F335494

General Info

Members Datasets Scaffolds Average Seq Length
223 138 210 228

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100016124|Ga0075436_1000161246
Length 249
Sequence MKSRSSHRSPAVSPTTCAMYRATFAMSVLWLASNAAVASESTCFGTVAKGSLENGVALPSAGPNFSSYSSSAELLGRTYVHSKVRDVVVAAYKRLEGAAPRKVFVYGETGWKSGGRIRPHRTHQNGLSVDFMVPVLDKAGRSVPLPTNAFNRFGYGVEFDSAGRYGDLEIDFPALAEHLYQLDVTARAQGIGISLVIFDDAYIPRLLDTARGPYLKQNLKFLRGKPWVRHDEHYHVDFAVQCGRMKASE

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221638 Duganella sp. Root336D2 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221652 Acidovorax sp. Root402 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
90 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
91 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
96 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
97 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
98 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
99 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
100 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
101 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
114 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
115 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
135 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
136 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 0
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 45.74
Nodule 0.9
Rhizoplane 1.35
Rhizosphere 31.39
Stem 0
Stem Tuber 0
Unclassified 20.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001010 3300002739 Bacteria 5162
2 JGI25152J39213_1001394 3300002773 Bacteria 10468
3 JGI25150J39212_1002025 3300002774 Bacteria 5275
4 JGI25150J39212_1008984 3300002774 Bacteria 1927
5 JGI25150J39212_1009807 3300002774 Bacteria 1807
6 JGI25159J45721_1002507 3300002987 Bacteria 6913
7 JGI25151J46595_10005427 3300003187 Bacteria 6588
8 rootH1_10106264 3300003316 Bacteria 1470
9 rootH1_10126241 3300003316 Bacteria 1911
10 rootH1_10038272 3300003323 Bacteria 3816
11 JGI25161J50226_1001072 3300003374 Bacteria 9284
12 Ga0055526_1003673 3300003771 Bacteria 9599
13 Ga0055537_1003691 3300003773 Bacteria 4631
14 Ga0055537_1019408 3300003773 Bacteria 1057
15 Ga0055524_1000106 3300003775 Bacteria 103668
16 Ga0055524_1002435 3300003775 Bacteria 9599
17 Ga0055524_1003747 3300003775 Bacteria 7251
18 Ga0055524_1007522 3300003775 Bacteria 4612
19 Ga0055536_1009724 3300003781 Bacteria 3930
20 Ga0055534_1004306 3300003784 Bacteria 4171
21 Ga0055528_1005538 3300003790 Bacteria 5860
22 Ga0055530_10001427 3300003791 Bacteria 17505
23 Ga0055530_10003304 3300003791 Bacteria 9321
24 Ga0055530_10004400 3300003791 Bacteria 7263
25 Ga0055540_1000312 3300003792 Bacteria 43001
26 Ga0055531_10004144 3300003794 Bacteria 8951
27 Ga0055531_10023225 3300003794 Bacteria 2334
28 Ga0055543_1001367 3300004625 Bacteria 9839
29 Ga0055543_1006127 3300004625 Bacteria 2958
30 Ga0065165_1000086 3300005262 Bacteria 154235
31 Ga0065165_1002319 3300005262 Bacteria 16660
32 Ga0065165_1003909 3300005262 Bacteria 9839
33 Ga0065165_1025117 3300005262 Bacteria 1988
34 Ga0070696_100002309 3300005546 Bacteria 12582
35 Ga0068855_100013565 3300005563 Bacteria 9828
36 Ga0068864_100109845 3300005618 Bacteria 2455
37 Ga0068861_100145488 3300005719 Bacteria 1939
38 Ga0068861_100169529 3300005719 Bacteria 1808
