F335441

General Info

Members Datasets Scaffolds Average Seq Length
223 136 217 138

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100701886|Ga0075363_1007018861
Length 158
Sequence MTATPSPTNPPVLQLRVVVEAEDYDAAVAFYRDVLGLPEQAAFEGEGDARVTILEAGRATLELANPAQKRMIDDVEVGRPVSPKIRLAFEVTDADGKTRALVDAGATLIAPPTETPWRSLNSRLDAPAGVQITLFQELEGLEERTTRDGFGTSTTRDQ

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221619 Agromyces sp. Root81 Isolate Unclassified
3 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
4 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
5 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
6 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
60 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
61 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
64 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
69 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
72 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 4.93
Rhizosphere 86.1
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10210673 3300002067 Bacteria 564
2 Ga0068868_100204395 3300005338 Bacteria 1648
3 Ga0070673_101758335 3300005364 Bacteria 587
4 Ga0070659_101215621 3300005366 Bacteria 667
5 Ga0070708_101288108 3300005445 Bacteria 683
6 Ga0070662_100643498 3300005457 Bacteria 894
7 Ga0070681_11212803 3300005458 Bacteria 677
8 Ga0070684_100742608 3300005535 Bacteria 916
9 Ga0070684_100798393 3300005535 Bacteria 882
10 Ga0070684_101198080 3300005535 Bacteria 714
11 Ga0070686_100497888 3300005544 Bacteria 945
12 Ga0070665_100001091 3300005548 Bacteria 33648
13 Ga0068859_100002435 3300005617 Bacteria 18946
14 Ga0068863_101271726 3300005841 Bacteria 742
15 Ga0068862_100586793 3300005844 Bacteria 1068
16 Ga0081455_10392406 3300005937 Bacteria 966
17 Ga0081538_10004330 3300005981 Bacteria 13117
18 Ga0075365_10011555 3300006038 Bacteria 5197
19 Ga0075363_100701886 3300006048 Bacteria 611
20 Ga0075364_10069604 3300006051 Bacteria 2315
21 Ga0075364_10083348 3300006051 Bacteria 2116
22 Ga0075369_10361990 3300006186 Bacteria 681
23 Ga0075430_100315322 3300006846 Bacteria 1293
24 Ga0075431_100080124 3300006847 Bacteria 3371
25 Ga0075431_100203573 3300006847 Bacteria 2024
26 Ga0075433_10628451 3300006852 Bacteria 942
27 Ga0075434_100346866 3300006871 Bacteria 1506
28 Ga0075434_100411725 3300006871 Bacteria 1373
29 Ga0075429_100213415 3300006880 Bacteria 1691
30 Ga0097620_100002435 3300006931 Bacteria 18946
31 Ga0114129_10106662 3300009147 Bacteria 3869
32 Ga0105239_10225544 3300010375 Bacteria 2102
33 Ga0157371_10000414 3300013102 Bacteria 52787
34 Ga0157372_11872538 3300013307 Bacteria 690
35 Ga0163163_11844665 3300014325 Bacteria 665
36 Ga0207710_10003234 3300025900 Bacteria 7278
37 Ga0207684_11323316 3300025910 Bacteria 592
38 Ga0207706_10394937 3300025933 Bacteria 1199
39 Ga0207668_10675948 3300025972 Bacteria 906
40 Ga0207677_10044105 3300026023 Bacteria 2969
41 Ga0207676_10836562 3300026095 Bacteria 900
42 Ga0268266_10002426 3300028379 Bacteria 20068
43 Ga0265320_10070578 3300031240 Bacteria 1647
44 Ga0265325_10275514 3300031241 Bacteria 755
45 Ga0265316_10600980 3300031344 Unclassified 780
46 Ga0265316_10684854 3300031344 Bacteria 723
47 Ga0307408_100163369 3300031548 Bacteria 1771
48 Ga0307508_10069790 3300031616 Bacteria 3086
49 Ga0307514_10002316 3300031649 Bacteria 20059
