria 963
63 Ga0207664_10159182 3300025929 Bacteria 1925
64 Ga0207686_10043320 3300025934 Bacteria 2757
65 Ga0207709_10034680 3300025935 Bacteria 2976
66 Ga0207669_10000001 3300025937 Bacteria 377747
67 Ga0207669_10000017 3300025937 Bacteria 119878
68 Ga0207704_10396295 3300025938 Bacteria 1088
69 Ga0207665_10510124 3300025939 Unclassified 930
70 Ga0207665_11502518 3300025939 Unclassified 535
71 Ga0207658_10157658 3300025986 Bacteria 1857
72 Ga0207703_10000385 3300026035 Bacteria 47298
73 Ga0207678_10124980 3300026067 Bacteria 2195
74 Ga0207678_10195232 3300026067 Bacteria 1730
75 Ga0207641_10005911 3300026088 Bacteria 10379
76 Ga0207683_10139677 3300026121 Bacteria 2182
77 Ga0207683_10548061 3300026121 Bacteria 1069
78 Ga0207428_11062583 3300027907 Bacteria 567
79 Ga0268266_10262479 3300028379 Bacteria 1601
80 Ga0268264_10002435 3300028381 Bacteria 16359
81 Ga0268264_11749384 3300028381 Unclassified 632
82 Ga0265337_1000066 3300028556 Bacteria 48673
83 Ga0265326_10000019 3300028558 Bacteria 137370
84 Ga0265319_1229914 3300028563 Bacteria 566
85 Ga0265334_10072981 3300028573 Bacteria 1275
86 Ga0265322_10000011 3300028654 Bacteria 167597
87 Ga0265336_10062495 3300028666 Bacteria 1116
88 Ga0265338_10259892 3300028800 Bacteria 1277
89 Ga0265324_10000283 3300029957 Bacteria 37587
90 Ga0307511_10061741 3300030521 Bacteria 2852
91 Ga0265330_10151780 3300031235 Bacteria 984
92 Ga0265328_10003099 3300031239 Bacteria 7416
93 Ga0265320_10000011 3300031240 Bacteria 249534
94 Ga0265329_10100362 3300031242 Bacteria 921
95 Ga0265331_10000858 3300031250 Bacteria 24739
96 Ga0265327_10000015 3300031251 Bacteria 496677
97 Ga0265314_10003522 3300031711 Bacteria 15112
98 Ga0265342_10072828 3300031712 Bacteria 1999
99 Ga0373955_0239168 3300035172 Unclassified 1087
100 Ga0395900_0100344 3300037418 Bacteria 2974
101 Ga0395900_1498112 3300037418 Bacteria 587
102 Ga0395898_0158758 3300037466 Bacteria 2163
103 Ga0395905_0135795 3300037471 Bacteria 2314
104 Ga0395901_0049716 3300038443 Bacteria 4357
105 Ga0395901_0297468 3300038443 Bacteria 1674
106 Ga0395901_0613909 3300038443 Bacteria 1095
107 Ga0451802_0657914 3300041460 Bacteria 510
108 Ga0451802_1824591 3300041460 Unclassified 777
109 Ga0451807_0339460 3300041486 Bacteria 639
110 Ga0451807_1653004 3300041486 Bacteria 738
111 Ga0451849_1037714 3300041505 Bacteria 1045
112 Ga0466963_0010038 3300044694 Bacteria 5724
113 Ga0466967_0111517 3300045976 Bacteria 2514
114 Ga0466967_0333480 3300045976 Bacteria 1465
115 Ga0495592_0001152 3300046454 Bacteria 18343
116 Ga0495592_0110334 3300046454 Bacteria 1947
117 Ga0495592_0186188 3300046454 Unclassified 1410
118 Ga0495592_0423245 3300046454 Bacteria 839
119 Ga0495603_0004009 3300046455 Bacteria 8766
120 Ga0495603_0112601 3300046455 Bacteria 1587
121 Ga0495629_0010707 3300046459 Bacteria 6669
122 Ga0495629_0093927 3300046459 Bacteria 2093
123 Ga0495629_0688366 3300046459 Bacteria 679
124 Ga0495629_1032575 3300046459 Bacteria 534
125 Ga0495651_0061533 3300046462 Bacteria 2873
