F336162

General Info

Members Datasets Scaffolds Average Seq Length
223 160 446 350

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2880518877|2880519314
Length 403
Sequence GRRTCRLDSLGLFCVRTNAVECPNKGGIMALWKRAGKYYVKLTAPDGTLIRRSTGTTDRLKALEFHDKLKAELWDLARLKQKPKRTWDEAALRWLKEKAHKKSYRDDVSRIRWFTNHLRGKTLDQVSRDMIDRLISRHFARKSDRTKDLYVALIRAIFRKAMREWEWIAHVPAFKTYARSGRVRVRFLTHDQAAELMGRLPEHQREVVLFALSTGLRQGNILHLRWDQVDMTRRIVTIGYGETKNGEALGVPLNEAALGVLRRQKGKHPVHVFTFRGKRLANANTRTWRAALKACGIEDFRWHDLRHTWATWLRQNDVPTWVLQELGGWKSESMVRRYAHMSVKHLQPYADQLILPGTDPLISPVTDTKKSNCPEKLESPGHKNGHSESRPRLKLVAGLDVNS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
116 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
117 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
137 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
138 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
139 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
140 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
143 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
151 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
152 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
153 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
154 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
155 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
156 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
157 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
158 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
159 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
160 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0.45
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 0.45
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10009786 3300002067 Bacteria 3071
2 JGI25164J39214_1002796 3300002772 Bacteria 2461
3 JGI25165J46597_1000106 3300003214 Bacteria 151139
4 rootH1_10032790 3300003316 Bacteria 2963
5 rootL2_10033181 3300003322 Bacteria 2104
6 rootH1_10007994 3300003323 Bacteria 4824
7 Ga0065165_1000570 3300005262 Bacteria 54738
8 Ga0070658_10004180 3300005327 Bacteria 11812
9 Ga0070658_10005205 3300005327 Bacteria 10582
10 Ga0070658_10081296 3300005327 Bacteria 2661
11 Ga0070658_10174841 3300005327 Bacteria 1805
12 Ga0070676_10001527 3300005328 Bacteria 11703
13 Ga0070683_100050757 3300005329 Bacteria 3841
14 Ga0070683_100141603 3300005329 Bacteria 2278
15 Ga0070670_100309115 3300005331 Bacteria 1383
16 Ga0068869_100001454 3300005334 Bacteria 14015
17 Ga0068868_100001983 3300005338 Bacteria 14061
18 Ga0068868_100115363 3300005338 Bacteria 2186
19 Ga0070660_100000663 3300005339 Bacteria 22744
20 Ga0070660_100040983 3300005339 Bacteria 3527
21 Ga0070687_100100705 3300005343 Bacteria 1617
22 Ga0070675_100052618 3300005354 Bacteria 3348
23 Ga0070671_100131325 3300005355 Bacteria 2109
24 Ga0070674_100069508 3300005356 Bacteria 2484
25 Ga0070673_100000004 3300005364 Bacteria 199809
26 Ga0070708_100008360 3300005445 Bacteria 8313
27 Ga0070708_100016754 3300005445 Bacteria 6090
28 Ga0070708_100134846 3300005445 Bacteria 2286
29 Ga0070663_100272464 3300005455 Bacteria 1346
30 Ga0070678_100179325 3300005456 Bacteria 1732