50 Ga0265342_10014488 3300031712 Bacteria 5232
51 Ga0307410_11271571 3300031852 Bacteria 643
52 Ga0307407_10029722 3300031903 Bacteria 2940
53 Ga0307407_10801202 3300031903 Bacteria 717
54 Ga0307412_10313593 3300031911 Bacteria 1245
55 Ga0307409_100206828 3300031995 Bacteria 1761
56 Ga0307409_100513279 3300031995 Bacteria 1169
57 Ga0307409_100948152 3300031995 Bacteria 876
58 Ga0307416_100029312 3300032002 Bacteria 4109
59 Ga0307416_100254687 3300032002 Bacteria 1711
60 Ga0307414_10771293 3300032004 Bacteria 875
61 Ga0307411_10444239 3300032005 Bacteria 1083
62 Ga0307411_11101687 3300032005 Bacteria 716
63 Ga0307411_11732295 3300032005 Bacteria 579
64 Ga0307415_100125528 3300032126 Bacteria 1933
65 Ga0307415_100519184 3300032126 Bacteria 1045
66 Ga0307415_100935941 3300032126 Bacteria 801
67 Ga0373950_0080342 3300034818 Bacteria 680
68 Ga0373938_0062042 3300034957 Bacteria 876
69 Ga0373940_0013504 3300035088 Bacteria 1978
70 Ga0373942_0000149 3300035207 Bacteria 16701
71 Ga0439466_0100740 3300041411 Bacteria 901
72 Ga0451797_0265497 3300041453 Bacteria 831
73 Ga0451837_0438911 3300041494 Bacteria 2785
74 Ga0451853_2550968 3300041512 Bacteria 2847
75 Ga0439448_0013142 3300042005 Bacteria 2486
76 Ga0439454_030269 3300042011 Bacteria 845
77 Ga0439455_0093132 3300042012 Bacteria 828
78 Ga0439463_006915 3300042016 Bacteria 2798
79 Ga0450920_003216 3300042122 Bacteria 2819
80 Ga0450923_122157 3300042125 Bacteria 615
81 Ga0466965_0439256 3300044683 Bacteria 725
82 Ga0466963_0643273 3300044694 Bacteria 749
83 Ga0466964_0470013 3300044706 Unclassified 670
84 Ga0466967_0207869 3300045976 Bacteria 1856
85 Ga0466967_1536572 3300045976 Bacteria 663
86 Ga0466967_1673407 3300045976 Bacteria 634
87 Ga0495629_0377136 3300046459 Bacteria 965
88 Ga0495658_0024810 3300046683 Bacteria 3199
89 Ga0495613_0046123 3300046689 Bacteria 3223
90 Ga0496104_0178127 3300048907 Bacteria 2036
91 Ga0496105_0045760 3300048908 Bacteria 3611
92 Ga0496108_0460333 3300048911 Bacteria 1111
93 Ga0496109_0314407 3300048912 Bacteria 1478
94 Ga0496109_1377498 3300048912 Bacteria 641
95 Ga0496110_0149951 3300048913 Bacteria 2111
96 Ga0496110_0619539 3300048913 Bacteria 981
97 Ga0496111_0076041 3300048914 Bacteria 2447
98 Ga0496114_0266960 3300048917 Bacteria 1508
99 Ga0496114_0277491 3300048917 Bacteria 1477
100 Ga0496118_0378314 3300048921 Bacteria 744
101 Ga0501031_0001352 3300049568 Bacteria 15120
102 Ga0501031_0618024 3300049568 Bacteria 697
103 Ga0501032_0072684 3300049569 Bacteria 2292
104 Ga0501033_0017531 3300049570 Bacteria 5410
105 Ga0501033_0197203 3300049570 Bacteria 1439
106 Ga0501034_0186846 3300049571 Bacteria 2035
107 Ga0501034_0208153 3300049571 Bacteria 1912
108 Ga0501036_0003594 3300049572 Bacteria 12398
109 Ga0501036_0005044 3300049572 Bacteria 10686
110 Ga0501036_0189641 3300049572 Bacteria 1730
111 Ga0501036_1236984 3300049572 Bacteria 608
112 Ga0501036_1258967 3300049572 Bacteria 602
113 Ga0501037_0067688 3300049573 Bacteria 2600
114 Ga0501037_0078331 3300049573 Bacteria 2398
115 Ga0501037_0443157 3300049573 Bacteria 887
116 Ga0501038_0006598 3300049574 Bacteria 10733
117 Ga0501039_0004940 3300049575 Bacteria 10110
118 Ga0501039_0008058 3300049575 Bacteria 8026
119 Ga0501040_0001482 3300049576 Bacteria 14902
120 Ga0501040_0010160 3300049576 Bacteria 6152
121 Ga0501040_1330501 3300049576 Bacteria 521
