F337084

General Info

Members Datasets Scaffolds Average Seq Length
224 174 223 300

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0035949|Ga0495597_0035949_241_1314
Length 357
Sequence LVAKAVGEEIAGVIGKPVYEWFTNLPRMVYHYKANLLAAFLRLGHHRGLCLFFGAPTMSGTPPKQTTNDFHPEVLKLFDSYVHGGIDRRGFLDGAARFAVGGISAAALLEALSPKFAQAQQVAPTDARIKAEWVEFESPRGYAKVRGYLVRPANASGPLPCVLVVHENRGLNPHIEDITRRLALDNFIAFAPDALFPLGGYPGDEDKARELFAKLDPVKTQEDFVAAATWLRGVSGANGKLGAVGFCWGGGVVNMLATRVPELAAAVPFYGNAPALDKVGAVKAQLMLMFAENDERINAAWPPYEAALKRAKVRYEAFMYPGTQHGFNNDTTPRYDTDAAKQAWQRTVAFFNKTLRG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
114 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
164 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
165 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.55
Nodule 0
Rhizoplane 0.45
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000202 3300002773 Bacteria 39928
2 JGI25150J39212_1000146 3300002774 Bacteria 39961
3 JGI25150J39212_1014112 3300002774 Bacteria 1365
4 JGI25151J46595_10019339 3300003187 Bacteria 2895
5 JGI25153J46596_10001631 3300003215 Bacteria 13301
6 rootH1_10026113 3300003316 Bacteria 6929
7 rootL2_10034900 3300003322 Bacteria 14171
8 Ga0055524_1000223 3300003775 Bacteria 60211
9 Ga0065707_10241574 3300005295 Bacteria 1154
10 Ga0070680_100028371 3300005336 Bacteria 4489
11 Ga0068868_100087699 3300005338 Bacteria 2503
12 Ga0070660_100350559 3300005339 Bacteria 1215
13 Ga0070659_100149531 3300005366 Bacteria 1904
14 Ga0070694_100044070 3300005444 Bacteria 2985
15 Ga0070708_100073609 3300005445 Bacteria 3080
16 Ga0070681_10094456 3300005458 Bacteria 2939
17 Ga0068867_100056754 3300005459 Bacteria 2898
18 Ga0070706_100018128 3300005467 Bacteria 6494
19 Ga0070706_100062704 3300005467 Bacteria 3435
20 Ga0070707_100021939 3300005468 Bacteria 6038
21 Ga0070699_100028610 3300005518 Bacteria 4805
22 Ga0070679_100011269 3300005530 Bacteria 8523
23 Ga0070697_100100694 3300005536 Unclassified 2400
24 Ga0070697_100403418 3300005536 Bacteria 1186
25 Ga0068853_100002388 3300005539 Bacteria 14035
26 Ga0068853_100054498 3300005539 Bacteria 3446
27 Ga0070695_100012905 3300005545 Bacteria 5016
28 Ga0070696_100032794 3300005546 Bacteria 3565
29 Ga0070704_100060518 3300005549 Bacteria 2706
30 Ga0068855_100196290 3300005563 Bacteria 2274
31 Ga0070664_100009749 3300005564 Bacteria 7784
32 Ga0068857_100135231 3300005577 Bacteria 2225
33 Ga0068854_100011817 3300005578 Bacteria 5701
34 Ga0068852_100044481 3300005616 Bacteria 3771
35 Ga0068852_100045291 3300005616 Bacteria 3741
36 Ga0068864_100044673 3300005618 Bacteria 3799
37 Ga0068861_100065060 3300005719 Bacteria 2807
38 Ga0068861_100477961 3300005719 Bacteria 1122
39 Ga0068851_10231698 3300005834 Bacteria 1041
40 Ga0068862_100333279 3300005844 Bacteria 1404
41 Ga0081455_10053997 3300005937 Bacteria 3428
42 Ga0075363_100029575 3300006048 Bacteria 2830
