F334274

General Info

Members Datasets Scaffolds Average Seq Length
222 157 216 329

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100103222|Ga0068857_1001032222
Length 384
Sequence MKKRIFSGVQPTGNLHIGNYLGAIKNWVPLQHEYESFFCIVNLHAITLPQDPKVLRQKTLDLARIYLAAGIDPAVSTIFIQSDVPAHTELTWILSCIARMGELERMTQFKDKSTKRVKQLTTPPDASFGKTSGRKLAENLPSASSPEERLTQQKAADPKKEIAPVWREVGASLSNFLSPGVGLFAYPVLMASDILLYQTDLVPVGKDQKQHLELTRDLAERFNRDFGETFKIPEPYIPPVGANILSLQDPTKKMSKSDENATGSIFLLDDADTVTKKIKRAVTDSGTDIKFDASRPAITNLLTIYQLFTGKTAEECEAHFEGKGYGAFKTELAEATVEFLRPFQERVHEYDEATLRNILETGAEKARNLASETLKVVYEKMGII

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
3 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
156 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
157 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 1.8
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10026912 3300003320 Bacteria 15387
2 Ga0065704_10170612 3300005289 Bacteria 1294
3 Ga0065712_10093476 3300005290 Unclassified 2291
4 Ga0065712_10111894 3300005290 Unclassified 1809
5 Ga0065707_10104933 3300005295 Bacteria 2671
6 Ga0065707_10155708 3300005295 Bacteria 1610
7 Ga0070658_10003502 3300005327 Bacteria 12897
8 Ga0070670_100008804 3300005331 Bacteria 8615
9 Ga0070682_100000247 3300005337 Bacteria 39158
10 Ga0070661_100010733 3300005344 Bacteria 6374
11 Ga0070669_100089876 3300005353 Bacteria 2301
12 Ga0070669_100147238 3300005353 Bacteria 1820
13 Ga0070671_100074749 3300005355 Bacteria 2831
14 Ga0070659_100013257 3300005366 Bacteria 6131
15 Ga0070667_100073386 3300005367 Bacteria 2917
16 Ga0070714_100000778 3300005435 Bacteria 22615
17 Ga0070714_100005166 3300005435 Bacteria 9936
18 Ga0070714_100128302 3300005435 Bacteria 2264
19 Ga0070701_10002799 3300005438 Bacteria 6782
20 Ga0070700_100312849 3300005441 Bacteria 1151
21 Ga0070694_100003260 3300005444 Bacteria 9690
22 Ga0070708_100044507 3300005445 Bacteria 3903
23 Ga0070708_100152555 3300005445 Bacteria 2149
24 Ga0070708_100200548 3300005445 Bacteria 1868
25 Ga0070662_100005786 3300005457 Bacteria 7923
26 Ga0070706_100005962 3300005467 Bacteria 11528
27 Ga0070706_100031112 3300005467 Bacteria 4922
28 Ga0070707_100003608 3300005468 Bacteria 14599
29 Ga0070707_100373226 3300005468 Bacteria 1386
30 Ga0070707_100388116 3300005468 Bacteria 1356
31 Ga0070698_100005254 3300005471 Bacteria 14168
32 Ga0070698_100010383 3300005471 Bacteria 9945
33 Ga0070698_100021315 3300005471 Bacteria 6789
34 Ga0070698_100136407 3300005471 Bacteria 2407
35 Ga0070698_100266885 3300005471 Bacteria 1643
36 Ga0070679_100024778 3300005530 Bacteria 5881
37 Ga0070679_100170646 3300005530 Bacteria 2148
38 Ga0070697_100000462 3300005536 Bacteria 31136
39 Ga0070697_100035851 3300005536 Bacteria 4004
40 Ga0068853_100001392 3300005539 Bacteria 17472
41 Ga0068853_100131813 3300005539 Bacteria 2238
42 Ga0070686_100022724 3300005544 Bacteria 3739
43 Ga0070696_100054666 3300005546 Bacteria 2783
44 Ga0070665_100000111 3300005548 Bacteria 152836
45 Ga0070704_100001705 3300005549 Bacteria 11972
46 Ga0070704_100281832 3300005549 Unclassified 1377
47 Ga0068857_100007220 3300005577 Bacteria 9566
48 Ga0068857_100009345 3300005577 Bacteria 8511
49 Ga0068857_100103222 3300005577 Bacteria 2560
50 Ga0068856_100104129 3300005614 Bacteria 2831
51 Ga0070702_100124775 3300005615 Bacteria 1617