122 Ga0501041_0002328 3300049577 Bacteria 10746
123 Ga0501041_0003842 3300049577 Bacteria 8648
124 Ga0501041_0194687 3300049577 Bacteria 1270
125 Ga0501042_0003281 3300049578 Bacteria 10124
126 Ga0501042_0055894 3300049578 Bacteria 2817
127 Ga0501042_0060946 3300049578 Bacteria 2695
128 Ga0501042_0101483 3300049578 Bacteria 2069
129 Ga0501043_0117506 3300049579 Bacteria 2086
130 Ga0501046_0005122 3300049580 Bacteria 11755
131 Ga0501046_0030660 3300049580 Bacteria 4363
132 Ga0501048_0001265 3300049582 Bacteria 19125
133 Ga0501048_0002709 3300049582 Bacteria 13515
134 Ga0501048_0210774 3300049582 Bacteria 1378
135 Ga0501048_0223619 3300049582 Bacteria 1336
136 Ga0501048_0340361 3300049582 Bacteria 1069
137 Ga0501067_0047783 3300049583 Bacteria 2374
138 Ga0501068_0091378 3300049584 Bacteria 1878
139 Ga0501068_0296015 3300049584 Bacteria 1035
140 Ga0501069_0062523 3300049585 Bacteria 2079
141 Ga0501070_0074937 3300049586 Bacteria 2801
142 Ga0501070_0143528 3300049586 Bacteria 1971
143 Ga0501070_1300008 3300049586 Unclassified 555
144 Ga0501071_0017083 3300049587 Bacteria 4999
145 Ga0501071_0029000 3300049587 Bacteria 3903
146 Ga0501071_0149549 3300049587 Bacteria 1741
147 Ga0501071_0226561 3300049587 Bacteria 1408
148 Ga0501071_1445016 3300049587 Bacteria 531
149 Ga0501072_0001801 3300049588 Bacteria 15953
150 Ga0501072_0016995 3300049588 Bacteria 5590
151 Ga0501072_0094517 3300049588 Bacteria 2375
152 Ga0501072_0892711 3300049588 Bacteria 694
153 Ga0501072_0926701 3300049588 Bacteria 680
154 Ga0501073_0201798 3300049589 Bacteria 1375
155 Ga0501074_0008042 3300049590 Bacteria 7638
156 Ga0501074_0016431 3300049590 Bacteria 5375
157 Ga0501074_0063632 3300049590 Bacteria 2657
158 Ga0501074_0064948 3300049590 Bacteria 2627
159 Ga0501075_0058454 3300049591 Bacteria 2904
160 Ga0501075_0363314 3300049591 Bacteria 1103
161 Ga0501075_0519940 3300049591 Unclassified 908
162 Ga0501076_0000352 3300049592 Bacteria 28454
163 Ga0501076_0002935 3300049592 Bacteria 11820
164 Ga0501076_0213920 3300049592 Bacteria 1576
165 Ga0501076_0360482 3300049592 Bacteria 1194
166 Ga0501077_0001396 3300049593 Bacteria 14557
167 Ga0501077_0054992 3300049593 Bacteria 2527
168 Ga0501077_0346091 3300049593 Bacteria 948
169 Ga0501079_0002714 3300049741 Bacteria 12898
170 Ga0501079_0014048 3300049741 Bacteria 6105
171 Ga0501079_0056003 3300049741 Bacteria 3042
172 Ga0501079_0177679 3300049741 Bacteria 1661
173 Ga0501080_0026119 3300049742 Bacteria 5425
174 Ga0501080_0038974 3300049742 Bacteria 4434
175 Ga0501081_0010166 3300049743 Bacteria 6141
176 Ga0501081_0016306 3300049743 Bacteria 4910
177 Ga0501081_0756908 3300049743 Bacteria 730
178 Ga0501083_0118458 3300049744 Bacteria 1737
179 Ga0501083_0172157 3300049744 Bacteria 1415
180 Ga0501035_0030735 3300049822 Bacteria 4896
181 Ga0501035_0054308 3300049822 Bacteria 3580
182 Ga0501044_0164854 3300049823 Bacteria 2191
183 Ga0501044_0856222 3300049823 Bacteria 786
184 Ga0501045_0000391 3300049824 Bacteria 26581
185 Ga0501045_0002531 3300049824 Bacteria 12447
186 Ga0501045_0066571 3300049824 Bacteria 2645
187 Ga0501045_0549337 3300049824 Unclassified 857
188 nmdc:mga03n38_816500_c1 3300050490 Bacteria 544
189 nmdc:mga00v17_109610_c1 3300050491 Bacteria 1750
190 nmdc:mga00v17_60955_c1 3300050491 Bacteria 2318
191 nmdc:mga0yw44_159546_c1 3300050492 Bacteria 1476