43 Ga0075363_100085460 3300006048 Bacteria 1731
44 Ga0075432_10054944 3300006058 Bacteria 1410
45 Ga0075362_10016514 3300006177 Bacteria 3024
46 Ga0075362_10017490 3300006177 Bacteria 2954
47 Ga0075367_10036108 3300006178 Bacteria 2863
48 Ga0075367_10100589 3300006178 Bacteria 1767
49 Ga0075369_10008933 3300006186 Bacteria 3876
50 Ga0075366_10020505 3300006195 Bacteria 3836
51 Ga0075366_10040815 3300006195 Bacteria 2745
52 Ga0075366_10052967 3300006195 Bacteria 2411
53 Ga0075366_10107887 3300006195 Bacteria 1674
54 Ga0075370_10013398 3300006353 Bacteria 4357
55 Ga0075370_10029322 3300006353 Bacteria 3065
56 Ga0075370_10034104 3300006353 Bacteria 2853
57 Ga0075370_10079342 3300006353 Bacteria 1885
58 Ga0075431_100411674 3300006847 Bacteria 1352
59 Ga0075429_100599775 3300006880 Bacteria 965
60 Ga0068865_100162487 3300006881 Bacteria 1705
61 Ga0105240_10033898 3300009093 Bacteria 6593
62 Ga0105245_10381270 3300009098 Bacteria 1404
63 Ga0105237_10619481 3300009545 Bacteria 1089
64 Ga0105249_10083700 3300009553 Bacteria 2970
65 Ga0105239_10087337 3300010375 Bacteria 3437
66 Ga0157379_10105751 3300014968 Bacteria 2526
67 Ga0207425_1000001 3300025245 Bacteria 2525432
68 Ga0207425_1008287 3300025245 Bacteria 2672
69 Ga0209129_1000001 3300025258 Bacteria 1452436
70 Ga0209676_1002678 3300025292 Bacteria 12081
71 Ga0209564_1024909 3300025295 Bacteria 2031
72 Ga0209758_1000020 3300025297 Bacteria 734220
73 Ga0209256_1000028 3300025299 Bacteria 420213
74 Ga0209051_1005788 3300025303 Bacteria 7116
75 Ga0209051_1018779 3300025303 Bacteria 3045
76 Ga0209257_1007406 3300025304 Bacteria 6634
77 Ga0207684_10004791 3300025910 Bacteria 12673
78 Ga0207671_10007304 3300025914 Bacteria 9603
79 Ga0207657_10075655 3300025919 Bacteria 2841
80 Ga0207652_10054734 3300025921 Bacteria 3430
81 Ga0207646_10043570 3300025922 Bacteria 4029
82 Ga0207650_10293559 3300025925 Bacteria 1326
83 Ga0207659_10147599 3300025926 Bacteria 1833
84 Ga0207659_10155100 3300025926 Bacteria 1792
85 Ga0207670_10471947 3300025936 Bacteria 1015
86 Ga0207704_10061076 3300025938 Bacteria 2336
87 Ga0207679_10075917 3300025945 Bacteria 2552
88 Ga0207679_10598964 3300025945 Bacteria 993
89 Ga0207651_10576633 3300025960 Bacteria 981
90 Ga0207712_10039796 3300025961 Bacteria 3222
91 Ga0207640_10070157 3300025981 Bacteria 2355
92 Ga0207639_10000263 3300026041 Bacteria 37984
93 Ga0207639_10029568 3300026041 Bacteria 4013
94 Ga0207678_10219807 3300026067 Bacteria 1626
95 Ga0207648_10017126 3300026089 Bacteria 6604
96 Ga0207674_10000748 3300026116 Bacteria 42600
97 Ga0207674_10086279 3300026116 Bacteria 3133
98 Ga0207675_100088616 3300026118 Bacteria 2907
99 Ga0207675_100431713 3300026118 Bacteria 1303
100 Ga0207698_10287770 3300026142 Bacteria 1523
101 Ga0209996_1015969 3300027395 Bacteria 1028
102 Ga0209995_1000691 3300027471 Bacteria 5165
103 Ga0209971_1009533 3300027682 Bacteria 2300