39 Ga0068870_10064368 3300005840 Unclassified 1980
40 Ga0068860_100479337 3300005843 Bacteria 1240
41 Ga0075369_10185886 3300006186 Bacteria 957
42 Ga0075366_10090206 3300006195 Bacteria 1835
43 Ga0075366_10291771 3300006195 Bacteria 997
44 Ga0075370_10002311 3300006353 Bacteria 8795
45 Ga0075370_10144358 3300006353 Bacteria 1392
46 Ga0075370_10236504 3300006353 Bacteria 1081
47 Ga0075428_100008862 3300006844 Bacteria 11158
48 Ga0075428_100916101 3300006844 Bacteria 929
49 Ga0075430_100019199 3300006846 Bacteria 5813
50 Ga0075429_100167230 3300006880 Unclassified 1926
51 Ga0075436_100016124 3300006914 Bacteria 5115
52 Ga0079104_1000507 3300006946 Bacteria 42083
53 Ga0075435_100194595 3300007076 Bacteria 1717
54 Ga0111539_10002619 3300009094 Bacteria 23861
55 Ga0111539_10792262 3300009094 Bacteria 1103
56 Ga0114129_10108465 3300009147 Bacteria 3833
57 Ga0114129_11394962 3300009147 Bacteria 865
58 Ga0105249_10253941 3300009553 Unclassified 1744
59 Ga0157327_1018029 3300012512 Bacteria 765
60 Ga0157375_10143148 3300013308 Bacteria 2519
61 Ga0157380_10256294 3300014326 Bacteria 1586
62 Ga0157379_10090137 3300014968 Bacteria 2751
63 Ga0163161_10024828 3300017792 Unclassified 4237
64 Ga0209436_101137 3300025208 Bacteria 9853
65 Ga0209436_103444 3300025208 Bacteria 4213
66 Ga0207425_1000021 3300025245 Bacteria 367537
67 Ga0207425_1001828 3300025245 Bacteria 8235
68 Ga0207425_1003104 3300025245 Bacteria 5485
69 Ga0207425_1006159 3300025245 Bacteria 3314
70 Ga0209129_1000020 3300025258 Bacteria 457053
71 Ga0209129_1004497 3300025258 Bacteria 5412
72 Ga0209565_1000389 3300025263 Bacteria 37285
73 Ga0209565_1000632 3300025263 Bacteria 23018
74 Ga0209565_1000689 3300025263 Bacteria 21007
75 Ga0209565_1001639 3300025263 Bacteria 9413
76 Ga0209565_1002604 3300025263 Bacteria 6396
77 Ga0209565_1009247 3300025263 Bacteria 2519
78 Ga0209565_1011011 3300025263 Bacteria 2221
79 Ga0209565_1011946 3300025263 Bacteria 2093
80 Ga0209673_1003765 3300025273 Bacteria 8639
81 Ga0209130_1002284 3300025284 Bacteria 9852
82 Ga0209675_1000567 3300025291 Bacteria 26633
83 Ga0209675_1003863 3300025291 Bacteria 6894
84 Ga0209675_1005458 3300025291 Bacteria 5316
85 Ga0209675_1010511 3300025291 Bacteria 3152
86 Ga0209676_1007089 3300025292 Bacteria 5365
87 Ga0209025_1006224 3300025294 Bacteria 9362
88 Ga0209564_1000063 3300025295 Bacteria 318515
89 Ga0209564_1005260 3300025295 Bacteria 7469
90 Ga0209758_1000077 3300025297 Bacteria 268195
91 Ga0209758_1005187 3300025297 Bacteria 10244
92 Ga0209050_1000050 3300025298 Bacteria 362578
93 Ga0209050_1001569 3300025298 Bacteria 23757
94 Ga0209050_1001817 3300025298 Bacteria 20812
95 Ga0209050_1001937 3300025298 Bacteria 19686
96 Ga0209050_1005964 3300025298 Bacteria 7405
97 Ga0209256_1000225 3300025299 Bacteria 103720
98 Ga0209256_1001841 3300025299 Bacteria 19712
99 Ga0209256_1001988 3300025299 Bacteria 18381
100 Ga0209256_1004003 3300025299 Bacteria 9651
101 Ga0207426_1000956 3300025302 Bacteria 28468
102 Ga0209051_1000148 3300025303 Bacteria 132600
103 Ga0209051_1015606 3300025303 Bacteria 3484
104 Ga0209257_1000044 3300025304 Bacteria 486709
105 Ga0209257_1000075 3300025304 Bacteria 324855
106 Ga0209257_1012415 3300025304 Bacteria 3942
107 Ga0209257_1020152 3300025304 Bacteria 2477
108 Ga0207667_10062885 3300025949 Bacteria 3880
