F333403

General Info

Members Datasets Scaffolds Average Seq Length
221 159 442 280

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1041307|Ga0182006_10413072
Length 307
Sequence MYRVLYSSISSNEATNNYSLCKDISLTPENEEFLDGTLLNPPSKKAHDLHLKQEQRYKVSIKNLNAWFGTKQALKNINLDIKPNAATAIIGPSGCGKTTLIRCLNRMHEMTPGATAKGHIIIDGDIDIYDKSVDPVIIKRRIGMVFQKPNPFPTMSIYDNVSAGLKLNGVKDKRLINDVVKESLEGAALWDEVKDELDKPGIGLSGGQQQRLCIARALAMQPEVLLMDEPTSALDPIASSKIEELVHVLKKELTIITVTHNMLQAARVSDYTAFMYLGELIEYGPTSQIFKTPQKELTERYISGKFG

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
57 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
75 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
159 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 2.71
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 2.71
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1041307 3300015261 Archaea 1811
2 Ga0065704_10010573 3300005289 Bacteria 2112
3 Ga0065715_10021400 3300005293 Bacteria 1770
4 Ga0070668_100295951 3300005347 Bacteria 1356
5 Ga0070669_100001851 3300005353 Bacteria 15229
6 Ga0070669_100150924 3300005353 Bacteria 1799
7 Ga0070659_100000030 3300005366 Bacteria 128662
8 Ga0070714_100000645 3300005435 Bacteria 24737
9 Ga0070714_100013480 3300005435 Bacteria 6551
10 Ga0070710_10000009 3300005437 Bacteria 165863
11 Ga0070710_10052832 3300005437 Bacteria 2286
12 Ga0070705_100019423 3300005440 Bacteria 3576
13 Ga0070708_100061719 3300005445 Bacteria 3349
14 Ga0070662_100537365 3300005457 Bacteria 978
15 Ga0070706_100009050 3300005467 Bacteria 9271
16 Ga0070707_100010917 3300005468 Bacteria 8457
17 Ga0070698_100082646 3300005471 Bacteria 3204
18 Ga0070684_100147026 3300005535 Bacteria 2134
19 Ga0070697_100027140 3300005536 Bacteria 4579
20 Ga0070697_100465200 3300005536 Bacteria 1103
21 Ga0070695_100125826 3300005545 Bacteria 1760
22 Ga0081539_10000511 3300005985 Bacteria 80587
23 Ga0070717_10000013 3300006028 Bacteria 228046
24 Ga0070715_10034260 3300006163 Bacteria 2080
25 Ga0070716_100048948 3300006173 Bacteria 2392
26 Ga0075433_10138410 3300006852 Archaea 2164
27 Ga0075434_100071238 3300006871 Archaea 3467
28 Ga0075435_100010770 3300007076 Archaea 6699
29 Ga0105239_10051136 3300010375 Bacteria 4530
30 Ga0105239_10334605 3300010375 Bacteria 1708
31 Ga0105246_10064687 3300011119 Bacteria 2556
32 Ga0157378_10141542 3300013297 Bacteria 2234
33 Ga0157372_10100516 3300013307 Bacteria 3300
34 Ga0213876_10003860 3300021384 Bacteria 8474
35 Ga0213876_10083459 3300021384 Bacteria 1690
36 Ga0207692_10000005 3300025898 Bacteria 370169
37 Ga0207685_10022152 3300025905 Bacteria 2142
38 Ga0207699_10086773 3300025906 Bacteria 1955
39 Ga0207684_10008205 3300025910 Bacteria 9299
40 Ga0207693_10000028 3300025915 Bacteria 120041
41 Ga0207693_10042767 3300025915 Bacteria 3566
42 Ga0207663_10000174 3300025916 Archaea 28796
43 Ga0207681_10001855 3300025923 Bacteria 13550
44 Ga0207681_10036725 3300025923 Bacteria 3234