52 Ga0068852_100105272 3300005616 Bacteria 2556
53 Ga0068852_100138358 3300005616 Bacteria 2251
54 Ga0068859_100228386 3300005617 Bacteria 1949
55 Ga0068864_100087261 3300005618 Bacteria 2746
56 Ga0068863_100010338 3300005841 Bacteria 9064
57 Ga0068863_100193503 3300005841 Bacteria 1955
58 Ga0068858_100012164 3300005842 Bacteria 8114
59 Ga0068858_100431858 3300005842 Bacteria 1267
60 Ga0068860_100055345 3300005843 Bacteria 3771
61 Ga0068860_100207846 3300005843 Bacteria 1898
62 Ga0068860_100229842 3300005843 Bacteria 1802
63 Ga0075434_100131296 3300006871 Bacteria 2524
64 Ga0097620_100228392 3300006931 Bacteria 1949
65 Ga0105240_10005451 3300009093 Bacteria 18958
66 Ga0105243_10246122 3300009148 Unclassified 1594
67 Ga0105241_10063970 3300009174 Bacteria 2840
68 Ga0105248_10023544 3300009177 Bacteria 6841
69 Ga0105248_10127868 3300009177 Bacteria 2867
70 Ga0105237_10010030 3300009545 Bacteria 10105
71 Ga0105237_10186304 3300009545 Unclassified 2075
72 Ga0105238_10000108 3300009551 Bacteria 90287
73 Ga0105249_10195743 3300009553 Bacteria 1975
74 Ga0157369_10282387 3300013105 Bacteria 1729
75 Ga0157378_10143484 3300013297 Bacteria 2219
76 Ga0163162_10020038 3300013306 Bacteria 6568
77 Ga0157372_10087087 3300013307 Bacteria 3543
78 Ga0157375_10278722 3300013308 Bacteria 1835
79 Ga0163163_10484457 3300014325 Bacteria 1298
80 Ga0157380_10026200 3300014326 Bacteria 4426
81 Ga0206356_10902675 3300020070 Bacteria 1452
82 Ga0206350_11159496 3300020080 Bacteria 1714
83 Ga0206353_11032125 3300020082 Bacteria 1662
84 Ga0213876_10001287 3300021384 Bacteria 15811
85 Ga0213876_10002767 3300021384 Bacteria 10215
86 Ga0213875_10087782 3300021388 Bacteria 1451
87 Ga0224712_10046150 3300022467 Bacteria 1671
88 Ga0207710_10035525 3300025900 Bacteria 2193
89 Ga0207699_10159878 3300025906 Unclassified 1499
90 Ga0207705_10016052 3300025909 Bacteria 5376
91 Ga0207684_10000857 3300025910 Bacteria 34915
92 Ga0207684_10019912 3300025910 Bacteria 5735
93 Ga0207684_10032421 3300025910 Bacteria 4443
94 Ga0207695_10043992 3300025913 Bacteria 4754
95 Ga0207671_10007939 3300025914 Bacteria 9098
96 Ga0207652_10038348 3300025921 Bacteria 4061
97 Ga0207646_10003753 3300025922 Bacteria 16931
98 Ga0207646_10118315 3300025922 Bacteria 2380
99 Ga0207694_10001548 3300025924 Bacteria 19522
100 Ga0207650_10085288 3300025925 Unclassified 2402
101 Ga0207659_10260528 3300025926 Bacteria 1410
102 Ga0207664_10000295 3300025929 Bacteria 37239
103 Ga0207664_10022892 3300025929 Bacteria 4674
104 Ga0207664_10398730 3300025929 Unclassified 1223
105 Ga0207706_10012664 3300025933 Bacteria 7676
106 Ga0207686_10132670 3300025934 Unclassified 1710
107 Ga0207670_10116802 3300025936 Bacteria 1932
108 Ga0207691_10036395 3300025940 Bacteria 4560
109 Ga0207711_10073436 3300025941 Bacteria 2972
110 Ga0207711_10202743 3300025941 Bacteria 1811
111 Ga0207689_10005999 3300025942 Bacteria 10747
112 Ga0207712_10008233 3300025961 Bacteria 6588
113 Ga0207658_10136450 3300025986 Bacteria 1979
114 Ga0207703_10007205 3300026035 Bacteria 8846
115 Ga0207703_10584569 3300026035 Bacteria 1055
116 Ga0207639_10001271 3300026041 Bacteria 17025
117 Ga0207641_10007461 3300026088 Bacteria 9097
118 Ga0207641_10066359 3300026088 Bacteria 3088
119 Ga0207676_10010567 3300026095 Bacteria 6580