109 Ga0209281_1001900 3300027111 Bacteria 9970
110 Ga0207428_10165750 3300027907 Bacteria 1676
111 Ga0207428_10206056 3300027907 Unclassified 1479
112 Ga0207428_10373157 3300027907 Bacteria 1047
113 Ga0268264_10369734 3300028381 Bacteria 1370
114 Ga0307517_10080193 3300028786 Bacteria 2797
115 Ga0307515_10291151 3300028794 Bacteria 1328
116 Ga0307512_10084837 3300030522 Bacteria 2248
117 Ga0316180_1180846 3300030736 Bacteria 4577
118 Ga0265327_10000407 3300031251 Bacteria 79425
119 Ga0307513_10000194 3300031456 Bacteria 87921
120 Ga0307513_10042069 3300031456 Bacteria 5035
121 Ga0307513_10057395 3300031456 Bacteria 4147
122 Ga0307513_10061899 3300031456 Bacteria 3958
123 Ga0307513_10508863 3300031456 Unclassified 921
124 Ga0307408_100001917 3300031548 Bacteria 15110
125 Ga0307408_100003173 3300031548 Bacteria 11327
126 Ga0307408_100040181 3300031548 Bacteria 3311
127 Ga0307508_10000040 3300031616 Bacteria 149333
128 Ga0316576_10095467 3300031727 Bacteria 2218
129 Ga0307516_10001374 3300031730 Bacteria 33687
130 Ga0307516_10003418 3300031730 Bacteria 20404
131 Ga0307516_10378630 3300031730 Unclassified 1077
132 Ga0307416_100198205 3300032002 Bacteria 1902
133 Ga0307416_100335008 3300032002 Bacteria 1523
134 Ga0307411_10017053 3300032005 Bacteria 4125
135 Ga0316574_0044406 3300035398 Bacteria 2749
136 Ga0316574_0295311 3300035398 Unclassified 1031
137 Ga0400484_07670 3300038725 Bacteria 14827
138 Ga0400490_17198 3300038726 Bacteria 36147
139 Ga0400490_34847 3300038726 Bacteria 4926
140 Ga0400490_39262 3300038726 Bacteria 3189
141 Ga0400490_50720 3300038726 Bacteria 2256
142 Ga0400485_13205 3300038735 Bacteria 1826
143 Ga0400485_21635 3300038735 Unclassified 1663
144 Ga0400488_09637 3300038741 Bacteria 9500
145 Ga0400488_28166 3300038741 Bacteria 6611
146 Ga0400488_61490 3300038741 Bacteria 3439
147 Ga0400486_16410 3300038742 Bacteria 2441
148 Ga0400486_18031 3300038742 Bacteria 36287
149 Ga0400486_26747 3300038742 Bacteria 2064
150 Ga0400483_003861 3300039062 Bacteria 5533
151 Ga0400483_012965 3300039062 Bacteria 18187
152 Ga0400483_035025 3300039062 Bacteria 2008
153 Ga0400483_181252 3300039062 Bacteria 5325
154 Ga0400483_272307 3300039062 Bacteria 44400
155 Ga0400489_39331 3300039093 Bacteria 9722
156 Ga0400489_56055 3300039093 Bacteria 1183
157 Ga0451789_0357148 3300041443 Bacteria 3369
158 Ga0451841_0202353 3300041498 Bacteria 956
159 Ga0450890_001215 3300042127 Bacteria 3732
160 Ga0450891_000095 3300042129 Bacteria 7495
161 Ga0450892_000239 3300042130 Bacteria 6603
162 Ga0450893_0002444 3300042532 Bacteria 2894
163 Ga0451577_0000101 3300042876 Bacteria 190854
164 Ga0453684_0000040 3300044712 Bacteria 690210
165 Ga0453684_0000679 3300044712 Bacteria 121950
166 Ga0495638_0054173 3300046460 Bacteria 2494
167 Ga0495638_0101657 3300046460 Bacteria 1718
168 Ga0495585_0034870 3300046492 Bacteria 2845
169 Ga0495632_0190313 3300046519 Bacteria 937
170 Ga0495625_0004472 3300046660 Bacteria 13205
171 Ga0495670_0042258 3300046691 Bacteria 2274
172 Ga0495686_0107455 3300047472 Bacteria 1677
173 Ga0496102_0013696 3300048905 Bacteria 7030
174 Ga0496114_0004257 3300048917 Bacteria 11081
175 Ga0501076_0170633 3300049592 Bacteria 1773
176 Ga0501227_024659 3300049665 Bacteria 1405
177 Ga0501227_028116 3300049665 Unclassified 1334