104 Ga0209966_1004492 3300027695 Bacteria 2366
105 Ga0209998_10000134 3300027717 Bacteria 28816
106 Ga0209974_10059826 3300027876 Bacteria 1288
107 Ga0268265_10732331 3300028380 Bacteria 958
108 Ga0307517_10005566 3300028786 Bacteria 18930
109 Ga0307517_10121216 3300028786 Bacteria 1932
110 Ga0307515_10000358 3300028794 Bacteria 112133
111 Ga0307511_10026743 3300030521 Bacteria 5286
112 Ga0265320_10038814 3300031240 Bacteria 2386
113 Ga0265331_10065360 3300031250 Bacteria 1711
114 Ga0265327_10016209 3300031251 Bacteria 4752
115 Ga0265327_10101717 3300031251 Bacteria 1386
116 Ga0307513_10089326 3300031456 Bacteria 3146
117 Ga0307513_10136312 3300031456 Bacteria 2390
118 Ga0307408_100036952 3300031548 Bacteria 3436
119 Ga0307514_10062532 3300031649 Bacteria 2831
120 Ga0316576_10019264 3300031727 Bacteria 4675
121 Ga0307516_10036619 3300031730 Bacteria 4910
122 Ga0307516_10169325 3300031730 Bacteria 1926
123 Ga0307405_10008424 3300031731 Bacteria 5227
124 Ga0307405_10101928 3300031731 Bacteria 1927
125 Ga0307405_10110406 3300031731 Bacteria 1862
126 Ga0307413_10001534 3300031824 Bacteria 8864
127 Ga0307413_10247889 3300031824 Bacteria 1319
128 Ga0307410_10003488 3300031852 Bacteria 7894
129 Ga0307407_10138305 3300031903 Bacteria 1568
130 Ga0307412_10052005 3300031911 Bacteria 2711
131 Ga0307412_10272765 3300031911 Bacteria 1324
132 Ga0307409_100007113 3300031995 Bacteria 6661
133 Ga0307409_100030741 3300031995 Bacteria 3864
134 Ga0307409_100083093 3300031995 Bacteria 2595
135 Ga0307409_100190616 3300031995 Bacteria 1825
136 Ga0307416_100031476 3300032002 Bacteria 3994
137 Ga0307416_100190556 3300032002 Bacteria 1933
138 Ga0307416_100509853 3300032002 Bacteria 1269
139 Ga0307411_10022275 3300032005 Bacteria 3726
140 Ga0307415_100133730 3300032126 Bacteria 1882
141 Ga0307415_100406274 3300032126 Bacteria 1164
142 Ga0373961_0000010 3300035241 Bacteria 129237
143 Ga0373927_0306656 3300035695 Bacteria 1045
144 Ga0373947_0052495 3300035725 Bacteria 2456
145 Ga0395905_0439576 3300037471 Bacteria 1202
146 Ga0436361_0256657 3300039447 Bacteria 4289
147 Ga0439448_0060057 3300042005 Bacteria 1256
148 Ga0439455_0004219 3300042012 Bacteria 2831
149 Ga0450914_006760 3300042118 Bacteria 1016
150 Ga0451577_0145703 3300042876 Bacteria 2129
151 Ga0453683_0279135 3300044673 Bacteria 1067
152 Ga0453684_0063255 3300044712 Bacteria 4735
153 Ga0466971_0119491 3300044719 Bacteria 1219
154 Ga0466957_0039718 3300044842 Bacteria 2840
155 Ga0451576_0006555 3300045051 Bacteria 14245
156 Ga0466958_0000911 3300045836 Bacteria 13275
157 Ga0495590_0009776 3300046457 Bacteria 3632
158 Ga0495606_0155556 3300046507 Bacteria 1338
159 Ga0495606_0187072 3300046507 Bacteria 1190
160 Ga0495620_0049017 3300046515 Bacteria 1810
161 Ga0495632_0005045 3300046519 Bacteria 8836
162 Ga0495637_0000061 3300046520 Bacteria 95460
163 Ga0495643_0000088 3300046522 Bacteria 155458