120 Ga0207674_10004732 3300026116 Bacteria 16319
121 Ga0207674_10008635 3300026116 Bacteria 11738
122 Ga0209998_10004904 3300027717 Bacteria 2816
123 Ga0209974_10040310 3300027876 Bacteria 1554
124 Ga0268266_10000123 3300028379 Bacteria 153496
125 Ga0268264_10001877 3300028381 Bacteria 19081
126 Ga0265319_1041666 3300028563 Bacteria 1548
127 Ga0265338_10014640 3300028800 Bacteria 8701
128 Ga0307511_10000168 3300030521 Bacteria 64188
129 Ga0265320_10035952 3300031240 Bacteria 2507
130 Ga0265325_10030447 3300031241 Bacteria 2893
131 Ga0265325_10070792 3300031241 Bacteria 1751
132 Ga0265313_10036416 3300031595 Bacteria 2470
133 Ga0316576_10036533 3300031727 Bacteria 3512
134 Ga0316576_10145579 3300031727 Bacteria 1784
135 Ga0316578_10022118 3300031728 Bacteria 3540
136 Ga0316577_10133055 3300031733 Bacteria 1400
137 Ga0307413_10047832 3300031824 Bacteria 2553
138 Ga0307409_100302419 3300031995 Bacteria 1489
139 Ga0307409_100404934 3300031995 Bacteria 1304
140 Ga0307416_100080334 3300032002 Bacteria 2752
141 Ga0307411_10136899 3300032005 Bacteria 1800
142 Ga0316585_10004742 3300032137 Bacteria 3809
143 Ga0373959_0000097 3300034820 Bacteria 19816
144 Ga0373926_0001387 3300035083 Bacteria 7334
145 Ga0373929_0029921 3300035085 Bacteria 1158
146 Ga0373946_0031339 3300035171 Bacteria 2128
147 Ga0316574_0006547 3300035398 Bacteria 6304
148 Ga0316574_0010389 3300035398 Bacteria 5260
149 Ga0373947_0000004 3300035725 Bacteria 248228
150 Ga0373937_0162530 3300036401 Bacteria 2094
151 Ga0395899_0011472 3300037312 Bacteria 6783
152 Ga0395898_0284945 3300037466 Bacteria 1576
153 Ga0395905_0057184 3300037471 Bacteria 3648
154 Ga0436364_0063937 3300037853 Bacteria 3232
155 Ga0395901_0120161 3300038443 Bacteria 2761
156 Ga0400489_14542 3300039093 Bacteria 67753
157 Ga0436365_0152640 3300039437 Bacteria 11815
158 Ga0436365_0363601 3300039437 Bacteria 58813
159 Ga0451577_0000211 3300042876 Bacteria 122517
160 Ga0451577_0000243 3300042876 Bacteria 107789
161 Ga0451577_0006283 3300042876 Bacteria 11896
162 Ga0451577_0290174 3300042876 Bacteria 1482
163 Ga0453683_0000563 3300044673 Bacteria 40979
164 Ga0453684_0000665 3300044712 Bacteria 122961
165 Ga0453684_0000804 3300044712 Bacteria 106902
166 Ga0453684_0018220 3300044712 Bacteria 10798
167 Ga0453684_0101818 3300044712 Bacteria 3513
168 Ga0453684_0374423 3300044712 Bacteria 1600
169 Ga0451576_0415609 3300045051 Bacteria 1411
170 Ga0495663_0001105 3300046525 Bacteria 8721
171 Ga0495598_0002315 3300046537 Bacteria 3919
172 Ga0495621_0001089 3300046539 Bacteria 6974
173 Ga0496109_0022573 3300048912 Bacteria 5575
174 Ga0496109_0228860 3300048912 Bacteria 1749
175 Ga0496122_0033102 3300048925 Bacteria 4258
176 Ga0501031_0002196 3300049568 Bacteria 12329
177 Ga0501032_0001797 3300049569 Bacteria 16930
178 Ga0501032_0034418 3300049569 Bacteria 3469
179 Ga0501033_0017462 3300049570 Bacteria 5420
180 Ga0501033_0056705 3300049570 Bacteria 2895
181 Ga0501033_0147274 3300049570 Bacteria 1700
182 Ga0501033_0155046 3300049570 Bacteria 1650
183 Ga0501034_0020535 3300049571 Bacteria 6745
184 Ga0501034_0053276 3300049571 Bacteria 4075
185 Ga0501036_0011960 3300049572 Bacteria 7195
186 Ga0501036_0020525 3300049572 Bacteria 5548
187 Ga0501037_0003716 3300049573 Bacteria 11080
188 Ga0501037_0032646 3300049573 Bacteria 3845