45 Ga0207664_10000046 3300025929 Bacteria 140749
46 Ga0207664_10010243 3300025929 Bacteria 6620
47 Ga0207664_10067693 3300025929 Bacteria 2867
48 Ga0207690_10000094 3300025932 Bacteria 74114
49 Ga0207706_10159733 3300025933 Bacteria 1981
50 Ga0207665_10016350 3300025939 Bacteria 4871
51 Ga0207661_10360107 3300025944 Bacteria 1314
52 Ga0207675_100179361 3300026118 Bacteria 2028
53 Ga0265326_10000159 3300028558 Bacteria 35803
54 Ga0265319_1000608 3300028563 Bacteria 23690
55 Ga0265334_10000177 3300028573 Bacteria 37570
56 Ga0265324_10003922 3300029957 Bacteria 6914
57 Ga0265327_10054611 3300031251 Bacteria 2067
58 Ga0316575_10144766 3300031665 Bacteria 979
59 Ga0316579_10005291 3300031691 Bacteria 5197
60 Ga0316579_10010011 3300031691 Bacteria 3998
61 Ga0316579_10079907 3300031691 Bacteria 1556
62 Ga0316577_10001746 3300031733 Bacteria 10460
63 Ga0316577_10004343 3300031733 Bacteria 7310
64 Ga0316577_10016677 3300031733 Bacteria 4053
65 Ga0307413_10053572 3300031824 Bacteria 2443
66 Ga0307407_10023702 3300031903 Archaea 3206
67 Ga0307409_100013159 3300031995 Bacteria 5310
68 Ga0307416_100179321 3300032002 Bacteria 1983
69 Ga0307414_10114040 3300032004 Bacteria 2064
70 Ga0373934_0005926 3300035086 Bacteria 4522
71 Ga0373923_0057858 3300035111 Bacteria 1640
72 Ga0373953_0013054 3300035117 Bacteria 2956
73 Ga0373954_0002574 3300035118 Bacteria 7623
74 Ga0373957_0003091 3300035120 Bacteria 4854
75 Ga0373955_0006596 3300035172 Bacteria 5295
76 Ga0316574_0004274 3300035398 Bacteria 7462
77 Ga0373935_0230369 3300035692 Bacteria 1290
78 Ga0373933_0005503 3300035724 Bacteria 6898
79 Ga0373937_0010423 3300036401 Bacteria 8116
80 Ga0373937_0164399 3300036401 Bacteria 2081
81 Ga0316582_0000336 3300036647 Bacteria 16557
82 Ga0316582_0008182 3300036647 Bacteria 5608
83 Ga0316582_0138802 3300036647 Bacteria 1638
84 Ga0316582_0146095 3300036647 Bacteria 1596
85 Ga0316582_0273878 3300036647 Bacteria 1158
86 Ga0316582_0309409 3300036647 Bacteria 1086
87 Ga0316584_0000895 3300036712 Bacteria 16968
88 Ga0316584_0004643 3300036712 Bacteria 9103
89 Ga0316584_0064423 3300036712 Bacteria 2744
90 Ga0316584_0084777 3300036712 Bacteria 2373
91 Ga0395900_0232159 3300037418 Bacteria 1855
92 Ga0395898_0083943 3300037466 Bacteria 3070
93 Ga0395898_0149312 3300037466 Bacteria 2237
94 Ga0395905_0140055 3300037471 Bacteria 2276
95 Ga0395905_0275004 3300037471 Bacteria 1570
96 Ga0316581_0052963 3300037588 Bacteria 1244
97 Ga0436364_0349867 3300037853 Bacteria 964
98 Ga0395901_0048242 3300038443 Bacteria 4422
99 Ga0395901_0513216 3300038443 Bacteria 1219
100 Ga0242422_01266 3300038699 Archaea 1740
101 Ga0242420_000090 3300038996 Archaea 8922
102 Ga0436360_0690694 3300039438 Bacteria 1307
103 Ga0466969_0007950 3300044656 Bacteria 5629
104 Ga0453683_0056934 3300044673 Bacteria 2446
105 Ga0466966_0084513 3300044684 Bacteria 1974
106 Ga0466961_0004440 3300044693 Bacteria 8782
107 Ga0466963_0069275 3300044694 Bacteria 2371