31 Ga0070662_100138675 3300005457 Bacteria 1883
32 Ga0068867_100308748 3300005459 Bacteria 1306
33 Ga0070707_100022181 3300005468 Bacteria 6003
34 Ga0070698_100018957 3300005471 Bacteria 7238
35 Ga0070684_100009942 3300005535 Bacteria 7521
36 Ga0070684_100425509 3300005535 Bacteria 1226
37 Ga0068853_100000154 3300005539 Bacteria 47200
38 Ga0070665_100079462 3300005548 Bacteria 3285
39 Ga0068855_100013856 3300005563 Bacteria 9721
40 Ga0068855_100020919 3300005563 Bacteria 7846
41 Ga0068855_100213977 3300005563 Bacteria 2164
42 Ga0070664_100131060 3300005564 Bacteria 2202
43 Ga0068857_100018185 3300005577 Bacteria 6165
44 Ga0068854_100022040 3300005578 Bacteria 4332
45 Ga0068856_100004587 3300005614 Bacteria 13739
46 Ga0068852_100004422 3300005616 Bacteria 9933
47 Ga0068852_100213364 3300005616 Bacteria 1832
48 Ga0068864_100214764 3300005618 Bacteria 1773
49 Ga0068863_100397122 3300005841 Bacteria 1348
50 Ga0081455_10153418 3300005937 Bacteria 1773
51 Ga0068871_100185967 3300006358 Bacteria 1787
52 Ga0075431_100233420 3300006847 Bacteria 1873
53 Ga0075431_100275989 3300006847 Bacteria 1702
54 Ga0075433_10351062 3300006852 Bacteria 1303
55 Ga0075434_100027468 3300006871 Bacteria 5588
56 Ga0075429_100000463 3300006880 Bacteria 30330
57 Ga0068865_100000006 3300006881 Bacteria 201186
58 Ga0075435_100011946 3300007076 Bacteria 6415
59 Ga0099795_10008838 3300007788 Bacteria 2896
60 Ga0105240_10010709 3300009093 Bacteria 12868
61 Ga0105240_10126546 3300009093 Bacteria 3070
62 Ga0105245_10001073 3300009098 Bacteria 24782
63 Ga0114129_10381759 3300009147 Bacteria 1861
64 Ga0105243_10001033 3300009148 Bacteria 25571
65 Ga0105243_10497862 3300009148 Bacteria 1154
66 Ga0105242_10001671 3300009176 Bacteria 17549
67 Ga0105248_10230786 3300009177 Bacteria 2083
68 Ga0105248_10266715 3300009177 Bacteria 1927
69 Ga0105238_10000553 3300009551 Bacteria 39106
70 Ga0105238_10039618 3300009551 Bacteria 4778
71 Ga0105238_10149710 3300009551 Bacteria 2309
72 Ga0105238_10289731 3300009551 Bacteria 1619
73 Ga0105238_10327102 3300009551 Bacteria 1519
74 Ga0105239_10265163 3300010375 Bacteria 1931
75 Ga0157371_10019447 3300013102 Bacteria 5008
76 Ga0157371_10033225 3300013102 Bacteria 3708
77 Ga0157370_10006385 3300013104 Bacteria 13012
78 Ga0157370_10382073 3300013104 Bacteria 1297
79 Ga0157369_10003074 3300013105 Bacteria 19932
80 Ga0157369_10045623 3300013105 Bacteria 4765
81 Ga0157369_10094278 3300013105 Bacteria 3195
82 Ga0157369_10447149 3300013105 Bacteria 1338
83 Ga0157374_10434185 3300013296 Bacteria 1313
84 Ga0157374_10434830 3300013296 Bacteria 1312
85 Ga0157378_10000050 3300013297 Bacteria 102138
86 Ga0157378_10000451 3300013297 Bacteria 39296
87 Ga0157378_10324358 3300013297 Bacteria 1497
88 Ga0157372_10062493 3300013307 Bacteria 4173
89 Ga0157372_10264175 3300013307 Bacteria 1999
90 Ga0157372_10348329 3300013307 Bacteria 1726
91 Ga0157375_10010464 3300013308 Bacteria 8163
92 Ga0157375_10266679 3300013308 Bacteria 1874
93 Ga0157377_10193923 3300014745 Bacteria 1285
94 Ga0157377_10259050 3300014745 Bacteria 1131
95 Ga0157376_10069961 3300014969 Bacteria 2977
96 Ga0157376_10439896 3300014969 Bacteria 1269
97 Ga0182005_1000052 3300015265 Bacteria 113532