189 Ga0501038_0088714 3300049574 Bacteria 2595
190 Ga0501039_0002824 3300049575 Bacteria 12980
191 Ga0501039_0006900 3300049575 Bacteria 8638
192 Ga0501041_0001057 3300049577 Bacteria 15059
193 Ga0501042_0001886 3300049578 Bacteria 12592
194 Ga0501043_0003423 3300049579 Bacteria 13031
195 Ga0501043_0042635 3300049579 Bacteria 3566
196 Ga0501046_0003656 3300049580 Bacteria 14081
197 Ga0501046_0005251 3300049580 Bacteria 11581
198 Ga0501047_0000979 3300049581 Bacteria 28768
199 Ga0501047_0008940 3300049581 Bacteria 9457
200 Ga0501048_0014933 3300049582 Bacteria 5744
201 Ga0501068_0002949 3300049584 Bacteria 9064
202 Ga0501068_0050418 3300049584 Bacteria 2516
203 Ga0501069_0075021 3300049585 Bacteria 1899
204 Ga0501072_0023007 3300049588 Bacteria 4838
205 Ga0501073_0055118 3300049589 Bacteria 2782
206 Ga0501075_0025929 3300049591 Bacteria 4309
207 Ga0501076_0025494 3300049592 Bacteria 4575
208 Ga0501080_0067594 3300049742 Bacteria 3324
209 Ga0501080_0507923 3300049742 Bacteria 1077
210 Ga0501083_0000049 3300049744 Bacteria 86914
211 Ga0501035_0006212 3300049822 Bacteria 11239
212 Ga0501035_0035797 3300049822 Bacteria 4503
213 Ga0501035_0191886 3300049822 Bacteria 1756
214 Ga0501044_0049901 3300049823 Bacteria 4319
215 Ga0501082_0151665 3300060353 Bacteria 2013
216 Ga0530510_0051334 3300061734 Bacteria 2979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100000778 Ga0070714_10000077832 297
2 3300025929 Ga0207664_10000295 Ga0207664_100002952 297
3 3300005355 Ga0070671_100074749 Ga0070671_1000747493 298
4 3300035085 Ga0373929_0029921 Ga0373929_0029921_15_941 298
5 3300045051 Ga0451576_0415609 Ga0451576_0415609_33_941 298
6 3300028563 Ga0265319_1041666 Ga0265319_10416662 299
7 3300028800 Ga0265338_10014640 Ga0265338_100146406 299
8 3300031240 Ga0265320_10035952 Ga0265320_100359522 299
9 3300031241 Ga0265325_10030447 Ga0265325_100304472 299
10 3300031595 Ga0265313_10036416 Ga0265313_100364162 299
11 3300031241 Ga0265325_10070792 Ga0265325_100707922 304
12 3300048912 Ga0496109_0228860 Ga0496109_0228860_25_978 309
13 iso_pu_bacteria 2786546517 2787436255 311
14 3300005577 Ga0068857_100009345 Ga0068857_1000093452 312
15 3300020070 Ga0206356_10902675 Ga0206356_109026752 312
16 3300020080 Ga0206350_11159496 Ga0206350_111594961 312
17 3300020082 Ga0206353_11032125 Ga0206353_110321252 312
18 3300022467 Ga0224712_10046150 Ga0224712_100461502 312
19 3300025921 Ga0207652_10038348 Ga0207652_100383481 312
20 3300026116 Ga0207674_10004732 Ga0207674_100047329 312
21 3300042876 Ga0451577_0000211 Ga0451577_0000211_76152_77114 314
22 3300042876 Ga0451577_0006283 Ga0451577_0006283_2781_3743 314
23 3300044712 Ga0453684_0000665 Ga0453684_0000665_76096_77058 314
24 3300049744 Ga0501083_0000049 Ga0501083_0000049_16109_17071 314
25 3300005435 Ga0070714_100005166 Ga0070714_1000051666 315
26 3300005471 Ga0070698_100136407 Ga0070698_1001364072 315
27 3300005530 Ga0070679_100024778 Ga0070679_1000247782 315
28 3300009545 Ga0105237_10186304 Ga0105237_101863042 315
29 3300021388 Ga0213875_10087782 Ga0213875_100877821 315
30 3300031727 Ga0316576_10036533 Ga0316576_100365332 315
31 3300031727 Ga0316576_10145579 Ga0316576_101455792 315
32 3300031728 Ga0316578_10022118 Ga0316578_100221182 315
33 3300031733 Ga0316577_10133055 Ga0316577_101330552 315