108 Ga0453684_0304043 3300044712 Bacteria 1812
109 Ga0453684_0528447 3300044712 Bacteria 1302
110 Ga0466971_0023232 3300044719 Bacteria 2763
111 Ga0466968_0022821 3300044735 Bacteria 2546
112 Ga0466970_0083728 3300044765 Bacteria 1726
113 Ga0466957_0149815 3300044842 Bacteria 1508
114 Ga0466959_0040093 3300045049 Bacteria 3460
115 Ga0466959_0048022 3300045049 Bacteria 3138
116 Ga0451576_0331346 3300045051 Bacteria 1593
117 Ga0466958_0003228 3300045836 Bacteria 8412
118 Ga0466967_0012704 3300045976 Bacteria 6462
119 Ga0466967_0417220 3300045976 Bacteria 1308
120 Ga0495592_0024038 3300046454 Bacteria 4634
121 Ga0495651_0002878 3300046462 Bacteria 13334
122 Ga0495653_0071062 3300046463 Bacteria 2603
123 Ga0495652_0011215 3300046529 Bacteria 8114
124 Ga0495587_0011924 3300046536 Bacteria 5494
125 Ga0495645_0017075 3300046543 Bacteria 5198
126 Ga0495667_0088008 3300046559 Bacteria 2014
127 Ga0495635_0046177 3300046663 Bacteria 3005
128 Ga0495657_0035468 3300046675 Bacteria 3456
129 Ga0495623_0035030 3300046679 Bacteria 3218
130 Ga0495646_0026977 3300046680 Bacteria 3606
131 Ga0495600_0012587 3300046809 Bacteria 5295
132 Ga0495675_0112922 3300047444 Bacteria 1695
133 Ga0495602_0001184 3300048088 Archaea 25597
134 Ga0496100_0000222 3300048903 Bacteria 30993
135 Ga0496101_0006230 3300048904 Bacteria 7671
136 Ga0496106_0021673 3300048909 Archaea 4771
137 Ga0496107_0148787 3300048910 Archaea 1732
138 Ga0496111_0048297 3300048914 Bacteria 3066
139 Ga0496112_0183897 3300048915 Bacteria 2053
140 Ga0496122_0043339 3300048925 Bacteria 3527
141 Ga0501317_008754 3300049533 Bacteria 1173
142 Ga0501325_006009 3300049541 Bacteria 984
143 Ga0501327_02707 3300049543 Bacteria 936
144 Ga0501335_006569 3300049551 Bacteria 1062
145 Ga0501031_0037008 3300049568 Bacteria 3184
146 Ga0501032_0007557 3300049569 Bacteria 7937
147 Ga0501032_0024892 3300049569 Archaea 4129
148 Ga0501033_0147973 3300049570 Bacteria 1695
149 Ga0501033_0314830 3300049570 Bacteria 1100
150 Ga0501036_0024072 3300049572 Bacteria 5132
151 Ga0501036_0024201 3300049572 Archaea 5118
152 Ga0501036_0232834 3300049572 Bacteria 1545
153 Ga0501037_0008781 3300049573 Archaea 7409
154 Ga0501038_0037368 3300049574 Archaea 4257
155 Ga0501038_0138139 3300049574 Bacteria 1996
156 Ga0501039_0015419 3300049575 Archaea 5849
157 Ga0501039_0078488 3300049575 Bacteria 2569
158 Ga0501040_0013222 3300049576 Archaea 5428
159 Ga0501040_0015620 3300049576 Bacteria 5019
160 Ga0501041_0009831 3300049577 Archaea 5630
161 Ga0501041_0035210 3300049577 Bacteria 3033
162 Ga0501041_0042646 3300049577 Bacteria 2758
163 Ga0501042_0043387 3300049578 Archaea 3202
164 Ga0501043_0010242 3300049579 Archaea 7346
165 Ga0501043_0030402 3300049579 Bacteria 4244
166 Ga0501046_0029180 3300049580 Bacteria 4486
167 Ga0501046_0030243 3300049580 Archaea 4396
168 Ga0501046_0042563 3300049580 Archaea 3621
169 Ga0501047_0022883 3300049581 Archaea 6000