98 Ga0213872_10069909 3300021361 Bacteria 1583
99 Ga0207427_100211 3300025231 Bacteria 53121
100 Ga0209026_1001156 3300025250 Bacteria 12354
101 Ga0209233_1000003 3300025261 Bacteria 1607366
102 Ga0209455_1000441 3300025272 Bacteria 32004
103 Ga0207647_10073240 3300025904 Bacteria 2065
104 Ga0207645_10006022 3300025907 Bacteria 8721
105 Ga0207705_10001142 3300025909 Bacteria 21619
106 Ga0207705_10002873 3300025909 Bacteria 13179
107 Ga0207705_10002910 3300025909 Bacteria 13089
108 Ga0207705_10007342 3300025909 Bacteria 8098
109 Ga0207705_10049402 3300025909 Bacteria 3027
110 Ga0207684_10265613 3300025910 Bacteria 1481
111 Ga0207695_10043589 3300025913 Bacteria 4781
112 Ga0207662_10115803 3300025918 Bacteria 1676
113 Ga0207657_10000020 3300025919 Bacteria 157826
114 Ga0207657_10001366 3300025919 Bacteria 26016
115 Ga0207657_10032165 3300025919 Bacteria 4743
116 Ga0207652_10241061 3300025921 Bacteria 1630
117 Ga0207646_10018346 3300025922 Bacteria 6527
118 Ga0207694_10002320 3300025924 Bacteria 15552
119 Ga0207694_10044063 3300025924 Bacteria 3445
120 Ga0207694_10136493 3300025924 Bacteria 1970
121 Ga0207694_10385186 3300025924 Bacteria 1164
122 Ga0207687_10063092 3300025927 Bacteria 2622
123 Ga0207690_10183332 3300025932 Bacteria 1578
124 Ga0207706_10045131 3300025933 Bacteria 3905
125 Ga0207686_10000940 3300025934 Bacteria 17425
126 Ga0207709_10001104 3300025935 Bacteria 19781
127 Ga0207704_10000022 3300025938 Bacteria 146109
128 Ga0207691_10136957 3300025940 Bacteria 2159
129 Ga0207711_10187885 3300025941 Bacteria 1882
130 Ga0207689_10023282 3300025942 Bacteria 5200
131 Ga0207661_10201643 3300025944 Bacteria 1749
132 Ga0207679_10057411 3300025945 Bacteria 2879
133 Ga0207679_10315476 3300025945 Bacteria 1352
134 Ga0207667_10002757 3300025949 Bacteria 21723
135 Ga0207651_10000009 3300025960 Bacteria 199913
136 Ga0207658_10263796 3300025986 Bacteria 1469
137 Ga0207677_10000164 3300026023 Bacteria 52688
138 Ga0207639_10000635 3300026041 Bacteria 24199
139 Ga0207702_10004165 3300026078 Bacteria 12952
140 Ga0207702_10242491 3300026078 Bacteria 1689
141 Ga0207641_10151286 3300026088 Bacteria 2102
142 Ga0207648_10042367 3300026089 Bacteria 3996
143 Ga0207674_10048093 3300026116 Bacteria 4368
144 Ga0207674_10205739 3300026116 Bacteria 1917
145 Ga0207683_10014630 3300026121 Bacteria 6682
146 Ga0207698_10102471 3300026142 Bacteria 2376
147 Ga0265334_10000222 3300028573 Bacteria 32888
148 Ga0307517_10003177 3300028786 Bacteria 25825
149 Ga0265328_10000449 3300031239 Bacteria 19146
150 Ga0265331_10000109 3300031250 Bacteria 108845
151 Ga0265327_10000243 3300031251 Bacteria 108869
152 Ga0265327_10000542 3300031251 Bacteria 64581
153 Ga0307408_100085572 3300031548 Bacteria 2368
154 Ga0307411_10285988 3300032005 Bacteria 1315
155 Ga0316574_0235233 3300035398 Unclassified 1172
156 Ga0395899_0000366 3300037312 Bacteria 54708
157 Ga0395899_0000387 3300037312 Bacteria 52472
158 Ga0395899_0001232 3300037312 Bacteria 22364
159 Ga0395900_0000130 3300037418 Bacteria 126231
160 Ga0395900_0000756 3300037418 Bacteria 42958
161 Ga0395900_0010864 3300037418 Bacteria 9312
162 Ga0395898_0000274 3300037466 Bacteria 125922
163 Ga0395905_0000287 3300037471 Bacteria 73803