126 Ga0495651_0095765 3300046462 Bacteria 2219
127 Ga0495653_0035887 3300046463 Bacteria 3910
128 Ga0495653_0057544 3300046463 Bacteria 2958
129 Ga0495653_0187720 3300046463 Bacteria 1413
130 Ga0495662_0000001 3300046476 Bacteria 179185
131 Ga0495618_0000014 3300046514 Bacteria 163136
132 Ga0495618_0304635 3300046514 Bacteria 990
133 Ga0495618_0456262 3300046514 Bacteria 775
134 Ga0495620_0239835 3300046515 Bacteria 692
135 Ga0495628_0011208 3300046516 Bacteria 7585
136 Ga0495628_0082388 3300046516 Bacteria 2499
137 Ga0495630_0002818 3300046517 Bacteria 12049
138 Ga0495630_0017930 3300046517 Bacteria 5193
139 Ga0495652_0011070 3300046529 Bacteria 8173
140 Ga0495652_0040875 3300046529 Bacteria 4007
141 Ga0495640_0023616 3300046533 Bacteria 4475
142 Ga0495587_0035965 3300046536 Bacteria 2981
143 Ga0495598_0008120 3300046537 Bacteria 2434
144 Ga0495621_0065322 3300046539 Unclassified 1329
145 Ga0495645_0008969 3300046543 Bacteria 6986
146 Ga0495667_0000020 3300046559 Bacteria 180876
147 Ga0495667_0162551 3300046559 Bacteria 1436
148 Ga0495668_0028721 3300046616 Bacteria 3145
149 Ga0495634_0000111 3300046642 Bacteria 67891
150 Ga0495635_0000031 3300046663 Bacteria 110244
151 Ga0495635_0136602 3300046663 Bacteria 1671
152 Ga0495635_0313973 3300046663 Bacteria 1050
153 Ga0495657_0121268 3300046675 Bacteria 1646
154 Ga0495657_0226689 3300046675 Bacteria 1131
155 Ga0495599_0687303 3300046678 Bacteria 591
156 Ga0495647_0000001 3300046681 Bacteria 222371
157 Ga0495647_0018607 3300046681 Bacteria 2475
158 Ga0495613_0000005 3300046689 Bacteria 222558
159 Ga0495624_0000019 3300046690 Bacteria 102237
160 Ga0495624_0131163 3300046690 Bacteria 1536
161 Ga0495624_0509208 3300046690 Bacteria 720
162 Ga0495600_0004207 3300046809 Bacteria 8590
163 Ga0495600_0253364 3300046809 Bacteria 1119
164 Ga0495660_0490128 3300046810 Unclassified 527
165 Ga0495604_0000067 3300047317 Bacteria 90345
166 Ga0495604_0153398 3300047317 Bacteria 1634
167 Ga0495674_1144714 3300047319 Bacteria 590
168 Ga0495676_0266135 3300047321 Bacteria 1165
169 Ga0495676_0356590 3300047321 Bacteria 977
170 Ga0495680_0000143 3300047322 Bacteria 71946
171 Ga0495680_0007905 3300047322 Bacteria 9704
172 Ga0495680_0328302 3300047322 Bacteria 1069
173 Ga0495684_0264384 3300047471 Bacteria 1247
174 Ga0495593_0518242 3300047673 Bacteria 598
175 Ga0495614_0298199 3300048089 Bacteria 744
176 Ga0496102_0705334 3300048905 Bacteria 932
177 Ga0496104_0000765 3300048907 Bacteria 27516
178 Ga0496105_0000409 3300048908 Bacteria 28168
179 Ga0496106_0000030 3300048909 Bacteria 136804
180 Ga0496108_0006747 3300048911 Bacteria 9294
181 Ga0496109_1297132 3300048912 Bacteria 664
182 Ga0496110_0067110 3300048913 Bacteria 3174
183 Ga0496111_0109678 3300048914 Bacteria 2032
184 Ga0496111_1296273 3300048914 Bacteria 513
185 Ga0496112_0000025 3300048915 Bacteria 146197
186 Ga0496112_0511690 3300048915 Bacteria 1136
187 Ga0496113_0169780 3300048916 Bacteria 1727
188 Ga0496114_0108339 3300048917 Bacteria 2378