170 Ga0501048_0062068 3300049582 Archaea 2645
171 Ga0501048_0089589 3300049582 Bacteria 2170
172 Ga0501067_0068251 3300049583 Bacteria 1968
173 Ga0501068_0020110 3300049584 Archaea 3885
174 Ga0501068_0111357 3300049584 Bacteria 1702
175 Ga0501069_0016115 3300049585 Bacteria 4009
176 Ga0501069_0028409 3300049585 Archaea 3067
177 Ga0501070_0054181 3300049586 Archaea 3326
178 Ga0501071_0008484 3300049587 Bacteria 6796
179 Ga0501071_0014404 3300049587 Archaea 5408
180 Ga0501072_0035858 3300049588 Archaea 3887
181 Ga0501073_0079875 3300049589 Bacteria 2276
182 Ga0501074_0028951 3300049590 Archaea 4013
183 Ga0501074_0150611 3300049590 Bacteria 1663
184 Ga0501075_0005038 3300049591 Bacteria 9021
185 Ga0501075_0095919 3300049591 Archaea 2250
186 Ga0501075_0345812 3300049591 Bacteria 1133
187 Ga0501076_0014034 3300049592 Archaea 6021
188 Ga0501076_0052245 3300049592 Bacteria 3237
189 Ga0501077_0034516 3300049593 Archaea 3219
190 Ga0501202_049169 3300049652 Bacteria 930
191 Ga0501079_0012758 3300049741 Bacteria 6420
192 Ga0501079_0020277 3300049741 Archaea 5080
193 Ga0501080_0000951 3300049742 Archaea 23701
194 Ga0501081_0013879 3300049743 Bacteria 5302
195 Ga0501081_0115437 3300049743 Bacteria 1908
196 Ga0501083_0007465 3300049744 Bacteria 7747
197 Ga0501271_004251 3300049768 Bacteria 1351
198 Ga0501035_0024865 3300049822 Bacteria 5492
199 Ga0501035_0036624 3300049822 Archaea 4445
200 Ga0501035_0332343 3300049822 Bacteria 1275
201 Ga0501044_0016679 3300049823 Archaea 7887
202 Ga0501044_0040543 3300049823 Archaea 4852
203 Ga0501044_0189810 3300049823 Bacteria 2018
204 Ga0501045_0000881 3300049824 Archaea 19504
205 Ga0501045_0001566 3300049824 Bacteria 15237
206 nmdc:mga0n895_5636_c1 3300050512 Archaea 10493
207 Ga0495619_0005362 3300053085 Bacteria 8120
208 Ga0500556_0001120 3300053104 Bacteria 13289
209 Ga0500616_0003062 3300053153 Bacteria 13147
210 Ga0501084_0004545 3300054114 Archaea 11347
211 Ga0501084_0012303 3300054114 Archaea 7086
212 Ga0587086_011231 3300059507 Bacteria 1095
213 Ga0587091_011341 3300059511 Bacteria 1388
214 Ga0501082_0006980 3300060353 Bacteria 9752
215 Ga0501082_0019012 3300060353 Archaea 5919
216 Ga0501082_0033705 3300060353 Bacteria 4417
217 Ga0501082_0049162 3300060353 Bacteria 3636
218 Ga0530510_0001053 3300061734 Archaea 18275
219 Ga0530510_0020700 3300061734 Bacteria 4678
220 Ga0530510_0142217 3300061734 Archaea 1768
221 8007376351 8007375930 Bacteria 4080554
222 Ga0182006_1041307
223 Ga0065704_10010573
224 Ga0065715_10021400
225 Ga0070668_100295951
226 Ga0070669_100001851
227 Ga0070669_100150924
228 Ga0070659_100000030
229 Ga0070714_100000645
230 Ga0070714_100013480
231 Ga0070710_10000009
232 Ga0070710_10052832
233 Ga0070705_100019423
234 Ga0070708_100061719
235 Ga0070662_100537365
236 Ga0070706_100009050
237 Ga0070707_100010917
238 Ga0070698_100082646
239 Ga0070684_100147026
240 Ga0070697_100027140
241 Ga0070697_100465200
242 Ga0070695_100125826
243 Ga0081539_10000511