164 Ga0495663_0000013 3300046525 Bacteria 155493
165 Ga0495621_0021759 3300046539 Bacteria 2117
166 Ga0495597_0035949 3300046542 Bacteria 2232
167 Ga0495633_0000212 3300046558 Bacteria 73041
168 Ga0495611_0052069 3300046648 Bacteria 1846
169 Ga0495625_0014804 3300046660 Bacteria 6208
170 Ga0495671_0000048 3300046692 Bacteria 155712
171 Ga0495649_0002553 3300046694 Bacteria 12758
172 Ga0495687_000722 3300047443 Bacteria 36591
173 Ga0495687_001915 3300047443 Bacteria 17872
174 Ga0495687_015778 3300047443 Bacteria 3825
175 Ga0495681_0003669 3300047470 Bacteria 10663
176 Ga0495686_0067961 3300047472 Bacteria 2199
177 Ga0495626_0077570 3300048091 Bacteria 1481
178 Ga0496106_0017642 3300048909 Bacteria 5280
179 Ga0501040_0065385 3300049576 Bacteria 2505
180 Ga0501041_0172466 3300049577 Bacteria 1354
181 Ga0501041_0243999 3300049577 Bacteria 1129
182 Ga0501042_0210338 3300049578 Bacteria 1403
183 Ga0501071_0075906 3300049587 Bacteria 2454
184 Ga0501072_0144712 3300049588 Bacteria 1895
185 Ga0501076_0097885 3300049592 Bacteria 2363
186 Ga0501076_0129902 3300049592 Bacteria 2043
187 Ga0501249_003453 3300049679 Bacteria 3174
188 Ga0501249_020510 3300049679 Unclassified 1438
189 Ga0501221_002730 3300049704 Bacteria 2904
190 Ga0501225_0010392 3300049705 Bacteria 2636
191 Ga0501225_0013948 3300049705 Bacteria 2247
192 Ga0501234_005558 3300049707 Bacteria 1974
193 Ga0501081_0014685 3300049743 Bacteria 5167
194 Ga0501279_018335 3300049775 Bacteria 985
195 Ga0501045_0120876 3300049824 Bacteria 1945
196 nmdc:mga03683_3684_c1 3300050489 Bacteria 4989
197 nmdc:mga0k408_209206_c1 3300050493 Bacteria 1165
198 nmdc:mga0k408_28346_c1 3300050493 Bacteria 3183
199 nmdc:mga0k408_5946_c1 3300050493 Bacteria 6510
200 nmdc:mga0k408_85832_c1 3300050493 Bacteria 1848
201 nmdc:mga06z11_118175_c1 3300050494 Bacteria 1476
202 nmdc:mga06z11_2304_c1 3300050494 Bacteria 7258
203 nmdc:mga07m45_11457_c1 3300050496 Bacteria 4659
204 nmdc:mga07m45_4560_c1 3300050496 Bacteria 6785
205 nmdc:mga07m45_9421_c1 3300050496 Bacteria 5067
206 nmdc:mga06r32_390185_c1 3300050510 Bacteria 1375
207 Ga0500578_0021748 3300053086 Bacteria 4119
208 Ga0500643_000584 3300053087 Bacteria 25245
209 Ga0500644_0003046 3300053088 Bacteria 4154
210 Ga0500566_0002381 3300053094 Bacteria 11125
211 Ga0500640_005580 3300053095 Bacteria 4711
212 Ga0500554_000363 3300053102 Bacteria 9800
213 Ga0500572_006361 3300053111 Bacteria 2702
214 Ga0500593_010853 3300053117 Bacteria 3831
215 Ga0500595_000441 3300053119 Bacteria 25944
216 Ga0500614_000023 3300053123 Bacteria 36107
217 Ga0500559_0046392 3300053136 Bacteria 1905
218 Ga0500568_0007900 3300053139 Bacteria 5178
219 Ga0500603_004074 3300053150 Bacteria 3126
220 Ga0501084_0316047 3300054114 Bacteria 1319
221 Ga0500661_002726 3300055283 Bacteria 3336
222 Ga0501082_0108736 3300060353 Bacteria 2400