34 3300032137 Ga0316585_10004742 Ga0316585_100047422 315
35 3300035398 Ga0316574_0006547 Ga0316574_0006547_5086_6054 315
36 3300035398 Ga0316574_0010389 Ga0316574_0010389_2627_3595 315
37 3300037853 Ga0436364_0063937 Ga0436364_0063937_1897_2862 315
38 3300039093 Ga0400489_14542 Ga0400489_14542_10822_11787 315
39 3300042876 Ga0451577_0000243 Ga0451577_0000243_99281_100246 315
40 3300044673 Ga0453683_0000563 Ga0453683_0000563_27488_28453 315
41 3300044712 Ga0453684_0000804 Ga0453684_0000804_6657_7622 315
42 3300044712 Ga0453684_0018220 Ga0453684_0018220_8327_9292 315
43 3300049570 Ga0501033_0056705 Ga0501033_0056705_1802_2767 315
44 3300049570 Ga0501033_0147274 Ga0501033_0147274_401_1366 315
45 3300049581 Ga0501047_0000979 Ga0501047_0000979_19762_20727 315
46 3300049822 Ga0501035_0006212 Ga0501035_0006212_5936_6901 315
47 3300005457 Ga0070662_100005786 Ga0070662_10000578610 316
48 3300005548 Ga0070665_100000111 Ga0070665_100000111169 316
49 3300005841 Ga0068863_100010338 Ga0068863_1000103386 316
50 3300005842 Ga0068858_100012164 Ga0068858_1000121645 316
51 3300009093 Ga0105240_10005451 Ga0105240_100054511 316
52 3300009177 Ga0105248_10127868 Ga0105248_101278681 316
53 3300009545 Ga0105237_10010030 Ga0105237_100100309 316
54 3300009551 Ga0105238_10000108 Ga0105238_1000010873 316
55 3300021384 Ga0213876_10002767 Ga0213876_100027679 316
56 3300025913 Ga0207695_10043992 Ga0207695_100439921 316
57 3300025914 Ga0207671_10007939 Ga0207671_100079399 316
58 3300025924 Ga0207694_10001548 Ga0207694_100015483 316
59 3300025941 Ga0207711_10202743 Ga0207711_102027432 316
60 3300026035 Ga0207703_10007205 Ga0207703_100072055 316
61 3300026088 Ga0207641_10007461 Ga0207641_100074616 316
62 3300027717 Ga0209998_10004904 Ga0209998_100049043 316
63 3300027876 Ga0209974_10040310 Ga0209974_100403102 316
64 3300028379 Ga0268266_10000123 Ga0268266_10000123160 316
65 3300030521 Ga0307511_10000168 Ga0307511_100001684 316
66 3300034820 Ga0373959_0000097 Ga0373959_0000097_11977_12945 316
67 3300037312 Ga0395899_0011472 Ga0395899_0011472_5799_6767 316
68 3300037471 Ga0395905_0057184 Ga0395905_0057184_250_1218 316
69 3300038443 Ga0395901_0120161 Ga0395901_0120161_188_1156 316
70 3300039437 Ga0436365_0152640 Ga0436365_0152640_9489_10457 316
71 3300049569 Ga0501032_0001797 Ga0501032_0001797_15322_16302 316
72 3300049570 Ga0501033_0017462 Ga0501033_0017462_501_1481 316
73 3300049571 Ga0501034_0020535 Ga0501034_0020535_4523_5503 316
74 3300049572 Ga0501036_0020525 Ga0501036_0020525_629_1609 316
75 3300049573 Ga0501037_0003716 Ga0501037_0003716_4166_5146 316
76 3300049574 Ga0501038_0088714 Ga0501038_0088714_1115_2095 316
77 3300049575 Ga0501039_0002824 Ga0501039_0002824_4595_5575 316
78 3300049579 Ga0501043_0003423 Ga0501043_0003423_11423_12403 316
79 3300049580 Ga0501046_0003656 Ga0501046_0003656_2818_3798 316
80 3300049581 Ga0501047_0008940 Ga0501047_0008940_2839_3819 316
81 3300049582 Ga0501048_0014933 Ga0501048_0014933_1835_2815 316
82 3300049584 Ga0501068_0002949 Ga0501068_0002949_332_1312 316
83 3300049589 Ga0501073_0055118 Ga0501073_0055118_931_1911 316
84 3300049742 Ga0501080_0067594 Ga0501080_0067594_1239_2219 316
85 3300049822 Ga0501035_0035797 Ga0501035_0035797_2281_3261 316
86 3300049823 Ga0501044_0049901 Ga0501044_0049901_629_1609 316