244 Ga0070717_10000013
245 Ga0070715_10034260
246 Ga0070716_100048948
247 Ga0075433_10138410
248 Ga0075434_100071238
249 Ga0075435_100010770
250 Ga0105239_10051136
251 Ga0105239_10334605
252 Ga0105246_10064687
253 Ga0157378_10141542
254 Ga0157372_10100516
255 Ga0213876_10003860
256 Ga0213876_10083459
257 Ga0207692_10000005
258 Ga0207685_10022152
259 Ga0207699_10086773
260 Ga0207684_10008205
261 Ga0207693_10000028
262 Ga0207693_10042767
263 Ga0207663_10000174
264 Ga0207681_10001855
265 Ga0207681_10036725
266 Ga0207664_10000046
267 Ga0207664_10010243
268 Ga0207664_10067693
269 Ga0207690_10000094
270 Ga0207706_10159733
271 Ga0207665_10016350
272 Ga0207661_10360107
273 Ga0207675_100179361
274 Ga0265326_10000159
275 Ga0265319_1000608
276 Ga0265334_10000177
277 Ga0265324_10003922
278 Ga0265327_10054611
279 Ga0316575_10144766
280 Ga0316579_10005291
281 Ga0316579_10010011
282 Ga0316579_10079907
283 Ga0316577_10001746
284 Ga0316577_10004343
285 Ga0316577_10016677
286 Ga0307413_10053572
287 Ga0307407_10023702
288 Ga0307409_100013159
289 Ga0307416_100179321
290 Ga0307414_10114040
291 Ga0373934_0005926
292 Ga0373923_0057858
293 Ga0373953_0013054
294 Ga0373954_0002574
295 Ga0373957_0003091
296 Ga0373955_0006596
297 Ga0316574_0004274
298 Ga0373935_0230369
299 Ga0373933_0005503
300 Ga0373937_0010423
301 Ga0373937_0164399
302 Ga0316582_0000336
303 Ga0316582_0008182
304 Ga0316582_0138802
305 Ga0316582_0146095
306 Ga0316582_0273878
307 Ga0316582_0309409
308 Ga0316584_0000895
309 Ga0316584_0004643
310 Ga0316584_0064423
311 Ga0316584_0084777
312 Ga0395900_0232159
313 Ga0395898_0083943
314 Ga0395898_0149312
315 Ga0395905_0140055
316 Ga0395905_0275004
317 Ga0316581_0052963
318 Ga0436364_0349867
319 Ga0395901_0048242
320 Ga0395901_0513216
321 Ga0242422_01266
322 Ga0242420_000090
323 Ga0436360_0690694
324 Ga0466969_0007950
325 Ga0453683_0056934
326 Ga0466966_0084513
327 Ga0466961_0004440
328 Ga0466963_0069275
329 Ga0453684_0304043
330 Ga0453684_0528447
331 Ga0466971_0023232
332 Ga0466968_0022821
333 Ga0466970_0083728
334 Ga0466957_0149815
335 Ga0466959_0040093
336 Ga0466959_0048022
337 Ga0451576_0331346
338 Ga0466958_0003228
339 Ga0466967_0012704
340 Ga0466967_0417220
341 Ga0495592_0024038
342 Ga0495651_0002878
343 Ga0495653_0071062
344 Ga0495652_0011215
345 Ga0495587_0011924
346 Ga0495645_0017075
347 Ga0495667_0088008
348 Ga0495635_0046177
349 Ga0495657_0035468
350 Ga0495623_0035030
351 Ga0495646_0026977
352 Ga0495600_0012587
353 Ga0495675_0112922
354 Ga0495602_0001184
355 Ga0496100_0000222
356 Ga0496101_0006230
357 Ga0496106_0021673
358 Ga0496107_0148787
359 Ga0496111_0048297
360 Ga0496112_0183897
361 Ga0496122_0043339
362 Ga0501317_008754
363 Ga0501325_006009
364 Ga0501327_02707
365 Ga0501335_006569
366 Ga0501031_0037008
367 Ga0501032_0007557
368 Ga0501032_0024892
369 Ga0501033_0147973
370 Ga0501033_0314830
371 Ga0501036_0024072
372 Ga0501036_0024201
373 Ga0501036_0232834