178 Ga0501234_011441 3300049707 Bacteria 1387
179 Ga0501279_000309 3300049775 Bacteria 6592
180 nmdc:mga03n38_278315_c1 3300050490 Bacteria 892
181 nmdc:mga00v17_84246_c1 3300050491 Unclassified 1989
182 nmdc:mga0k408_41314_c1 3300050493 Bacteria 2655
183 nmdc:mga07m45_157050_c1 3300050496 Bacteria 1320
184 nmdc:mga07m45_238_c1 3300050496 Bacteria 22186
185 nmdc:mga07m45_246399_c1 3300050496 Bacteria 1040
186 nmdc:mga07m45_335521_c1 3300050496 Bacteria 879
187 nmdc:mga05p37_20922_c1 3300050507 Bacteria 7918
188 nmdc:mga0qj67_506100_c1 3300050509 Bacteria 971
189 nmdc:mga06r32_1016502_c1 3300050510 Unclassified 781
190 nmdc:mga08y16_624957_c1 3300050511 Bacteria 1084
191 nmdc:mga08y16_67703_c1 3300050511 Unclassified 3724
192 nmdc:mga08y16_8194_c1 3300050511 Bacteria 10936
193 nmdc:mga0rr50_445932_c1 3300050513 Bacteria 1097
194 nmdc:mga08x19_35049_c1 3300050514 Bacteria 3174
195 Ga0500651_0046582 3300053093 Bacteria 2727
196 Ga0500556_0098517 3300053104 Unclassified 1124
197 Ga0500594_0001969 3300053118 Bacteria 4441
198 Ga0500595_002919 3300053119 Bacteria 8180
199 Ga0500623_050278 3300053127 Bacteria 2099
200 Ga0500642_0024104 3300053130 Bacteria 2453
201 Ga0500642_0103558 3300053130 Bacteria 1325
202 Ga0500652_000236 3300053131 Bacteria 20936
203 Ga0500568_0015756 3300053139 Bacteria 3376
204 Ga0500577_0002487 3300053142 Bacteria 4713
205 Ga0500579_112362 3300053143 Bacteria 1364
206 Ga0500604_0003155 3300053151 Bacteria 4432
207 Ga0500622_0000205 3300053156 Bacteria 62937
208 Ga0500622_0002493 3300053156 Bacteria 13244
209 Ga0500622_0005192 3300053156 Bacteria 7885
210 Ga0590074_011785 3300059423 Bacteria 1466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100002309 Ga0070696_1000023098 174
2 3300009147 Ga0114129_11394962 Ga0114129_113949621 179
3 3300005719 Ga0068861_100145488 Ga0068861_1001454882 189
4 3300005563 Ga0068855_100013565 Ga0068855_1000135656 194
5 3300006844 Ga0075428_100008862 Ga0075428_1000088623 194
6 3300025949 Ga0207667_10062885 Ga0207667_100628854 194
7 3300035398 Ga0316574_0044406 Ga0316574_0044406_45_677 194
8 3300038742 Ga0400486_16410 Ga0400486_16410_1532_2206 194
9 3300046460 Ga0495638_0054173 Ga0495638_0054173_616_1260 194
10 3300050496 nmdc:mga07m45_335521_c1 nmdc:mga07m45_335521_c1_22_627 194
11 3300050510 nmdc:mga06r32_1016502_c1 nmdc:mga06r32_1016502_c1_11_655 194
12 iso_pu_bacteria 2643221652 2644292304 194
13 3300041498 Ga0451841_0202353 Ga0451841_0202353_271_924 195
14 3300014968 Ga0157379_10090137 Ga0157379_100901372 196
15 3300059423 Ga0590074_011785 Ga0590074_011785_15_659 196
16 3300009094 Ga0111539_10792262 Ga0111539_107922622 197
17 3300027907 Ga0207428_10373157 Ga0207428_103731572 197
18 3300031730 Ga0307516_10001374 Ga0307516_100013745 197
19 3300050511 nmdc:mga08y16_624957_c1 nmdc:mga08y16_624957_c1_256_915 197
20 3300039062 Ga0400483_012965 Ga0400483_012965_14623_15351 198
21 3300039062 Ga0400483_272307 Ga0400483_272307_37829_38557 198
22 3300053118 Ga0500594_0001969 Ga0500594_0001969_2861_3568 198
23 3300053156 Ga0500622_0002493 Ga0500622_0002493_2986_3663 198
24 3300003773 Ga0055537_1019408 Ga0055537_10194081 199
25 3300003791 Ga0055530_10003304 Ga0055530_100033046 199
26 3300025263 Ga0209565_1009247 Ga0209565_10092473 199
27 3300025298 Ga0209050_1001569 Ga0209050_100156920 199
28 3300039062 Ga0400483_035025 Ga0400483_035025_320_1030 199