192 nmdc:mga05p37_417022_c1 3300050507 Bacteria 1563
193 nmdc:mga09592_208912_c1 3300050508 Bacteria 1691
194 nmdc:mga09592_842746_c1 3300050508 Bacteria 773
195 nmdc:mga0qj67_57013_c2 3300050509 Bacteria 1613
196 nmdc:mga0qj67_68032_c1 3300050509 Bacteria 2838
197 nmdc:mga06r32_1465766_c1 3300050510 Bacteria 623
198 nmdc:mga06r32_281613_c1 3300050510 Bacteria 1650
199 nmdc:mga0n895_115830_c1 3300050512 Bacteria 2698
200 nmdc:mga0n895_396207_c1 3300050512 Bacteria 1396
201 nmdc:mga0rr50_593941_c1 3300050513 Bacteria 944
202 nmdc:mga0a205_438381_c1 3300050515 Bacteria 1167
203 nmdc:mga0a205_503786_c1 3300050515 Bacteria 1067
204 Ga0500568_0152854 3300053139 Bacteria 853
205 Ga0501084_0038242 3300054114 Bacteria 4011
206 Ga0501084_0045274 3300054114 Bacteria 3684
207 Ga0501084_0301425 3300054114 Bacteria 1353
208 Ga0590074_056745 3300059423 Unclassified 723
209 Ga0590075_078414 3300059424 Bacteria 855
210 Ga0590077_090882 3300059426 Bacteria 708
211 Ga0501082_0017534 3300060353 Bacteria 6168
212 Ga0501082_0018701 3300060353 Bacteria 5969
213 Ga0501082_0071298 3300060353 Bacteria 2992
214 Ga0501082_0110110 3300060353 Bacteria 2384
215 Ga0530510_0008200 3300061734 Bacteria 7286
216 Ga0530510_0018507 3300061734 Bacteria 4938
217 Ga0530510_0033017 3300061734 Bacteria 3725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_1236984 Ga0501036_1236984_135_560 124
2 3300049587 Ga0501071_1445016 Ga0501071_1445016_59_484 124
3 3300005617 Ga0068859_100002435 Ga0068859_1000024355 125
4 3300006931 Ga0097620_100002435 Ga0097620_10000243516 125
5 3300025900 Ga0207710_10003234 Ga0207710_100032349 125
6 3300049576 Ga0501040_1330501 Ga0501040_1330501_12_389 125
7 3300034818 Ga0373950_0080342 Ga0373950_0080342_27_413 128
8 3300044706 Ga0466964_0470013 Ga0466964_0470013_47_478 128
9 3300031548 Ga0307408_100163369 Ga0307408_1001633693 129
10 3300031903 Ga0307407_10801202 Ga0307407_108012021 129
11 3300031995 Ga0307409_100206828 Ga0307409_1002068282 129
12 3300031995 Ga0307409_100948152 Ga0307409_1009481522 129
13 3300032002 Ga0307416_100029312 Ga0307416_1000293122 129
14 3300032002 Ga0307416_100254687 Ga0307416_1002546872 129
15 3300032005 Ga0307411_11101687 Ga0307411_111016872 129
16 3300032126 Ga0307415_100125528 Ga0307415_1001255282 129
17 3300042122 Ga0450920_003216 Ga0450920_003216_1518_1919 129
18 3300049568 Ga0501031_0001352 Ga0501031_0001352_33_422 129
19 3300049569 Ga0501032_0072684 Ga0501032_0072684_488_877 129
20 3300049570 Ga0501033_0197203 Ga0501033_0197203_1033_1422 129
21 3300049571 Ga0501034_0208153 Ga0501034_0208153_1144_1533 129
22 3300049572 Ga0501036_0003594 Ga0501036_0003594_2165_2554 129
23 3300049573 Ga0501037_0078331 Ga0501037_0078331_1077_1466 129
24 3300049574 Ga0501038_0006598 Ga0501038_0006598_8502_8891 129
25 3300049575 Ga0501039_0004940 Ga0501039_0004940_1763_2152 129
26 3300049576 Ga0501040_0010160 Ga0501040_0010160_3582_3971 129
27 3300049577 Ga0501041_0003842 Ga0501041_0003842_1816_2205 129
28 3300049578 Ga0501042_0003281 Ga0501042_0003281_7299_7688 129
29 3300049579 Ga0501043_0117506 Ga0501043_0117506_1039_1428 129
30 3300049580 Ga0501046_0030660 Ga0501046_0030660_3873_4262 129
31 3300049582 Ga0501048_0002709 Ga0501048_0002709_4105_4494 129
32 3300049584 Ga0501068_0091378 Ga0501068_0091378_417_806 129