223 Ga0501082_0133152 3300060353 Bacteria 2157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049679 Ga0501249_020510 Ga0501249_020510_658_1413 249
2 3300049775 Ga0501279_018335 Ga0501279_018335_15_770 249
3 3300005719 Ga0068861_100477961 Ga0068861_1004779611 284
4 3300026118 Ga0207675_100431713 Ga0207675_1004317131 284
5 3300005338 Ga0068868_100087699 Ga0068868_1000876992 287
6 3300005618 Ga0068864_100044673 Ga0068864_1000446734 287
7 3300014968 Ga0157379_10105751 Ga0157379_101057512 287
8 3300006177 Ga0075362_10016514 Ga0075362_100165144 288
9 3300025925 Ga0207650_10293559 Ga0207650_102935592 289
10 3300031456 Ga0307513_10136312 Ga0307513_101363121 289
11 3300031731 Ga0307405_10110406 Ga0307405_101104062 291
12 3300031995 Ga0307409_100030741 Ga0307409_1000307414 291
13 3300032126 Ga0307415_100133730 Ga0307415_1001337302 291
14 iso_pu_bacteria 2511231002 2511244065 291
15 3300028794 Ga0307515_10000358 Ga0307515_100003589 292
16 3300046520 Ga0495637_0000061 Ga0495637_0000061_35260_36156 292
17 3300046522 Ga0495643_0000088 Ga0495643_0000088_66966_67862 292
18 3300046525 Ga0495663_0000013 Ga0495663_0000013_67326_68222 292
19 3300046558 Ga0495633_0000212 Ga0495633_0000212_67453_68349 292
20 3300046692 Ga0495671_0000048 Ga0495671_0000048_67093_67989 292
21 3300047470 Ga0495681_0003669 Ga0495681_0003669_426_1322 292
22 3300053094 Ga0500566_0002381 Ga0500566_0002381_5775_6656 292
23 3300053150 Ga0500603_004074 Ga0500603_004074_548_1429 292
24 3300005339 Ga0070660_100350559 Ga0070660_1003505592 293
25 3300005366 Ga0070659_100149531 Ga0070659_1001495312 293
26 3300005539 Ga0068853_100002388 Ga0068853_10000238815 293
27 3300005563 Ga0068855_100196290 Ga0068855_1001962902 293
28 3300005577 Ga0068857_100135231 Ga0068857_1001352312 293
29 3300005616 Ga0068852_100044481 Ga0068852_1000444815 293
30 3300005834 Ga0068851_10231698 Ga0068851_102316981 293
31 3300025919 Ga0207657_10075655 Ga0207657_100756552 293
32 3300025945 Ga0207679_10598964 Ga0207679_105989641 293
33 3300026041 Ga0207639_10000263 Ga0207639_1000026339 293
34 3300026116 Ga0207674_10000748 Ga0207674_1000074827 293
35 3300026142 Ga0207698_10287770 Ga0207698_102877702 293
36 3300039447 Ga0436361_0256657 Ga0436361_0256657_1054_1938 293
37 3300047472 Ga0495686_0067961 Ga0495686_0067961_353_1246 293
38 3300049576 Ga0501040_0065385 Ga0501040_0065385_989_1876 293
39 3300049577 Ga0501041_0243999 Ga0501041_0243999_189_1076 293
40 3300049592 Ga0501076_0097885 Ga0501076_0097885_571_1458 293
41 3300049743 Ga0501081_0014685 Ga0501081_0014685_3157_4044 293
42 3300060353 Ga0501082_0133152 Ga0501082_0133152_108_995 293
43 3300005467 Ga0070706_100062704 Ga0070706_1000627043 294
44 3300005518 Ga0070699_100028610 Ga0070699_1000286104 294
45 3300005536 Ga0070697_100100694 Ga0070697_1001006942 294
46 3300005536 Ga0070697_100403418 Ga0070697_1004034181 294
47 3300005546 Ga0070696_100032794 Ga0070696_1000327942 294