29 iso_pu_bacteria 2643221638 2644216551 199
30 3300006844 Ga0075428_100916101 Ga0075428_1009161012 200
31 3300006880 Ga0075429_100167230 Ga0075429_1001672304 200
32 3300009147 Ga0114129_10108465 Ga0114129_101084655 200
33 3300050496 nmdc:mga07m45_238_c1 nmdc:mga07m45_238_c1_21097_21762 200
34 3300050507 nmdc:mga05p37_20922_c1 nmdc:mga05p37_20922_c1_5381_6052 200
35 3300053119 Ga0500595_002919 Ga0500595_002919_3512_4195 200
36 iso_pu_bacteria 2643221573 2643879590 200
37 iso_pu_bacteria 2643221720 2644662801 200
38 iso_pu_bacteria 2643221728 2644698244 200
39 3300025245 Ga0207425_1003104 Ga0207425_10031047 201
40 3300025263 Ga0209565_1000389 Ga0209565_100038929 201
41 3300025294 Ga0209025_1006224 Ga0209025_10062248 201
42 3300025297 Ga0209758_1005187 Ga0209758_10051875 201
43 3300030736 Ga0316180_1180846 Ga0316180_11808463 201
44 3300031456 Ga0307513_10508863 Ga0307513_105088631 201
45 3300038725 Ga0400484_07670 Ga0400484_07670_4660_5334 201
46 3300038726 Ga0400490_17198 Ga0400490_17198_24247_24921 201
47 3300038726 Ga0400490_34847 Ga0400490_34847_1584_2258 201
48 3300038726 Ga0400490_39262 Ga0400490_39262_193_855 201
49 3300038726 Ga0400490_50720 Ga0400490_50720_908_1585 201
50 3300038735 Ga0400485_13205 Ga0400485_13205_905_1639 201
51 3300038735 Ga0400485_21635 Ga0400485_21635_213_893 201
52 3300038741 Ga0400488_09637 Ga0400488_09637_8309_8983 201
53 3300038741 Ga0400488_28166 Ga0400488_28166_4414_5076 201
54 3300038742 Ga0400486_18031 Ga0400486_18031_10774_11454 201
55 3300038742 Ga0400486_26747 Ga0400486_26747_113_787 201
56 3300039062 Ga0400483_003861 Ga0400483_003861_4254_4934 201
57 3300039062 Ga0400483_181252 Ga0400483_181252_4069_4743 201
58 3300039093 Ga0400489_39331 Ga0400489_39331_4223_4903 201
59 3300042876 Ga0451577_0000101 Ga0451577_0000101_140684_141370 201
60 3300044712 Ga0453684_0000679 Ga0453684_0000679_32422_33108 201
61 3300050490 nmdc:mga03n38_278315_c1 nmdc:mga03n38_278315_c1_18_695 201
62 3300002773 JGI25152J39213_1001394 JGI25152J39213_10013948 202
63 3300002774 JGI25150J39212_1002025 JGI25150J39212_10020254 202
64 3300025245 Ga0207425_1000021 Ga0207425_1000021132 202
65 3300025258 Ga0209129_1000020 Ga0209129_1000020203 202
66 3300025297 Ga0209758_1000077 Ga0209758_1000077132 202
67 3300048905 Ga0496102_0013696 Ga0496102_0013696_4736_5425 202
68 3300004625 Ga0055543_1006127 Ga0055543_10061273 203
69 3300005262 Ga0065165_1000086 Ga0065165_100008623 203
70 3300006186 Ga0075369_10185886 Ga0075369_101858862 203
71 3300028794 Ga0307515_10291151 Ga0307515_102911511 203
72 iso_pu_bacteria 2585428057 2587729147 203
73 iso_pu_bacteria 2585428058 2587734780 203
74 iso_pu_bacteria 2588253510 2588293571 203
75 iso_pu_bacteria 2643221554 2643791967 203
76 iso_pu_bacteria 2643221592 2643968930 203
77 iso_pu_bacteria 2643221625 2644144062 203
78 iso_pu_bacteria 2643221648 2644273181 203
79 3300002774 JGI25150J39212_1008984 JGI25150J39212_10089842 204
80 3300003187 JGI25151J46595_10005427 JGI25151J46595_100054274 204
81 3300005262 Ga0065165_1002319 Ga0065165_100231912 204
82 3300005719 Ga0068861_100169529 Ga0068861_1001695292 204
83 3300006195 Ga0075366_10090206 Ga0075366_100902062 204
84 3300025291 Ga0209675_1005458 Ga0209675_10054585 204
85 3300025298 Ga0209050_1001817 Ga0209050_100181712 204