164 Ga0395905_0233152 3300037471 Bacteria 1721
165 Ga0395905_0242658 3300037471 Bacteria 1683
166 Ga0395905_0370093 3300037471 Bacteria 1326
167 Ga0395905_0420312 3300037471 Bacteria 1233
168 Ga0395901_0000108 3300038443 Bacteria 113046
169 Ga0395901_0002106 3300038443 Bacteria 20419
170 Ga0395901_0008214 3300038443 Bacteria 10546
171 Ga0400490_17760 3300038726 Bacteria 4877
172 Ga0400488_15767 3300038741 Bacteria 1364
173 Ga0400486_16861 3300038742 Bacteria 1420
174 Ga0400483_169969 3300039062 Bacteria 3290
175 Ga0400483_205067 3300039062 Bacteria 1870
176 Ga0400489_50568 3300039093 Bacteria 1328
177 Ga0436365_1717004 3300039437 Bacteria 1575
178 Ga0436361_0947424 3300039447 Bacteria 3210
179 Ga0439465_0002855 3300041413 Bacteria 5659
180 Ga0439445_0009349 3300042004 Bacteria 2309
181 Ga0466961_0000250 3300044693 Bacteria 36056
182 Ga0453684_0000040 3300044712 Bacteria 690210
183 Ga0453684_0010266 3300044712 Bacteria 16039
184 Ga0466970_0000081 3300044765 Bacteria 39013
185 Ga0466959_0001389 3300045049 Bacteria 14806
186 Ga0466959_0078303 3300045049 Bacteria 2384
187 Ga0495643_0016616 3300046522 Bacteria 4322
188 Ga0495654_0016440 3300046530 Bacteria 3913
189 Ga0495609_0006588 3300046538 Bacteria 5913
190 Ga0495609_0009467 3300046538 Bacteria 4712
191 Ga0495625_0000189 3300046660 Bacteria 97637
192 Ga0495625_0000454 3300046660 Bacteria 61335
193 Ga0495626_0036869 3300048091 Bacteria 2327
194 Ga0496109_0206308 3300048912 Bacteria 1848
195 Ga0501314_003138 3300049530 Bacteria 1320
196 Ga0501038_0004727 3300049574 Bacteria 12667
197 Ga0501209_000042 3300049656 Bacteria 11989
198 Ga0501223_000136 3300049663 Bacteria 20934
199 Ga0501224_000005 3300049664 Bacteria 149922
200 Ga0501233_000008 3300049668 Bacteria 34986
201 Ga0501235_000193 3300049669 Bacteria 10723
202 Ga0501225_0000239 3300049705 Bacteria 17200
203 Ga0501234_000971 3300049707 Bacteria 4537
204 Ga0501226_000021 3300049853 Bacteria 127141
205 nmdc:mga05p37_420899_c1 3300050507 Bacteria 1554
206 nmdc:mga05p37_5642_c1 3300050507 Bacteria 14712
207 nmdc:mga09592_14659_c1 3300050508 Bacteria 6396
208 nmdc:mga0n895_25950_c1 3300050512 Bacteria 5542
209 nmdc:mga0n895_544266_c1 3300050512 Bacteria 1167
210 nmdc:mga0rr50_3679_c1 3300050513 Bacteria 8886
211 nmdc:mga08x19_33567_c1 3300050514 Bacteria 3239
212 nmdc:mga0a205_93432_c1 3300050515 Bacteria 2906
213 Ga0500592_001585 3300053116 Bacteria 3680
214 Ga0500564_004611 3300053138 Bacteria 5541
215 Ga0500624_000494 3300053157 Bacteria 11519
216 Ga0500627_0000020 3300053158 Bacteria 109977
217 Ga0500661_008390 3300055283 Bacteria 1901
218 2880519314 2880518877 Bacteria 5012590
219 2809063756 2808606401 Bacteria 4586670
220 2809079626 2808606404 Bacteria 4652788
221 2809083991 2808606405 Bacteria 4586632
222 2879166175 2879163058 Bacteria 4223965
223 3000866023 3000865235 Bacteria 3106258
224 JGI24735J21928_10009786
225 JGI25164J39214_1002796
226 JGI25165J46597_1000106
227 rootH1_10032790
228 rootL2_10033181
229 rootH1_10007994
230 Ga0065165_1000570
231 Ga0070658_10004180
232 Ga0070658_10005205
233 Ga0070658_10081296
234 Ga0070658_10174841
235 Ga0070676_10001527
236 Ga0070683_100050757
237 Ga0070683_100141603