33 3300049585 Ga0501069_0062523 Ga0501069_0062523_618_1007 129
34 3300049587 Ga0501071_0029000 Ga0501071_0029000_1611_2000 129
35 3300049588 Ga0501072_0016995 Ga0501072_0016995_3653_4042 129
36 3300049590 Ga0501074_0008042 Ga0501074_0008042_1144_1533 129
37 3300049591 Ga0501075_0058454 Ga0501075_0058454_2481_2870 129
38 3300049592 Ga0501076_0002935 Ga0501076_0002935_9792_10181 129
39 3300049593 Ga0501077_0054992 Ga0501077_0054992_959_1348 129
40 3300049741 Ga0501079_0002714 Ga0501079_0002714_2342_2731 129
41 3300049742 Ga0501080_0038974 Ga0501080_0038974_1870_2259 129
42 3300049743 Ga0501081_0016306 Ga0501081_0016306_3483_3872 129
43 3300049744 Ga0501083_0118458 Ga0501083_0118458_904_1293 129
44 3300049822 Ga0501035_0030735 Ga0501035_0030735_3969_4358 129
45 3300049823 Ga0501044_0856222 Ga0501044_0856222_246_635 129
46 3300049824 Ga0501045_0000391 Ga0501045_0000391_10168_10557 129
47 3300054114 Ga0501084_0038242 Ga0501084_0038242_2498_2887 129
48 3300060353 Ga0501082_0017534 Ga0501082_0017534_1920_2309 129
49 3300061734 Ga0530510_0033017 Ga0530510_0033017_76_465 129
50 iso_pu_bacteria 2939660829 2939661900 129
51 3300005937 Ga0081455_10392406 Ga0081455_103924061 130
52 3300006846 Ga0075430_100315322 Ga0075430_1003153223 130
53 3300006847 Ga0075431_100080124 Ga0075431_1000801241 130
54 3300031344 Ga0265316_10600980 Ga0265316_106009801 130
55 3300031911 Ga0307412_10313593 Ga0307412_103135932 130
56 3300031995 Ga0307409_100513279 Ga0307409_1005132792 130
57 3300032126 Ga0307415_100519184 Ga0307415_1005191842 130
58 3300034957 Ga0373938_0062042 Ga0373938_0062042_328_738 130
59 3300035088 Ga0373940_0013504 Ga0373940_0013504_1334_1744 130
60 3300035207 Ga0373942_0000149 Ga0373942_0000149_2736_3146 130
61 3300048907 Ga0496104_0178127 Ga0496104_0178127_268_669 130
62 3300048908 Ga0496105_0045760 Ga0496105_0045760_1418_1819 130
63 3300048913 Ga0496110_0619539 Ga0496110_0619539_225_629 130
64 3300048917 Ga0496114_0266960 Ga0496114_0266960_792_1193 130
65 3300048917 Ga0496114_0277491 Ga0496114_0277491_1019_1423 130
66 3300049572 Ga0501036_1258967 Ga0501036_1258967_175_570 130
67 3300049578 Ga0501042_0055894 Ga0501042_0055894_1695_2087 130
68 3300049582 Ga0501048_0210774 Ga0501048_0210774_227_619 130
69 3300049582 Ga0501048_0223619 Ga0501048_0223619_218_610 130
70 3300049588 Ga0501072_0926701 Ga0501072_0926701_77_469 130
71 3300049591 Ga0501075_0363314 Ga0501075_0363314_465_857 130
72 3300049592 Ga0501076_0360482 Ga0501076_0360482_27_419 130
73 3300049743 Ga0501081_0756908 Ga0501081_0756908_255_647 130
74 3300049824 Ga0501045_0066571 Ga0501045_0066571_236_628 130
75 3300050509 nmdc:mga0qj67_57013_c2 nmdc:mga0qj67_57013_c2_918_1313 130
76 3300059424 Ga0590075_078414 Ga0590075_078414_227_619 130
77 3300005364 Ga0070673_101758335 Ga0070673_1017583351 131
78 3300005535 Ga0070684_100798393 Ga0070684_1007983931 131
79 3300005544 Ga0070686_100497888 Ga0070686_1004978882 131
80 3300006871 Ga0075434_100411725 Ga0075434_1004117252 131
81 3300014325 Ga0163163_11844665 Ga0163163_118446651 131
82 3300025910 Ga0207684_11323316 Ga0207684_113233161 131
83 3300026095 Ga0207676_10836562 Ga0207676_108365622 131
84 3300031649 Ga0307514_10002316 Ga0307514_100023168 131
85 3300032126 Ga0307415_100935941 Ga0307415_1009359411 131
86 3300044694 Ga0466963_0643273 Ga0466963_0643273_338_733 131
87 3300045976 Ga0466967_0207869 Ga0466967_0207869_505_912 131