86 3300025303 Ga0209051_1015606 Ga0209051_10156062 204
87 3300031727 Ga0316576_10095467 Ga0316576_100954672 204
88 3300031730 Ga0307516_10378630 Ga0307516_103786302 204
89 3300032002 Ga0307416_100198205 Ga0307416_1001982052 204
90 3300035398 Ga0316574_0295311 Ga0316574_0295311_84_776 204
91 3300041443 Ga0451789_0357148 Ga0451789_0357148_269_961 204
92 3300046460 Ga0495638_0101657 Ga0495638_0101657_981_1673 204
93 3300050491 nmdc:mga00v17_84246_c1 nmdc:mga00v17_84246_c1_1146_1865 204
94 3300053093 Ga0500651_0046582 Ga0500651_0046582_1662_2354 204
95 3300053104 Ga0500556_0098517 Ga0500556_0098517_192_875 204
96 3300053127 Ga0500623_050278 Ga0500623_050278_1059_1751 204
97 3300053130 Ga0500642_0024104 Ga0500642_0024104_472_1164 204
98 3300053130 Ga0500642_0103558 Ga0500642_0103558_529_1221 204
99 3300053131 Ga0500652_000236 Ga0500652_000236_14657_15349 204
100 3300053139 Ga0500568_0015756 Ga0500568_0015756_2117_2809 204
101 3300053142 Ga0500577_0002487 Ga0500577_0002487_3768_4460 204
102 3300053143 Ga0500579_112362 Ga0500579_112362_123_815 204
103 3300053151 Ga0500604_0003155 Ga0500604_0003155_2991_3683 204
104 3300053156 Ga0500622_0000205 Ga0500622_0000205_51604_52296 204
105 3300003316 rootH1_10106264 rootH1_101062641 205
106 3300003316 rootH1_10126241 rootH1_101262412 205
107 3300003323 rootH1_10038272 rootH1_100382722 205
108 3300003775 Ga0055524_1000106 Ga0055524_1000106108 205
109 3300003791 Ga0055530_10001427 Ga0055530_100014272 205
110 3300003792 Ga0055540_1000312 Ga0055540_100031223 205
111 3300003794 Ga0055531_10023225 Ga0055531_100232254 205
112 3300006353 Ga0075370_10002311 Ga0075370_100023112 205
113 3300006846 Ga0075430_100019199 Ga0075430_10001919910 205
114 3300006914 Ga0075436_100016124 Ga0075436_1000161246 205
115 3300006946 Ga0079104_1000507 Ga0079104_100050738 205
116 3300007076 Ga0075435_100194595 Ga0075435_1001945952 205
117 3300009553 Ga0105249_10253941 Ga0105249_102539412 205
118 3300017792 Ga0163161_10024828 Ga0163161_100248282 205
119 3300025291 Ga0209675_1010511 Ga0209675_10105114 205
120 3300025298 Ga0209050_1001937 Ga0209050_100193719 205
121 3300025299 Ga0209256_1000225 Ga0209256_100022515 205
122 3300025303 Ga0209051_1000148 Ga0209051_100014832 205
123 3300025304 Ga0209257_1000044 Ga0209257_1000044457 205
124 3300027111 Ga0209281_1001900 Ga0209281_100190019 205
125 3300027907 Ga0207428_10206056 Ga0207428_102060562 205
126 3300038741 Ga0400488_61490 Ga0400488_61490_1986_2696 205
127 3300039093 Ga0400489_56055 Ga0400489_56055_227_937 205
128 3300042127 Ga0450890_001215 Ga0450890_001215_2795_3523 205
129 3300042129 Ga0450891_000095 Ga0450891_000095_5810_6538 205
130 3300042130 Ga0450892_000239 Ga0450892_000239_5814_6542 205
131 3300042532 Ga0450893_0002444 Ga0450893_0002444_1102_1830 205
132 3300046492 Ga0495585_0034870 Ga0495585_0034870_369_1079 205
133 3300046691 Ga0495670_0042258 Ga0495670_0042258_651_1376 205
134 3300048917 Ga0496114_0004257 Ga0496114_0004257_6256_6945 205
135 3300049592 Ga0501076_0170633 Ga0501076_0170633_1026_1724 205
136 3300050509 nmdc:mga0qj67_506100_c1 nmdc:mga0qj67_506100_c1_83_781 205
137 3300050513 nmdc:mga0rr50_445932_c1 nmdc:mga0rr50_445932_c1_260_955 205
138 3300050514 nmdc:mga08x19_35049_c1 nmdc:mga08x19_35049_c1_623_1318 205
139 3300005618 Ga0068864_100109845 Ga0068864_1001098452 207