87 3300021384 Ga0213876_10001287 Ga0213876_1000128716 317
88 3300025929 Ga0207664_10022892 Ga0207664_100228922 317
89 3300039437 Ga0436365_0363601 Ga0436365_0363601_41455_42426 317
90 3300005290 Ga0065712_10111894 Ga0065712_101118941 319
91 3300005441 Ga0070700_100312849 Ga0070700_1003128491 319
92 3300005471 Ga0070698_100005254 Ga0070698_10000525416 319
93 3300013297 Ga0157378_10143484 Ga0157378_101434842 319
94 3300049742 Ga0501080_0507923 Ga0501080_0507923_87_1067 319
95 3300005290 Ga0065712_10093476 Ga0065712_100934763 320
96 3300005331 Ga0070670_100008804 Ga0070670_10000880411 320
97 3300005530 Ga0070679_100170646 Ga0070679_1001706462 320
98 3300005539 Ga0068853_100131813 Ga0068853_1001318131 320
99 3300005577 Ga0068857_100103222 Ga0068857_1001032222 320
100 3300005615 Ga0070702_100124775 Ga0070702_1001247752 320
101 3300005616 Ga0068852_100105272 Ga0068852_1001052721 320
102 3300005618 Ga0068864_100087261 Ga0068864_1000872613 320
103 3300005841 Ga0068863_100193503 Ga0068863_1001935031 320
104 3300005842 Ga0068858_100431858 Ga0068858_1004318581 320
105 3300005843 Ga0068860_100055345 Ga0068860_1000553454 320
106 3300005843 Ga0068860_100207846 Ga0068860_1002078463 320
107 3300005843 Ga0068860_100229842 Ga0068860_1002298422 320
108 3300009553 Ga0105249_10195743 Ga0105249_101957432 320
109 3300013307 Ga0157372_10087087 Ga0157372_100870876 320
110 3300014326 Ga0157380_10026200 Ga0157380_100262002 320
111 3300025900 Ga0207710_10035525 Ga0207710_100355253 320
112 3300025925 Ga0207650_10085288 Ga0207650_100852882 320
113 3300025926 Ga0207659_10260528 Ga0207659_102605282 320
114 3300025940 Ga0207691_10036395 Ga0207691_100363951 320
115 3300025961 Ga0207712_10008233 Ga0207712_100082332 320
116 3300026035 Ga0207703_10584569 Ga0207703_105845691 320
117 3300026088 Ga0207641_10066359 Ga0207641_100663594 320
118 3300026095 Ga0207676_10010567 Ga0207676_100105675 320
119 3300028381 Ga0268264_10001877 Ga0268264_100018772 320
120 3300048912 Ga0496109_0022573 Ga0496109_0022573_2190_3167 320
121 3300005295 Ga0065707_10104933 Ga0065707_101049332 321
122 3300005344 Ga0070661_100010733 Ga0070661_1000107335 321
123 3300005366 Ga0070659_100013257 Ga0070659_1000132572 321
124 3300005438 Ga0070701_10002799 Ga0070701_100027999 321
125 3300005444 Ga0070694_100003260 Ga0070694_1000032605 321
126 3300005445 Ga0070708_100200548 Ga0070708_1002005482 321
127 3300005467 Ga0070706_100031112 Ga0070706_1000311122 321
128 3300005468 Ga0070707_100003608 Ga0070707_1000036084 321
129 3300005471 Ga0070698_100010383 Ga0070698_1000103835 321
130 3300005536 Ga0070697_100000462 Ga0070697_10000046223 321
131 3300005539 Ga0068853_100001392 Ga0068853_10000139216 321
132 3300005544 Ga0070686_100022724 Ga0070686_1000227243 321
133 3300005549 Ga0070704_100001705 Ga0070704_1000017052 321
134 3300005549 Ga0070704_100281832 Ga0070704_1002818321 321
135 3300005577 Ga0068857_100007220 Ga0068857_10000722014 321
136 3300005616 Ga0068852_100138358 Ga0068852_1001383582 321
137 3300005617 Ga0068859_100228386 Ga0068859_1002283861 321
138 3300006931 Ga0097620_100228392 Ga0097620_1002283923 321
139 3300009148 Ga0105243_10246122 Ga0105243_102461222 321
140 3300009174 Ga0105241_10063970 Ga0105241_100639702 321
141 3300013105 Ga0157369_10282387 Ga0157369_102823872 321
142 3300025910 Ga0207684_10019912 Ga0207684_100199125 321