189 Ga0496115_0000011 3300048918 Bacteria 222529
190 Ga0496115_0007479 3300048918 Bacteria 8039
191 Ga0501040_0237225 3300049576 Bacteria 1299
192 Ga0501042_0035701 3300049578 Bacteria 3527
193 Ga0501042_0411854 3300049578 Unclassified 979
194 Ga0501046_0898657 3300049580 Bacteria 618
195 nmdc:mga03n38_116704_c1 3300050490 Bacteria 1307
196 nmdc:mga03n38_141704_c1 3300050490 Bacteria 1201
197 nmdc:mga00v17_123412_c1 3300050491 Bacteria 1651
198 nmdc:mga00v17_987630_c1 3300050491 Bacteria 530
199 nmdc:mga0yw44_304313_c1 3300050492 Bacteria 1068
200 nmdc:mga05p37_90215_c1 3300050507 Bacteria 3777
201 nmdc:mga06r32_97159_c1 3300050510 Bacteria 2886
202 nmdc:mga08y16_1337123_c1 3300050511 Bacteria 682
203 nmdc:mga0rr50_1638572_c1 3300050513 Bacteria 543
204 nmdc:mga0a205_43_c1 3300050515 Bacteria 51209
205 Ga0495601_0000158 3300053077 Bacteria 37317
206 Ga0495601_0045379 3300053077 Bacteria 2763
207 Ga0495601_0102824 3300053077 Bacteria 1846
208 Ga0495601_0133973 3300053077 Bacteria 1615
209 Ga0495601_0146300 3300053077 Bacteria 1542
210 Ga0495601_0612422 3300053077 Unclassified 698
211 Ga0495601_0643122 3300053077 Bacteria 679
212 Ga0495612_0002488 3300053078 Bacteria 7598
213 Ga0495612_0018285 3300053078 Bacteria 2808
214 Ga0495655_0000002 3300053083 Bacteria 312752
215 Ga0495619_0000008 3300053085 Bacteria 305999
216 Ga0495619_0000320 3300053085 Bacteria 33623
217 Ga0495619_0591973 3300053085 Bacteria 759
218 Ga0500566_0059735 3300053094 Bacteria 2161
219 Ga0500628_000001 3300053129 Bacteria 564074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10294076 Ga0081455_102940761 63
2 3300038443 Ga0395901_0297468 Ga0395901_0297468_595_867 66
3 3300006038 Ga0075365_10266418 Ga0075365_102664181 67
4 3300006048 Ga0075363_100055830 Ga0075363_1000558302 67
5 3300050490 nmdc:mga03n38_116704_c1 nmdc:mga03n38_116704_c1_799_1071 67
6 3300050492 nmdc:mga0yw44_304313_c1 nmdc:mga0yw44_304313_c1_128_400 67
7 3300025927 Ga0207687_10556304 Ga0207687_105563042 68
8 3300037418 Ga0395900_0100344 Ga0395900_0100344_525_797 68
9 3300037418 Ga0395900_1498112 Ga0395900_1498112_187_459 68
10 3300037471 Ga0395905_0135795 Ga0395905_0135795_1915_2187 68
11 3300038443 Ga0395901_0613909 Ga0395901_0613909_244_516 68
12 3300046455 Ga0495603_0112601 Ga0495603_0112601_949_1221 68
13 3300047321 Ga0495676_0356590 Ga0495676_0356590_65_337 68
14 3300048912 Ga0496109_1297132 Ga0496109_1297132_297_569 68
15 3300005983 Ga0081540_1191664 Ga0081540_11916642 69
16 3300006048 Ga0075363_100239388 Ga0075363_1002393882 69
17 3300046810 Ga0495660_0490128 Ga0495660_0490128_104_376 69
18 3300050490 nmdc:mga03n38_141704_c1 nmdc:mga03n38_141704_c1_685_957 69
19 3300005718 Ga0068866_10421409 Ga0068866_104214092 70
20 3300005841 Ga0068863_100016778 Ga0068863_1000167783 70
21 3300005842 Ga0068858_100000508 Ga0068858_1000005083 70
22 3300006844 Ga0075428_102523208 Ga0075428_1025232082 70
23 3300009093 Ga0105240_10851304 Ga0105240_108513042 70
24 3300025899 Ga0207642_10335904 Ga0207642_103359042 70