140 3300005843 Ga0068860_100479337 Ga0068860_1004793371 207
141 3300028381 Ga0268264_10369734 Ga0268264_103697341 207
142 3300044712 Ga0453684_0000040 Ga0453684_0000040_685348_686040 207
143 3300002739 JGI25158J39367_1001010 JGI25158J39367_10010104 208
144 3300002774 JGI25150J39212_1009807 JGI25150J39212_10098072 208
145 3300002987 JGI25159J45721_1002507 JGI25159J45721_10025076 208
146 3300003374 JGI25161J50226_1001072 JGI25161J50226_10010726 208
147 3300003771 Ga0055526_1003673 Ga0055526_10036736 208
148 3300003773 Ga0055537_1003691 Ga0055537_10036916 208
149 3300003775 Ga0055524_1002435 Ga0055524_10024356 208
150 3300003775 Ga0055524_1003747 Ga0055524_10037473 208
151 3300003775 Ga0055524_1007522 Ga0055524_10075223 208
152 3300003781 Ga0055536_1009724 Ga0055536_10097244 208
153 3300003784 Ga0055534_1004306 Ga0055534_10043064 208
154 3300003790 Ga0055528_1005538 Ga0055528_10055385 208
155 3300003791 Ga0055530_10004400 Ga0055530_100044004 208
156 3300003794 Ga0055531_10004144 Ga0055531_100041445 208
157 3300004625 Ga0055543_1001367 Ga0055543_10013676 208
158 3300005262 Ga0065165_1003909 Ga0065165_10039096 208
159 3300005262 Ga0065165_1025117 Ga0065165_10251171 208
160 3300005840 Ga0068870_10064368 Ga0068870_100643684 208
161 3300006195 Ga0075366_10291771 Ga0075366_102917711 208
162 3300006353 Ga0075370_10144358 Ga0075370_101443581 208
163 3300006353 Ga0075370_10236504 Ga0075370_102365041 208
164 3300009094 Ga0111539_10002619 Ga0111539_1000261916 208
165 3300012512 Ga0157327_1018029 Ga0157327_10180291 208
166 3300013308 Ga0157375_10143148 Ga0157375_101431483 208
167 3300014326 Ga0157380_10256294 Ga0157380_102562942 208
168 3300025208 Ga0209436_101137 Ga0209436_1011376 208
169 3300025208 Ga0209436_103444 Ga0209436_1034442 208
170 3300025245 Ga0207425_1001828 Ga0207425_10018284 208
171 3300025245 Ga0207425_1006159 Ga0207425_10061592 208
172 3300025258 Ga0209129_1004497 Ga0209129_10044976 208
173 3300025263 Ga0209565_1000632 Ga0209565_100063217 208
174 3300025263 Ga0209565_1000689 Ga0209565_10006899 208
175 3300025263 Ga0209565_1001639 Ga0209565_10016395 208
176 3300025263 Ga0209565_1002604 Ga0209565_10026043 208
177 3300025263 Ga0209565_1011011 Ga0209565_10110112 208
178 3300025263 Ga0209565_1011946 Ga0209565_10119462 208
179 3300025273 Ga0209673_1003765 Ga0209673_10037653 208
180 3300025284 Ga0209130_1002284 Ga0209130_10022846 208
181 3300025291 Ga0209675_1000567 Ga0209675_100056710 208
182 3300025291 Ga0209675_1003863 Ga0209675_10038633 208
183 3300025292 Ga0209676_1007089 Ga0209676_10070896 208
184 3300025295 Ga0209564_1000063 Ga0209564_1000063241 208
185 3300025295 Ga0209564_1005260 Ga0209564_10052605 208
186 3300025298 Ga0209050_1000050 Ga0209050_1000050137 208
187 3300025298 Ga0209050_1005964 Ga0209050_10059644 208
188 3300025299 Ga0209256_1001841 Ga0209256_10018415 208
189 3300025299 Ga0209256_1001988 Ga0209256_10019888 208
190 3300025299 Ga0209256_1004003 Ga0209256_10040037 208
191 3300025302 Ga0207426_1000956 Ga0207426_100095622 208
192 3300025304 Ga0209257_1000075 Ga0209257_1000075137 208
193 3300025304 Ga0209257_1012415 Ga0209257_10124154 208
194 3300025304 Ga0209257_1020152 Ga0209257_10201523 208
195 3300027907 Ga0207428_10165750 Ga0207428_101657502 208
196 3300028786 Ga0307517_10080193 Ga0307517_100801933 208
197 3300030522 Ga0307512_10084837 Ga0307512_100848373 208