88 3300045976 Ga0466967_1536572 Ga0466967_1536572_202_627 131
89 3300045976 Ga0466967_1673407 Ga0466967_1673407_23_427 131
90 3300048911 Ga0496108_0460333 Ga0496108_0460333_485_880 131
91 3300048912 Ga0496109_0314407 Ga0496109_0314407_931_1326 131
92 3300049572 Ga0501036_0189641 Ga0501036_0189641_1054_1449 131
93 3300049573 Ga0501037_0443157 Ga0501037_0443157_468_863 131
94 3300049583 Ga0501067_0047783 Ga0501067_0047783_1946_2341 131
95 3300049586 Ga0501070_0074937 Ga0501070_0074937_592_987 131
96 3300049586 Ga0501070_0143528 Ga0501070_0143528_787_1194 131
97 3300049587 Ga0501071_0149549 Ga0501071_0149549_547_942 131
98 3300049588 Ga0501072_0892711 Ga0501072_0892711_107_502 131
99 3300049589 Ga0501073_0201798 Ga0501073_0201798_367_762 131
100 3300049590 Ga0501074_0064948 Ga0501074_0064948_1967_2362 131
101 3300049593 Ga0501077_0346091 Ga0501077_0346091_96_491 131
102 3300049741 Ga0501079_0056003 Ga0501079_0056003_16_411 131
103 3300049741 Ga0501079_0177679 Ga0501079_0177679_923_1366 131
104 3300049742 Ga0501080_0026119 Ga0501080_0026119_4776_5171 131
105 3300049823 Ga0501044_0164854 Ga0501044_0164854_1273_1716 131
106 3300050512 nmdc:mga0n895_396207_c1 nmdc:mga0n895_396207_c1_345_740 131
107 3300050513 nmdc:mga0rr50_593941_c1 nmdc:mga0rr50_593941_c1_53_448 131
108 3300050515 nmdc:mga0a205_438381_c1 nmdc:mga0a205_438381_c1_726_1121 131
109 3300054114 Ga0501084_0301425 Ga0501084_0301425_106_501 131
110 3300059426 Ga0590077_090882 Ga0590077_090882_85_480 131
111 3300060353 Ga0501082_0071298 Ga0501082_0071298_1348_1743 131
112 iso_pu_bacteria 2643221619 2644110603 131
113 iso_pu_bacteria 2910809715 2910813139 131
114 3300005841 Ga0068863_101271726 Ga0068863_1012717261 132
115 3300006186 Ga0075369_10361990 Ga0075369_103619901 132
116 3300006852 Ga0075433_10628451 Ga0075433_106284512 132
117 3300006871 Ga0075434_100346866 Ga0075434_1003468662 132
118 3300013102 Ga0157371_10000414 Ga0157371_1000041436 132
119 3300031616 Ga0307508_10069790 Ga0307508_100697904 132
120 3300041411 Ga0439466_0100740 Ga0439466_0100740_80_487 132
121 3300050512 nmdc:mga0n895_115830_c1 nmdc:mga0n895_115830_c1_1427_1825 132
122 3300050515 nmdc:mga0a205_503786_c1 nmdc:mga0a205_503786_c1_326_724 132
123 iso_pu_bacteria 2558860112 2558914444 132
124 iso_pu_bacteria 2811994880 2812363647 132
125 iso_pu_bacteria 2855386786 2855388559 132
126 3300002067 JGI24735J21928_10210673 JGI24735J21928_102106731 133
127 3300005338 Ga0068868_100204395 Ga0068868_1002043952 133
128 3300005366 Ga0070659_101215621 Ga0070659_1012156212 133
129 3300005445 Ga0070708_101288108 Ga0070708_1012881081 133
130 3300005457 Ga0070662_100643498 Ga0070662_1006434982 133
131 3300005458 Ga0070681_11212803 Ga0070681_112128031 133
132 3300005535 Ga0070684_100742608 Ga0070684_1007426081 133
133 3300005535 Ga0070684_101198080 Ga0070684_1011980801 133
134 3300005548 Ga0070665_100001091 Ga0070665_10000109128 133
135 3300005844 Ga0068862_100586793 Ga0068862_1005867932 133
136 3300005981 Ga0081538_10004330 Ga0081538_100043309 133
137 3300006038 Ga0075365_10011555 Ga0075365_100115554 133
138 3300006048 Ga0075363_100701886 Ga0075363_1007018861 133
139 3300006051 Ga0075364_10069604 Ga0075364_100696042 133
140 3300006051 Ga0075364_10083348 Ga0075364_100833482 133
141 3300006847 Ga0075431_100203573 Ga0075431_1002035732 133