374 Ga0501037_0008781
375 Ga0501038_0037368
376 Ga0501038_0138139
377 Ga0501039_0015419
378 Ga0501039_0078488
379 Ga0501040_0013222
380 Ga0501040_0015620
381 Ga0501041_0009831
382 Ga0501041_0035210
383 Ga0501041_0042646
384 Ga0501042_0043387
385 Ga0501043_0010242
386 Ga0501043_0030402
387 Ga0501046_0029180
388 Ga0501046_0030243
389 Ga0501046_0042563
390 Ga0501047_0022883
391 Ga0501048_0062068
392 Ga0501048_0089589
393 Ga0501067_0068251
394 Ga0501068_0020110
395 Ga0501068_0111357
396 Ga0501069_0016115
397 Ga0501069_0028409
398 Ga0501070_0054181
399 Ga0501071_0008484
400 Ga0501071_0014404
401 Ga0501072_0035858
402 Ga0501073_0079875
403 Ga0501074_0028951
404 Ga0501074_0150611
405 Ga0501075_0005038
406 Ga0501075_0095919
407 Ga0501075_0345812
408 Ga0501076_0014034
409 Ga0501076_0052245
410 Ga0501077_0034516
411 Ga0501202_049169
412 Ga0501079_0012758
413 Ga0501079_0020277
414 Ga0501080_0000951
415 Ga0501081_0013879
416 Ga0501081_0115437
417 Ga0501083_0007465
418 Ga0501271_004251
419 Ga0501035_0024865
420 Ga0501035_0036624
421 Ga0501035_0332343
422 Ga0501044_0016679
423 Ga0501044_0040543
424 Ga0501044_0189810
425 Ga0501045_0000881
426 Ga0501045_0001566
427 nmdc:mga0n895_5636_c1
428 Ga0495619_0005362
429 Ga0500556_0001120
430 Ga0500616_0003062
431 Ga0501084_0004545
432 Ga0501084_0012303
433 Ga0587086_011231
434 Ga0587091_011341
435 Ga0501082_0006980
436 Ga0501082_0019012
437 Ga0501082_0033705
438 Ga0501082_0049162
439 Ga0530510_0001053
440 Ga0530510_0020700
441 Ga0530510_0142217
442 8007376351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

74

232

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9204 24 271
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9199 24 271
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9174 25 268
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9155 24 271
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9139 24 270
ID Description Score Start End Superfamily
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9767 28 268 3.40.50.300
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 28 268 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9569 28 271 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9311 26 271 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9201 26 268 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A655R1D5-F1-model_v4 Phosphate transporter ATP-binding protein (EC 3.6.3.27) 0.9826 128 273 GO:0005315
GO:0005524
GO:0005886
GO:0016887
GO:0035435
AF-A0A6I7N8S6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9782 126 273 GO:0005524
GO:0006817
GO:0016887
AF-A0A641RXQ9-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9773 188 273 GO:0005524
AF-A0A655R1D5-F1-model_v4 Phosphate transporter ATP-binding protein (EC 3.6.3.27) 0.9694 128 273 GO:0005315
GO:0005524
GO:0005886
GO:0016887
GO:0035435
AF-A0A641RXQ9-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9662 188 273 GO:0005524

Map