198 3300031251 Ga0265327_10000407 Ga0265327_1000040748 208
199 3300031456 Ga0307513_10000194 Ga0307513_1000019462 208
200 3300031456 Ga0307513_10042069 Ga0307513_100420693 208
201 3300031456 Ga0307513_10057395 Ga0307513_100573953 208
202 3300031456 Ga0307513_10061899 Ga0307513_100618994 208
203 3300031548 Ga0307408_100001917 Ga0307408_1000019175 208
204 3300031548 Ga0307408_100003173 Ga0307408_1000031736 208
205 3300031548 Ga0307408_100040181 Ga0307408_1000401813 208
206 3300031616 Ga0307508_10000040 Ga0307508_1000004047 208
207 3300031730 Ga0307516_10003418 Ga0307516_100034187 208
208 3300032002 Ga0307416_100335008 Ga0307416_1003350082 208
209 3300032005 Ga0307411_10017053 Ga0307411_100170533 208
210 3300046519 Ga0495632_0190313 Ga0495632_0190313_126_821 208
211 3300046660 Ga0495625_0004472 Ga0495625_0004472_1083_1835 208
212 3300047472 Ga0495686_0107455 Ga0495686_0107455_742_1449 208
213 3300049665 Ga0501227_024659 Ga0501227_024659_243_926 208
214 3300049665 Ga0501227_028116 Ga0501227_028116_205_927 208
215 3300049707 Ga0501234_011441 Ga0501234_011441_218_901 208
216 3300049775 Ga0501279_000309 Ga0501279_000309_5180_5860 208
217 3300050493 nmdc:mga0k408_41314_c1 nmdc:mga0k408_41314_c1_1319_2026 208
218 3300050496 nmdc:mga07m45_157050_c1 nmdc:mga07m45_157050_c1_302_997 208
219 3300050496 nmdc:mga07m45_246399_c1 nmdc:mga07m45_246399_c1_182_934 208
220 3300050511 nmdc:mga08y16_67703_c1 nmdc:mga08y16_67703_c1_728_1471 208
221 3300050511 nmdc:mga08y16_8194_c1 nmdc:mga08y16_8194_c1_275_997 208
222 3300053156 Ga0500622_0005192 Ga0500622_0005192_5421_6116 208
223 iso_pu_bacteria 2526164512 2526211670 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03411

Peptidase_M74

Penicillin-insensitive murein endopeptidase

43

146

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.7387 135 162
1tzp-assembly1.cif.gz_B mepa, inactive form without zn in p21 0.6896 19 205
3n1m-assembly1.cif.gz_B crystal structure of ihhn bound to bocfn3 0.689 24 96
6td6-assembly1.cif.gz_B structure of drosophila melanogaster dispatched bound to a modified hedgehog ligand, hhn-c85ii 0.6839 43 95
1u10-assembly3.cif.gz_F mepa, active form with zn in p1 0.6836 13 205
ID Description Score Start End Superfamily
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7387 135 162 3.90.850.10
af_P79729_1_88_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.6882 51 96 3.30.1380.10
af_Q14623_25_193_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.6327 15 96 3.30.1380.10
af_Q54SX5_582_656_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5913 98 152 3.30.40.10
af_Q54BE9_115_400_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5873 143 205 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0S2K328-F1-model_v4 Peptidase 0.9802 20 206 GO:0004252
GO:0006508
GO:0008237
GO:0030288
AF-A0A2V6PG87-F1-model_v4 Replication initiation protein 0.9789 23 207 GO:0004252
GO:0006508
GO:0008237
GO:0030288
AF-A0A4Q5M9E8-F1-model_v4 deleted 0.9784 20 207
AF-A0A4V1INY6-F1-model_v4 Replication initiation protein 0.9778 20 207 GO:0004252
GO:0006508
GO:0008237
GO:0030288
AF-A0A3B0ZF02-F1-model_v4 Replication initiation protein 0.9769 20 208 GO:0004252
GO:0006508
GO:0008237
GO:0030288

Feature Viewer

pLDDT pTM Quality
87.78 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map