25 3300026035 Ga0207703_10000385 Ga0207703_100003858 70
26 3300026088 Ga0207641_10005911 Ga0207641_100059113 70
27 3300037466 Ga0395898_0158758 Ga0395898_0158758_476_748 70
28 3300038443 Ga0395901_0049716 Ga0395901_0049716_977_1249 70
29 3300041505 Ga0451849_1037714 Ga0451849_1037714_149_415 70
30 3300046454 Ga0495592_0110334 Ga0495592_0110334_782_1069 70
31 3300046459 Ga0495629_0093927 Ga0495629_0093927_802_1068 70
32 3300046514 Ga0495618_0304635 Ga0495618_0304635_439_726 70
33 3300046514 Ga0495618_0456262 Ga0495618_0456262_477_743 70
34 3300046516 Ga0495628_0011208 Ga0495628_0011208_1560_1856 70
35 3300046529 Ga0495652_0011070 Ga0495652_0011070_3795_4091 70
36 3300046543 Ga0495645_0008969 Ga0495645_0008969_4183_4479 70
37 3300053077 Ga0495601_0133973 Ga0495601_0133973_765_1061 70
38 3300053083 Ga0495655_0000002 Ga0495655_0000002_142284_142550 70
39 3300053129 Ga0500628_000001 Ga0500628_000001_230953_231219 70
40 3300006163 Ga0070715_10000029 Ga0070715_100000296 71
41 3300006237 Ga0097621_100548549 Ga0097621_1005485492 71
42 3300006358 Ga0068871_100618854 Ga0068871_1006188541 71
43 3300013308 Ga0157375_10003797 Ga0157375_100037974 71
44 3300025905 Ga0207685_10000054 Ga0207685_100000544 71
45 3300028556 Ga0265337_1000066 Ga0265337_100006611 71
46 3300028558 Ga0265326_10000019 Ga0265326_10000019131 71
47 3300028563 Ga0265319_1229914 Ga0265319_12299142 71
48 3300028573 Ga0265334_10072981 Ga0265334_100729812 71
49 3300028654 Ga0265322_10000011 Ga0265322_10000011131 71
50 3300028666 Ga0265336_10062495 Ga0265336_100624952 71
51 3300028800 Ga0265338_10259892 Ga0265338_102598922 71
52 3300029957 Ga0265324_10000283 Ga0265324_1000028313 71
53 3300031235 Ga0265330_10151780 Ga0265330_101517802 71
54 3300031239 Ga0265328_10003099 Ga0265328_100030992 71
55 3300031240 Ga0265320_10000011 Ga0265320_10000011131 71
56 3300031242 Ga0265329_10100362 Ga0265329_101003621 71
57 3300031250 Ga0265331_10000858 Ga0265331_100008589 71
58 3300031251 Ga0265327_10000015 Ga0265327_10000015239 71
59 3300031711 Ga0265314_10003522 Ga0265314_100035223 71
60 3300031712 Ga0265342_10072828 Ga0265342_100728282 71
61 3300041486 Ga0451807_0339460 Ga0451807_0339460_178_444 71
62 3300046559 Ga0495667_0162551 Ga0495667_0162551_478_744 71
63 3300006038 Ga0075365_10034615 Ga0075365_100346152 72
64 3300006051 Ga0075364_10202783 Ga0075364_102027832 72
65 3300006173 Ga0070716_101831203 Ga0070716_1018312032 72
66 3300013308 Ga0157375_11170361 Ga0157375_111703611 72
67 3300025904 Ga0207647_10164778 Ga0207647_101647782 72
68 3300025939 Ga0207665_11502518 Ga0207665_115025182 72
69 3300026121 Ga0207683_10548061 Ga0207683_105480612 72
70 3300028379 Ga0268266_10262479 Ga0268266_102624792 72
71 3300041486 Ga0451807_1653004 Ga0451807_1653004_33_299 72
72 3300046462 Ga0495651_0061533 Ga0495651_0061533_734_1000 72
73 3300046517 Ga0495630_0002818 Ga0495630_0002818_4237_4503 72
74 3300047322 Ga0495680_0000143 Ga0495680_0000143_18424_18690 72
75 3300048915 Ga0496112_0000025 Ga0496112_0000025_122101_122367 72