48 3300005564 Ga0070664_100009749 Ga0070664_1000097497 294
49 3300006880 Ga0075429_100599775 Ga0075429_1005997751 294
50 3300025945 Ga0207679_10075917 Ga0207679_100759173 294
51 3300027395 Ga0209996_1015969 Ga0209996_10159691 294
52 3300027471 Ga0209995_1000691 Ga0209995_10006915 294
53 3300027682 Ga0209971_1009533 Ga0209971_10095332 294
54 3300027695 Ga0209966_1004492 Ga0209966_10044923 294
55 3300027717 Ga0209998_10000134 Ga0209998_100001341 294
56 3300027876 Ga0209974_10059826 Ga0209974_100598261 294
57 3300031548 Ga0307408_100036952 Ga0307408_1000369523 294
58 3300031727 Ga0316576_10019264 Ga0316576_100192643 294
59 3300031731 Ga0307405_10008424 Ga0307405_100084243 294
60 3300031731 Ga0307405_10101928 Ga0307405_101019281 294
61 3300031824 Ga0307413_10001534 Ga0307413_100015347 294
62 3300031824 Ga0307413_10247889 Ga0307413_102478891 294
63 3300031852 Ga0307410_10003488 Ga0307410_100034885 294
64 3300031903 Ga0307407_10138305 Ga0307407_101383052 294
65 3300031911 Ga0307412_10052005 Ga0307412_100520053 294
66 3300031911 Ga0307412_10272765 Ga0307412_102727652 294
67 3300031995 Ga0307409_100007113 Ga0307409_1000071134 294
68 3300031995 Ga0307409_100083093 Ga0307409_1000830932 294
69 3300031995 Ga0307409_100190616 Ga0307409_1001906162 294
70 3300032002 Ga0307416_100031476 Ga0307416_1000314765 294
71 3300032005 Ga0307411_10022275 Ga0307411_100222754 294
72 3300035695 Ga0373927_0306656 Ga0373927_0306656_106_993 294
73 3300035725 Ga0373947_0052495 Ga0373947_0052495_381_1268 294
74 3300042005 Ga0439448_0060057 Ga0439448_0060057_19_906 294
75 3300042118 Ga0450914_006760 Ga0450914_006760_41_928 294
76 3300042876 Ga0451577_0145703 Ga0451577_0145703_1052_1942 294
77 3300044712 Ga0453684_0063255 Ga0453684_0063255_495_1385 294
78 3300045051 Ga0451576_0006555 Ga0451576_0006555_9058_9948 294
79 3300046507 Ga0495606_0187072 Ga0495606_0187072_218_1129 294
80 3300049679 Ga0501249_003453 Ga0501249_003453_767_1657 294
81 3300049704 Ga0501221_002730 Ga0501221_002730_1992_2882 294
82 3300049705 Ga0501225_0010392 Ga0501225_0010392_476_1372 294
83 3300049705 Ga0501225_0013948 Ga0501225_0013948_186_1076 294
84 3300049707 Ga0501234_005558 Ga0501234_005558_289_1179 294
85 3300053087 Ga0500643_000584 Ga0500643_000584_8504_9415 294
86 3300002774 JGI25150J39212_1014112 JGI25150J39212_10141122 295
87 3300003316 rootH1_10026113 rootH1_100261132 295
88 3300003322 rootL2_10034900 rootL2_100349007 295
89 3300005444 Ga0070694_100044070 Ga0070694_1000440701 295
90 3300005445 Ga0070708_100073609 Ga0070708_1000736091 295
91 3300005459 Ga0068867_100056754 Ga0068867_1000567544 295
92 3300005467 Ga0070706_100018128 Ga0070706_1000181282 295
93 3300005468 Ga0070707_100021939 Ga0070707_1000219397 295
94 3300005539 Ga0068853_100054498 Ga0068853_1000544982 295
95 3300005545 Ga0070695_100012905 Ga0070695_1000129052 295