238 Ga0070670_100309115
239 Ga0068869_100001454
240 Ga0068868_100001983
241 Ga0068868_100115363
242 Ga0070660_100000663
243 Ga0070660_100040983
244 Ga0070687_100100705
245 Ga0070675_100052618
246 Ga0070671_100131325
247 Ga0070674_100069508
248 Ga0070673_100000004
249 Ga0070708_100008360
250 Ga0070708_100016754
251 Ga0070708_100134846
252 Ga0070663_100272464
253 Ga0070678_100179325
254 Ga0070662_100138675
255 Ga0068867_100308748
256 Ga0070707_100022181
257 Ga0070698_100018957
258 Ga0070684_100009942
259 Ga0070684_100425509
260 Ga0068853_100000154
261 Ga0070665_100079462
262 Ga0068855_100013856
263 Ga0068855_100020919
264 Ga0068855_100213977
265 Ga0070664_100131060
266 Ga0068857_100018185
267 Ga0068854_100022040
268 Ga0068856_100004587
269 Ga0068852_100004422
270 Ga0068852_100213364
271 Ga0068864_100214764
272 Ga0068863_100397122
273 Ga0081455_10153418
274 Ga0068871_100185967
275 Ga0075431_100233420
276 Ga0075431_100275989
277 Ga0075433_10351062
278 Ga0075434_100027468
279 Ga0075429_100000463
280 Ga0068865_100000006
281 Ga0075435_100011946
282 Ga0099795_10008838
283 Ga0105240_10010709
284 Ga0105240_10126546
285 Ga0105245_10001073
286 Ga0114129_10381759
287 Ga0105243_10001033
288 Ga0105243_10497862
289 Ga0105242_10001671
290 Ga0105248_10230786
291 Ga0105248_10266715
292 Ga0105238_10000553
293 Ga0105238_10039618
294 Ga0105238_10149710
295 Ga0105238_10289731
296 Ga0105238_10327102
297 Ga0105239_10265163
298 Ga0157371_10019447
299 Ga0157371_10033225
300 Ga0157370_10006385
301 Ga0157370_10382073
302 Ga0157369_10003074
303 Ga0157369_10045623
304 Ga0157369_10094278
305 Ga0157369_10447149
306 Ga0157374_10434185
307 Ga0157374_10434830
308 Ga0157378_10000050
309 Ga0157378_10000451
310 Ga0157378_10324358
311 Ga0157372_10062493
312 Ga0157372_10264175
313 Ga0157372_10348329
314 Ga0157375_10010464
315 Ga0157375_10266679
316 Ga0157377_10193923
317 Ga0157377_10259050
318 Ga0157376_10069961
319 Ga0157376_10439896
320 Ga0182005_1000052
321 Ga0213872_10069909
322 Ga0207427_100211
323 Ga0209026_1001156
324 Ga0209233_1000003
325 Ga0209455_1000441
326 Ga0207647_10073240
327 Ga0207645_10006022
328 Ga0207705_10001142
329 Ga0207705_10002873
330 Ga0207705_10002910
331 Ga0207705_10007342
332 Ga0207705_10049402
333 Ga0207684_10265613
334 Ga0207695_10043589
335 Ga0207662_10115803
336 Ga0207657_10000020
337 Ga0207657_10001366
338 Ga0207657_10032165
339 Ga0207652_10241061
340 Ga0207646_10018346
341 Ga0207694_10002320
342 Ga0207694_10044063
343 Ga0207694_10136493
344 Ga0207694_10385186
345 Ga0207687_10063092
346 Ga0207690_10183332
347 Ga0207706_10045131
348 Ga0207686_10000940
349 Ga0207709_10001104
350 Ga0207704_10000022
351 Ga0207691_10136957
352 Ga0207711_10187885
353 Ga0207689_10023282
354 Ga0207661_10201643
355 Ga0207679_10057411
356 Ga0207679_10315476
357 Ga0207667_10002757
358 Ga0207651_10000009
359 Ga0207658_10263796
360 Ga0207677_10000164
361 Ga0207639_10000635
362 Ga0207702_10004165
363 Ga0207702_10242491
364 Ga0207641_10151286
365 Ga0207648_10042367
366 Ga0207674_10048093
367 Ga0207674_10205739
368 Ga0207683_10014630
369 Ga0207698_10102471
370 Ga0265334_10000222
371 Ga0307517_10003177
372 Ga0265328_10000449
373 Ga0265331_10000109
374 Ga0265327_10000243