76 3300048918 Ga0496115_0007479 Ga0496115_0007479_3048_3311 72
77 3300050491 nmdc:mga00v17_123412_c1 nmdc:mga00v17_123412_c1_1127_1393 72
78 3300053077 Ga0495601_0612422 Ga0495601_0612422_147_413 72
79 3300009147 Ga0114129_10531086 Ga0114129_105310862 73
80 3300025908 Ga0207643_10854289 Ga0207643_108542892 73
81 3300027907 Ga0207428_11062583 Ga0207428_110625831 73
82 3300041460 Ga0451802_1824591 Ga0451802_1824591_143_406 73
83 3300046681 Ga0495647_0018607 Ga0495647_0018607_1436_1702 73
84 3300050491 nmdc:mga00v17_987630_c1 nmdc:mga00v17_987630_c1_244_519 73
85 3300050507 nmdc:mga05p37_90215_c1 nmdc:mga05p37_90215_c1_1573_1845 73
86 3300050511 nmdc:mga08y16_1337123_c1 nmdc:mga08y16_1337123_c1_116_388 73
87 3300005455 Ga0070663_100069149 Ga0070663_1000691493 74
88 3300026067 Ga0207678_10124980 Ga0207678_101249802 74
89 3300047317 Ga0495604_0000067 Ga0495604_0000067_89277_89549 74
90 3300049578 Ga0501042_0035701 Ga0501042_0035701_380_655 74
91 3300046454 Ga0495592_0186188 Ga0495592_0186188_626_895 75
92 3300046663 Ga0495635_0000031 Ga0495635_0000031_104946_105212 75
93 3300046675 Ga0495657_0226689 Ga0495657_0226689_479_745 75
94 3300046678 Ga0495599_0687303 Ga0495599_0687303_43_309 75
95 3300005985 Ga0081539_10012453 Ga0081539_100124534 77
96 3300006175 Ga0070712_101876069 Ga0070712_1018760692 78
97 3300028381 Ga0268264_11749384 Ga0268264_117493841 78
98 3300030521 Ga0307511_10061741 Ga0307511_100617412 78
99 3300044694 Ga0466963_0010038 Ga0466963_0010038_3933_4196 78
100 3300046559 Ga0495667_0000020 Ga0495667_0000020_54774_55037 78
101 3300046642 Ga0495634_0000111 Ga0495634_0000111_722_985 78
102 3300046663 Ga0495635_0136602 Ga0495635_0136602_494_757 78
103 3300047322 Ga0495680_0007905 Ga0495680_0007905_5751_6014 78
104 3300048089 Ga0495614_0298199 Ga0495614_0298199_146_409 78
105 3300049576 Ga0501040_0237225 Ga0501040_0237225_946_1209 78
106 3300053085 Ga0495619_0000008 Ga0495619_0000008_180775_181038 78
107 3300002074 JGI24748J21848_1001803 JGI24748J21848_10018032 79
108 3300002239 JGI24034J26672_10002280 JGI24034J26672_100022802 79
109 3300002244 JGI24742J22300_10010708 JGI24742J22300_100107082 79
110 3300005341 Ga0070691_10000524 Ga0070691_100005244 79
111 3300005367 Ga0070667_100105540 Ga0070667_1001055402 79
112 3300005439 Ga0070711_100016210 Ga0070711_1000162103 79
113 3300005456 Ga0070678_100138883 Ga0070678_1001388832 79
114 3300005456 Ga0070678_100756752 Ga0070678_1007567522 79
115 3300005548 Ga0070665_100508699 Ga0070665_1005086992 79
116 3300005718 Ga0068866_10000003 Ga0068866_10000003288 79
117 3300005718 Ga0068866_10001583 Ga0068866_100015834 79
118 3300005843 Ga0068860_100004743 Ga0068860_10000474311 79
119 3300005843 Ga0068860_102116959 Ga0068860_1021169591 79
120 3300005937 Ga0081455_10595011 Ga0081455_105950111 79
121 3300006847 Ga0075431_100050709 Ga0075431_1000507094 79
122 3300006881 Ga0068865_100633343 Ga0068865_1006333432 79
123 3300007076 Ga0075435_101763329 Ga0075435_1017633292 79