143 3300025910 Ga0207684_10032421 Ga0207684_100324213 321
144 3300025922 Ga0207646_10003753 Ga0207646_1000375311 321
145 3300025933 Ga0207706_10012664 Ga0207706_1001266412 321
146 3300025934 Ga0207686_10132670 Ga0207686_101326701 321
147 3300025942 Ga0207689_10005999 Ga0207689_100059994 321
148 3300026041 Ga0207639_10001271 Ga0207639_100012716 321
149 3300026116 Ga0207674_10008635 Ga0207674_100086354 321
150 3300031824 Ga0307413_10047832 Ga0307413_100478321 321
151 3300032002 Ga0307416_100080334 Ga0307416_1000803344 321
152 iso_pu_bacteria 2808606447 2809226730 321
153 iso_pu_bacteria 2852632344 2852632947 321
154 3300005289 Ga0065704_10170612 Ga0065704_101706121 322
155 3300005295 Ga0065707_10155708 Ga0065707_101557082 322
156 3300005327 Ga0070658_10003502 Ga0070658_1000350213 322
157 3300005337 Ga0070682_100000247 Ga0070682_10000024711 322
158 3300005367 Ga0070667_100073386 Ga0070667_1000733861 322
159 3300005468 Ga0070707_100373226 Ga0070707_1003732262 322
160 3300005471 Ga0070698_100266885 Ga0070698_1002668852 322
161 3300005536 Ga0070697_100035851 Ga0070697_1000358513 322
162 3300005546 Ga0070696_100054666 Ga0070696_1000546661 322
163 3300006871 Ga0075434_100131296 Ga0075434_1001312962 322
164 3300009177 Ga0105248_10023544 Ga0105248_100235445 322
165 3300013306 Ga0163162_10020038 Ga0163162_100200388 322
166 3300013308 Ga0157375_10278722 Ga0157375_102787221 322
167 3300014325 Ga0163163_10484457 Ga0163163_104844572 322
168 3300025909 Ga0207705_10016052 Ga0207705_100160527 322
169 3300025922 Ga0207646_10118315 Ga0207646_101183152 322
170 3300025936 Ga0207670_10116802 Ga0207670_101168022 322
171 3300025941 Ga0207711_10073436 Ga0207711_100734364 322
172 3300025986 Ga0207658_10136450 Ga0207658_101364502 322
173 3300046525 Ga0495663_0001105 Ga0495663_0001105_2063_3052 322
174 3300046537 Ga0495598_0002315 Ga0495598_0002315_2090_3079 322
175 3300046539 Ga0495621_0001089 Ga0495621_0001089_2555_3544 322
176 3300005467 Ga0070706_100005962 Ga0070706_10000596210 323
177 3300005471 Ga0070698_100021315 Ga0070698_1000213157 323
178 3300025910 Ga0207684_10000857 Ga0207684_100008579 323
179 3300036401 Ga0373937_0162530 Ga0373937_0162530_335_1435 323
180 3300044712 Ga0453684_0374423 Ga0453684_0374423_302_1285 323
181 iso_pu_bacteria 8007371054 8007374895 323
182 iso_pu_bacteria 8007375930 8007379657 323
183 iso_pu_bacteria 8055037949 8055040358 324
184 3300005435 Ga0070714_100128302 Ga0070714_1001283022 325
185 3300005445 Ga0070708_100044507 Ga0070708_1000445073 325
186 3300005445 Ga0070708_100152555 Ga0070708_1001525552 325
187 3300005468 Ga0070707_100388116 Ga0070707_1003881161 325
188 3300025906 Ga0207699_10159878 Ga0207699_101598781 325
189 3300025929 Ga0207664_10398730 Ga0207664_103987301 325
190 3300035083 Ga0373926_0001387 Ga0373926_0001387_4698_5702 325
191 3300035171 Ga0373946_0031339 Ga0373946_0031339_898_1902 325
192 3300035725 Ga0373947_0000004 Ga0373947_0000004_210494_211498 325
193 3300037466 Ga0395898_0284945 Ga0395898_0284945_311_1366 325
194 3300048925 Ga0496122_0033102 Ga0496122_0033102_2772_3770 325
195 3300049568 Ga0501031_0002196 Ga0501031_0002196_9957_10994 325
196 3300049569 Ga0501032_0034418 Ga0501032_0034418_19_1056 325
197 3300049570 Ga0501033_0155046 Ga0501033_0155046_581_1618 325