375 Ga0265327_10000542
376 Ga0307408_100085572
377 Ga0307411_10285988
378 Ga0316574_0235233
379 Ga0395899_0000366
380 Ga0395899_0000387
381 Ga0395899_0001232
382 Ga0395900_0000130
383 Ga0395900_0000756
384 Ga0395900_0010864
385 Ga0395898_0000274
386 Ga0395905_0000287
387 Ga0395905_0233152
388 Ga0395905_0242658
389 Ga0395905_0370093
390 Ga0395905_0420312
391 Ga0395901_0000108
392 Ga0395901_0002106
393 Ga0395901_0008214
394 Ga0400490_17760
395 Ga0400488_15767
396 Ga0400486_16861
397 Ga0400483_169969
398 Ga0400483_205067
399 Ga0400489_50568
400 Ga0436365_1717004
401 Ga0436361_0947424
402 Ga0439465_0002855
403 Ga0439445_0009349
404 Ga0466961_0000250
405 Ga0453684_0000040
406 Ga0453684_0010266
407 Ga0466970_0000081
408 Ga0466959_0001389
409 Ga0466959_0078303
410 Ga0495643_0016616
411 Ga0495654_0016440
412 Ga0495609_0006588
413 Ga0495609_0009467
414 Ga0495625_0000189
415 Ga0495625_0000454
416 Ga0495626_0036869
417 Ga0496109_0206308
418 Ga0501314_003138
419 Ga0501038_0004727
420 Ga0501209_000042
421 Ga0501223_000136
422 Ga0501224_000005
423 Ga0501233_000008
424 Ga0501235_000193
425 Ga0501225_0000239
426 Ga0501234_000971
427 Ga0501226_000021
428 nmdc:mga05p37_420899_c1
429 nmdc:mga05p37_5642_c1
430 nmdc:mga09592_14659_c1
431 nmdc:mga0n895_25950_c1
432 nmdc:mga0n895_544266_c1
433 nmdc:mga0rr50_3679_c1
434 nmdc:mga08x19_33567_c1
435 nmdc:mga0a205_93432_c1
436 Ga0500592_001585
437 Ga0500564_004611
438 Ga0500624_000494
439 Ga0500627_0000020
440 Ga0500661_008390
441 2880519314
442 2809063756
443 2809079626
444 2809083991
445 2879166175
446 3000866023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

186

345

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dor-assembly1.cif.gz_B p2 integrase catalytic domain in space group p21 0.8179 159 319
2v5i-assembly1.cif.gz_A structure of the receptor-binding protein of bacteriophage det7: a podoviral tailspike in a myovirus 0.8131 3 25
5zbd-assembly1.cif.gz_A crystal structure of tryptophan oxidase (c395a mutant) from chromobacterium violaceum 0.8066 3 25
5dor-assembly2.cif.gz_C p2 integrase catalytic domain in space group p21 0.8063 159 316
1ae9-assembly1.cif.gz_A structure of the lambda integrase catalytic core 0.8016 159 300
ID Description Score Start End Superfamily
af_P24218_188_370_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.9236 163 323 1.10.443.10
af_P24218_1_54_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.9222 1 53 3.30.160.60
af_P24218_1_54_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.8911 1 53 3.30.160.60
3n0qA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8334 2 26 2.102.10.10
af_P75969_82_190_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8293 57 154 1.10.150.130
ID Description Score Start End GO Terms
AF-V5BYD7-F1-model_v4 Integrase Int 0.9623 180 300 GO:0003677
GO:0006310
GO:0015074
AF-V5BYD7-F1-model_v4 Integrase Int 0.9472 180 300 GO:0003677
GO:0006310
GO:0015074
AF-A0A5K7ZBZ9-F1-model_v4 Tyr recombinase domain-containing protein 0.8838 155 324 GO:0003677
GO:0006310
GO:0015074
AF-A0A2I1QZI8-F1-model_v4 deleted 0.8508 180 333
AF-A0A1M6T5P9-F1-model_v4 Phage integrase family protein 0.8474 151 323 GO:0003677
GO:0006310
GO:0015074

Map