124 3300009098 Ga0105245_10006201 Ga0105245_100062013 79
125 3300009098 Ga0105245_12754484 Ga0105245_127544841 79
126 3300009148 Ga0105243_10046930 Ga0105243_100469302 79
127 3300009148 Ga0105243_10508117 Ga0105243_105081172 79
128 3300009176 Ga0105242_10123196 Ga0105242_101231962 79
129 3300010375 Ga0105239_10133047 Ga0105239_101330472 79
130 3300010375 Ga0105239_10306236 Ga0105239_103062361 79
131 3300013104 Ga0157370_10022403 Ga0157370_100224034 79
132 3300013296 Ga0157374_10032041 Ga0157374_100320412 79
133 3300013306 Ga0163162_12038267 Ga0163162_120382671 79
134 3300014325 Ga0163163_11028760 Ga0163163_110287602 79
135 3300014969 Ga0157376_12088117 Ga0157376_120881172 79
136 3300017792 Ga0163161_11482038 Ga0163161_114820381 79
137 3300025899 Ga0207642_10000002 Ga0207642_10000002538 79
138 3300025899 Ga0207642_10000080 Ga0207642_1000008021 79
139 3300025915 Ga0207693_11106168 Ga0207693_111061681 79
140 3300025916 Ga0207663_10003583 Ga0207663_100035832 79
141 3300025927 Ga0207687_10346587 Ga0207687_103465872 79
142 3300025929 Ga0207664_10159182 Ga0207664_101591822 79
143 3300025934 Ga0207686_10043320 Ga0207686_100433202 79
144 3300025935 Ga0207709_10034680 Ga0207709_100346802 79
145 3300025937 Ga0207669_10000001 Ga0207669_100000014 79
146 3300025937 Ga0207669_10000017 Ga0207669_1000001710 79
147 3300025938 Ga0207704_10396295 Ga0207704_103962952 79
148 3300025939 Ga0207665_10510124 Ga0207665_105101242 79
149 3300025986 Ga0207658_10157658 Ga0207658_101576582 79
150 3300026067 Ga0207678_10195232 Ga0207678_101952322 79
151 3300026121 Ga0207683_10139677 Ga0207683_101396772 79
152 3300028381 Ga0268264_10002435 Ga0268264_100024355 79
153 3300035172 Ga0373955_0239168 Ga0373955_0239168_508_774 79
154 3300041460 Ga0451802_0657914 Ga0451802_0657914_160_426 79
155 3300045976 Ga0466967_0111517 Ga0466967_0111517_1949_2215 79
156 3300045976 Ga0466967_0333480 Ga0466967_0333480_1161_1427 79
157 3300046454 Ga0495592_0001152 Ga0495592_0001152_800_1066 79
158 3300046454 Ga0495592_0423245 Ga0495592_0423245_92_361 79
159 3300046455 Ga0495603_0004009 Ga0495603_0004009_7809_8075 79
160 3300046459 Ga0495629_0010707 Ga0495629_0010707_712_978 79
161 3300046459 Ga0495629_0688366 Ga0495629_0688366_62_328 79
162 3300046459 Ga0495629_1032575 Ga0495629_1032575_66_335 79
163 3300046462 Ga0495651_0095765 Ga0495651_0095765_925_1191 79
164 3300046463 Ga0495653_0035887 Ga0495653_0035887_545_811 79
165 3300046463 Ga0495653_0057544 Ga0495653_0057544_1371_1637 79
166 3300046463 Ga0495653_0187720 Ga0495653_0187720_201_467 79
167 3300046476 Ga0495662_0000001 Ga0495662_0000001_33856_34122 79
168 3300046514 Ga0495618_0000014 Ga0495618_0000014_101555_101821 79
169 3300046515 Ga0495620_0239835 Ga0495620_0239835_203_469 79
170 3300046516 Ga0495628_0082388 Ga0495628_0082388_744_1010 79
171 3300046517 Ga0495630_0017930 Ga0495630_0017930_1702_1968 79
172 3300046529 Ga0495652_0040875 Ga0495652_0040875_446_712 79
173 3300046533 Ga0495640_0023616 Ga0495640_0023616_3454_3720 79
174 3300046536 Ga0495587_0035965 Ga0495587_0035965_2565_2834 79