96 3300005549 Ga0070704_100060518 Ga0070704_1000605183 295
97 3300005578 Ga0068854_100011817 Ga0068854_1000118174 295
98 3300005616 Ga0068852_100045291 Ga0068852_1000452916 295
99 3300005844 Ga0068862_100333279 Ga0068862_1003332792 295
100 3300006048 Ga0075363_100029575 Ga0075363_1000295752 295
101 3300006048 Ga0075363_100085460 Ga0075363_1000854602 295
102 3300006177 Ga0075362_10017490 Ga0075362_100174902 295
103 3300006178 Ga0075367_10036108 Ga0075367_100361082 295
104 3300006178 Ga0075367_10100589 Ga0075367_101005892 295
105 3300006186 Ga0075369_10008933 Ga0075369_100089332 295
106 3300006195 Ga0075366_10020505 Ga0075366_100205054 295
107 3300006195 Ga0075366_10040815 Ga0075366_100408153 295
108 3300006195 Ga0075366_10052967 Ga0075366_100529674 295
109 3300006195 Ga0075366_10107887 Ga0075366_101078871 295
110 3300006353 Ga0075370_10013398 Ga0075370_100133983 295
111 3300006353 Ga0075370_10029322 Ga0075370_100293223 295
112 3300006353 Ga0075370_10034104 Ga0075370_100341042 295
113 3300006353 Ga0075370_10079342 Ga0075370_100793422 295
114 3300006847 Ga0075431_100411674 Ga0075431_1004116742 295
115 3300006881 Ga0068865_100162487 Ga0068865_1001624872 295
116 3300009093 Ga0105240_10033898 Ga0105240_100338981 295
117 3300010375 Ga0105239_10087337 Ga0105239_100873372 295
118 3300025910 Ga0207684_10004791 Ga0207684_100047919 295
119 3300025914 Ga0207671_10007304 Ga0207671_1000730410 295
120 3300025922 Ga0207646_10043570 Ga0207646_100435704 295
121 3300025926 Ga0207659_10147599 Ga0207659_101475992 295
122 3300025926 Ga0207659_10155100 Ga0207659_101551002 295
123 3300025938 Ga0207704_10061076 Ga0207704_100610762 295
124 3300025960 Ga0207651_10576633 Ga0207651_105766331 295
125 3300025981 Ga0207640_10070157 Ga0207640_100701575 295
126 3300026041 Ga0207639_10029568 Ga0207639_100295682 295
127 3300026067 Ga0207678_10219807 Ga0207678_102198071 295
128 3300026089 Ga0207648_10017126 Ga0207648_100171261 295
129 3300026116 Ga0207674_10086279 Ga0207674_100862793 295
130 3300028380 Ga0268265_10732331 Ga0268265_107323311 295
131 3300028786 Ga0307517_10005566 Ga0307517_100055664 295
132 3300028786 Ga0307517_10121216 Ga0307517_101212163 295
133 3300031250 Ga0265331_10065360 Ga0265331_100653603 295
134 3300031251 Ga0265327_10016209 Ga0265327_100162096 295
135 3300031251 Ga0265327_10101717 Ga0265327_101017172 295
136 3300031456 Ga0307513_10089326 Ga0307513_100893262 295
137 3300031649 Ga0307514_10062532 Ga0307514_100625322 295
138 3300031730 Ga0307516_10169325 Ga0307516_101693252 295
139 3300032002 Ga0307416_100190556 Ga0307416_1001905563 295
140 3300032002 Ga0307416_100509853 Ga0307416_1005098532 295
141 3300032126 Ga0307415_100406274 Ga0307415_1004062741 295
142 3300035241 Ga0373961_0000010 Ga0373961_0000010_649_1539 295
143 3300042012 Ga0439455_0004219 Ga0439455_0004219_1525_2415 295
144 3300044719 Ga0466971_0119491 Ga0466971_0119491_37_927 295