142 3300006880 Ga0075429_100213415 Ga0075429_1002134152 133
143 3300009147 Ga0114129_10106662 Ga0114129_101066626 133
144 3300010375 Ga0105239_10225544 Ga0105239_102255442 133
145 3300013307 Ga0157372_11872538 Ga0157372_118725382 133
146 3300025933 Ga0207706_10394937 Ga0207706_103949372 133
147 3300025972 Ga0207668_10675948 Ga0207668_106759482 133
148 3300026023 Ga0207677_10044105 Ga0207677_100441053 133
149 3300028379 Ga0268266_10002426 Ga0268266_1000242619 133
150 3300031240 Ga0265320_10070578 Ga0265320_100705782 133
151 3300031241 Ga0265325_10275514 Ga0265325_102755141 133
152 3300031344 Ga0265316_10684854 Ga0265316_106848541 133
153 3300031712 Ga0265342_10014488 Ga0265342_100144885 133
154 3300031852 Ga0307410_11271571 Ga0307410_112715711 133
155 3300031903 Ga0307407_10029722 Ga0307407_100297223 133
156 3300032004 Ga0307414_10771293 Ga0307414_107712932 133
157 3300032005 Ga0307411_10444239 Ga0307411_104442392 133
158 3300032005 Ga0307411_11732295 Ga0307411_117322952 133
159 3300041453 Ga0451797_0265497 Ga0451797_0265497_159_632 133
160 3300041494 Ga0451837_0438911 Ga0451837_0438911_563_1036 133
161 3300041512 Ga0451853_2550968 Ga0451853_2550968_2301_2774 133
162 3300042005 Ga0439448_0013142 Ga0439448_0013142_1310_1738 133
163 3300042011 Ga0439454_030269 Ga0439454_030269_47_475 133
164 3300042012 Ga0439455_0093132 Ga0439455_0093132_18_446 133
165 3300042016 Ga0439463_006915 Ga0439463_006915_521_949 133
166 3300042125 Ga0450923_122157 Ga0450923_122157_176_595 133
167 3300044683 Ga0466965_0439256 Ga0466965_0439256_46_483 133
168 3300046459 Ga0495629_0377136 Ga0495629_0377136_466_882 133
169 3300046683 Ga0495658_0024810 Ga0495658_0024810_654_1070 133
170 3300046689 Ga0495613_0046123 Ga0495613_0046123_2110_2526 133
171 3300048912 Ga0496109_1377498 Ga0496109_1377498_73_474 133
172 3300048913 Ga0496110_0149951 Ga0496110_0149951_1640_2041 133
173 3300048914 Ga0496111_0076041 Ga0496111_0076041_1606_2007 133
174 3300048921 Ga0496118_0378314 Ga0496118_0378314_26_442 133
175 3300049568 Ga0501031_0618024 Ga0501031_0618024_101_529 133
176 3300049570 Ga0501033_0017531 Ga0501033_0017531_3282_3743 133
177 3300049571 Ga0501034_0186846 Ga0501034_0186846_889_1365 133
178 3300049572 Ga0501036_0005044 Ga0501036_0005044_8357_8818 133
179 3300049573 Ga0501037_0067688 Ga0501037_0067688_1510_1971 133
180 3300049575 Ga0501039_0008058 Ga0501039_0008058_4622_5083 133
181 3300049576 Ga0501040_0001482 Ga0501040_0001482_4279_4740 133
182 3300049577 Ga0501041_0002328 Ga0501041_0002328_1441_1902 133
183 3300049577 Ga0501041_0194687 Ga0501041_0194687_793_1221 133
184 3300049578 Ga0501042_0060946 Ga0501042_0060946_640_1101 133
185 3300049578 Ga0501042_0101483 Ga0501042_0101483_997_1446 133
186 3300049580 Ga0501046_0005122 Ga0501046_0005122_443_904 133
187 3300049582 Ga0501048_0001265 Ga0501048_0001265_3937_4398 133
188 3300049582 Ga0501048_0340361 Ga0501048_0340361_74_520 133
189 3300049584 Ga0501068_0296015 Ga0501068_0296015_221_682 133
190 3300049586 Ga0501070_1300008 Ga0501070_1300008_40_501 133
191 3300049587 Ga0501071_0017083 Ga0501071_0017083_2871_3332 133
192 3300049587 Ga0501071_0226561 Ga0501071_0226561_34_462 133
193 3300049588 Ga0501072_0001801 Ga0501072_0001801_10521_10982 133
194 3300049588 Ga0501072_0094517 Ga0501072_0094517_643_1092 133
195 3300049590 Ga0501074_0016431 Ga0501074_0016431_3209_3670 133