175 3300046537 Ga0495598_0008120 Ga0495598_0008120_1902_2168 79
176 3300046539 Ga0495621_0065322 Ga0495621_0065322_790_1059 79
177 3300046616 Ga0495668_0028721 Ga0495668_0028721_759_1025 79
178 3300046663 Ga0495635_0313973 Ga0495635_0313973_367_633 79
179 3300046675 Ga0495657_0121268 Ga0495657_0121268_378_644 79
180 3300046681 Ga0495647_0000001 Ga0495647_0000001_49505_49771 79
181 3300046689 Ga0495613_0000005 Ga0495613_0000005_120883_121149 79
182 3300046690 Ga0495624_0000019 Ga0495624_0000019_39428_39697 79
183 3300046690 Ga0495624_0131163 Ga0495624_0131163_771_1037 79
184 3300046690 Ga0495624_0509208 Ga0495624_0509208_300_566 79
185 3300046809 Ga0495600_0004207 Ga0495600_0004207_6518_6784 79
186 3300046809 Ga0495600_0253364 Ga0495600_0253364_544_810 79
187 3300047317 Ga0495604_0153398 Ga0495604_0153398_63_332 79
188 3300047319 Ga0495674_1144714 Ga0495674_1144714_250_516 79
189 3300047321 Ga0495676_0266135 Ga0495676_0266135_589_855 79
190 3300047322 Ga0495680_0328302 Ga0495680_0328302_682_948 79
191 3300047471 Ga0495684_0264384 Ga0495684_0264384_40_306 79
192 3300047673 Ga0495593_0518242 Ga0495593_0518242_180_449 79
193 3300048905 Ga0496102_0705334 Ga0496102_0705334_233_502 79
194 3300048907 Ga0496104_0000765 Ga0496104_0000765_15688_15954 79
195 3300048908 Ga0496105_0000409 Ga0496105_0000409_2828_3094 79
196 3300048909 Ga0496106_0000030 Ga0496106_0000030_759_1025 79
197 3300048911 Ga0496108_0006747 Ga0496108_0006747_113_379 79
198 3300048913 Ga0496110_0067110 Ga0496110_0067110_1957_2226 79
199 3300048914 Ga0496111_0109678 Ga0496111_0109678_1188_1457 79
200 3300048914 Ga0496111_1296273 Ga0496111_1296273_32_304 79
201 3300048915 Ga0496112_0511690 Ga0496112_0511690_708_974 79
202 3300048916 Ga0496113_0169780 Ga0496113_0169780_763_1029 79
203 3300048917 Ga0496114_0108339 Ga0496114_0108339_889_1155 79
204 3300048918 Ga0496115_0000011 Ga0496115_0000011_117215_117481 79
205 3300049578 Ga0501042_0411854 Ga0501042_0411854_258_527 79
206 3300049580 Ga0501046_0898657 Ga0501046_0898657_71_337 79
207 3300050510 nmdc:mga06r32_97159_c1 nmdc:mga06r32_97159_c1_373_642 79
208 3300050513 nmdc:mga0rr50_1638572_c1 nmdc:mga0rr50_1638572_c1_65_331 79
209 3300050515 nmdc:mga0a205_43_c1 nmdc:mga0a205_43_c1_35259_35525 79
210 3300053077 Ga0495601_0000158 Ga0495601_0000158_14421_14687 79
211 3300053077 Ga0495601_0045379 Ga0495601_0045379_1499_1765 79
212 3300053077 Ga0495601_0102824 Ga0495601_0102824_721_987 79
213 3300053077 Ga0495601_0146300 Ga0495601_0146300_744_1010 79
214 3300053077 Ga0495601_0643122 Ga0495601_0643122_317_583 79
215 3300053078 Ga0495612_0002488 Ga0495612_0002488_1447_1713 79
216 3300053078 Ga0495612_0018285 Ga0495612_0018285_296_562 79
217 3300053085 Ga0495619_0000320 Ga0495619_0000320_1902_2168 79
218 3300053085 Ga0495619_0591973 Ga0495619_0591973_432_698 79
219 3300053094 Ga0500566_0059735 Ga0500566_0059735_696_962 79

Feature Viewer

pLDDT pTM Quality
83 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map