198 3300049572 Ga0501036_0011960 Ga0501036_0011960_552_1589 325
199 3300049573 Ga0501037_0032646 Ga0501037_0032646_2224_3261 325
200 3300049575 Ga0501039_0006900 Ga0501039_0006900_7006_8043 325
201 3300049577 Ga0501041_0001057 Ga0501041_0001057_14004_15041 325
202 3300049578 Ga0501042_0001886 Ga0501042_0001886_6288_7325 325
203 3300049579 Ga0501043_0042635 Ga0501043_0042635_2180_3217 325
204 3300049580 Ga0501046_0005251 Ga0501046_0005251_4573_5610 325
205 3300049584 Ga0501068_0050418 Ga0501068_0050418_934_1971 325
206 3300049585 Ga0501069_0075021 Ga0501069_0075021_316_1353 325
207 3300049588 Ga0501072_0023007 Ga0501072_0023007_387_1424 325
208 3300049591 Ga0501075_0025929 Ga0501075_0025929_19_1056 325
209 3300049592 Ga0501076_0025494 Ga0501076_0025494_2963_4000 325
210 3300060353 Ga0501082_0151665 Ga0501082_0151665_421_1458 325
211 3300061734 Ga0530510_0051334 Ga0530510_0051334_192_1229 325
212 3300005614 Ga0068856_100104129 Ga0068856_1001041292 326
213 3300031995 Ga0307409_100404934 Ga0307409_1004049342 326
214 3300042876 Ga0451577_0290174 Ga0451577_0290174_203_1246 329
215 3300044712 Ga0453684_0101818 Ga0453684_0101818_2412_3455 329
216 3300031995 Ga0307409_100302419 Ga0307409_1003024191 330
217 3300005353 Ga0070669_100147238 Ga0070669_1001472381 332
218 3300005353 Ga0070669_100089876 Ga0070669_1000898763 333
219 3300032005 Ga0307411_10136899 Ga0307411_101368992 333
220 3300049571 Ga0501034_0053276 Ga0501034_0053276_3016_4020 334
221 3300049822 Ga0501035_0191886 Ga0501035_0191886_10_1014 334
222 3300003320 rootH2_10026912 rootH2_1002691212 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

164

341

0.95

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

1

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhj-assembly2.cif.gz_D independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9682 4 335
3fhj-assembly3.cif.gz_E independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9673 4 335
3fhj-assembly3.cif.gz_F independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9668 4 335
3prh-assembly1.cif.gz_A tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9659 4 335
1d2r-assembly3.cif.gz_C 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site. 0.9647 4 335
ID Description Score Start End Superfamily
3fhjD02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9717 189 301 1.10.240.10
3fhjD02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.961 189 301 1.10.240.10
3prhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9569 4 335 3.40.50.620
af_Q86A90_13_226_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9553 4 182 3.40.50.620
af_Q86A90_233_346_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9538 189 303 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A7W7AIB9-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9872 5 335 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A327MEU7-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9852 4 336 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A4S0I307-F1-model_v4 deleted 0.985 69 160
AF-A0A3C0BQP2-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9842 49 265 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A440IBG7-F1-model_v4 deleted 0.9827 190 276

Feature Viewer

pLDDT pTM Quality
92.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map