196 3300049590 Ga0501074_0063632 Ga0501074_0063632_1645_2091 133
197 3300049591 Ga0501075_0519940 Ga0501075_0519940_322_771 133
198 3300049592 Ga0501076_0000352 Ga0501076_0000352_13461_13922 133
199 3300049592 Ga0501076_0213920 Ga0501076_0213920_746_1195 133
200 3300049593 Ga0501077_0001396 Ga0501077_0001396_5659_6120 133
201 3300049741 Ga0501079_0014048 Ga0501079_0014048_635_1096 133
202 3300049743 Ga0501081_0010166 Ga0501081_0010166_1839_2300 133
203 3300049744 Ga0501083_0172157 Ga0501083_0172157_562_1023 133
204 3300049822 Ga0501035_0054308 Ga0501035_0054308_1939_2400 133
205 3300049824 Ga0501045_0002531 Ga0501045_0002531_3535_3996 133
206 3300049824 Ga0501045_0549337 Ga0501045_0549337_112_561 133
207 3300050490 nmdc:mga03n38_816500_c1 nmdc:mga03n38_816500_c1_10_486 133
208 3300050491 nmdc:mga00v17_109610_c1 nmdc:mga00v17_109610_c1_96_572 133
209 3300050491 nmdc:mga00v17_60955_c1 nmdc:mga00v17_60955_c1_303_770 133
210 3300050492 nmdc:mga0yw44_159546_c1 nmdc:mga0yw44_159546_c1_511_978 133
211 3300050507 nmdc:mga05p37_417022_c1 nmdc:mga05p37_417022_c1_654_1082 133
212 3300050508 nmdc:mga09592_208912_c1 nmdc:mga09592_208912_c1_632_1060 133
213 3300050508 nmdc:mga09592_842746_c1 nmdc:mga09592_842746_c1_88_513 133
214 3300050509 nmdc:mga0qj67_68032_c1 nmdc:mga0qj67_68032_c1_1481_1909 133
215 3300050510 nmdc:mga06r32_1465766_c1 nmdc:mga06r32_1465766_c1_65_538 133
216 3300050510 nmdc:mga06r32_281613_c1 nmdc:mga06r32_281613_c1_773_1201 133
217 3300053139 Ga0500568_0152854 Ga0500568_0152854_36_503 133
218 3300054114 Ga0501084_0045274 Ga0501084_0045274_2831_3292 133
219 3300059423 Ga0590074_056745 Ga0590074_056745_34_459 133
220 3300060353 Ga0501082_0018701 Ga0501082_0018701_2509_2970 133
221 3300060353 Ga0501082_0110110 Ga0501082_0110110_1907_2335 133
222 3300061734 Ga0530510_0008200 Ga0530510_0008200_5251_5712 133
223 3300061734 Ga0530510_0018507 Ga0530510_0018507_3461_3889 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

16

135

0.85

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

134

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6isd-assembly1.cif.gz_B crystal structure of arabidopsis thaliana hppd complexed with sulcotrione 0.7998 77 128
7x5w-assembly1.cif.gz_A-2 crystal structure of athppd-y18022 complex 0.7983 77 130
7ezq-assembly1.cif.gz_A complex structure of athppd with inhibitor y15832 0.7983 77 128
7cqr-assembly1.cif.gz_A complex structure of hppd with y16550 0.7981 77 128
8i0y-assembly1.cif.gz_A crystal structure of athppd-y191713 complex 0.7979 77 130
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8912 76 133 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8543 77 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8244 77 129 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8009 76 125 3.30.720.110
5yy7B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7755 77 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A420EUJ2-F1-model_v4 VOC family protein 0.9992 1 130
AF-A0A542T837-F1-model_v4 deleted 0.9991 3 130
AF-A0A1C5HRM1-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.999 1 130
AF-A0A5C4QVC2-F1-model_v4 VOC family protein 0.9965 1 130
AF-A0A2W2DTF5-F1-model_v4 Glyoxalase 0.995 1 131

Feature Viewer

pLDDT pTM Quality
94.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map