145 3300044842 Ga0466957_0039718 Ga0466957_0039718_744_1634 295
146 3300045836 Ga0466958_0000911 Ga0466958_0000911_621_1511 295
147 3300046457 Ga0495590_0009776 Ga0495590_0009776_1529_2431 295
148 3300046507 Ga0495606_0155556 Ga0495606_0155556_326_1228 295
149 3300046515 Ga0495620_0049017 Ga0495620_0049017_616_1518 295
150 3300046519 Ga0495632_0005045 Ga0495632_0005045_5161_6063 295
151 3300046539 Ga0495621_0021759 Ga0495621_0021759_189_1094 295
152 3300046542 Ga0495597_0035949 Ga0495597_0035949_241_1314 295
153 3300046648 Ga0495611_0052069 Ga0495611_0052069_677_1579 295
154 3300046660 Ga0495625_0014804 Ga0495625_0014804_4468_5370 295
155 3300046694 Ga0495649_0002553 Ga0495649_0002553_11299_12201 295
156 3300047443 Ga0495687_000722 Ga0495687_000722_18380_19453 295
157 3300047443 Ga0495687_001915 Ga0495687_001915_7103_8005 295
158 3300047443 Ga0495687_015778 Ga0495687_015778_1603_2505 295
159 3300048091 Ga0495626_0077570 Ga0495626_0077570_414_1316 295
160 3300048909 Ga0496106_0017642 Ga0496106_0017642_3796_4698 295
161 3300050489 nmdc:mga03683_3684_c1 nmdc:mga03683_3684_c1_3110_4018 295
162 3300050493 nmdc:mga0k408_209206_c1 nmdc:mga0k408_209206_c1_223_1134 295
163 3300050493 nmdc:mga0k408_28346_c1 nmdc:mga0k408_28346_c1_549_1451 295
164 3300050493 nmdc:mga0k408_5946_c1 nmdc:mga0k408_5946_c1_838_1740 295
165 3300050493 nmdc:mga0k408_85832_c1 nmdc:mga0k408_85832_c1_702_1622 295
166 3300050494 nmdc:mga06z11_118175_c1 nmdc:mga06z11_118175_c1_143_1051 295
167 3300050494 nmdc:mga06z11_2304_c1 nmdc:mga06z11_2304_c1_635_1537 295
168 3300050496 nmdc:mga07m45_11457_c1 nmdc:mga07m45_11457_c1_826_1734 295
169 3300050496 nmdc:mga07m45_4560_c1 nmdc:mga07m45_4560_c1_3143_4045 295
170 3300050496 nmdc:mga07m45_9421_c1 nmdc:mga07m45_9421_c1_1620_2540 295
171 3300050510 nmdc:mga06r32_390185_c1 nmdc:mga06r32_390185_c1_166_1056 295
172 3300053086 Ga0500578_0021748 Ga0500578_0021748_2115_3017 295
173 3300053088 Ga0500644_0003046 Ga0500644_0003046_2129_3019 295
174 3300053117 Ga0500593_010853 Ga0500593_010853_1520_2410 295
175 3300053139 Ga0500568_0007900 Ga0500568_0007900_1830_2732 295
176 3300055283 Ga0500661_002726 Ga0500661_002726_14_904 295
177 3300003187 JGI25151J46595_10019339 JGI25151J46595_100193393 296
178 3300005295 Ga0065707_10241574 Ga0065707_102415741 296
179 3300006058 Ga0075432_10054944 Ga0075432_100549441 296
180 3300009098 Ga0105245_10381270 Ga0105245_103812702 296
181 3300009545 Ga0105237_10619481 Ga0105237_106194811 296
182 3300025245 Ga0207425_1008287 Ga0207425_10082872 296
183 3300025292 Ga0209676_1002678 Ga0209676_10026788 296
184 3300025295 Ga0209564_1024909 Ga0209564_10249092 296
185 3300025303 Ga0209051_1005788 Ga0209051_10057884 296
186 3300025303 Ga0209051_1018779 Ga0209051_10187793 296
187 3300031730 Ga0307516_10036619 Ga0307516_100366192 296
188 3300037471 Ga0395905_0439576 Ga0395905_0439576_13_903 296
189 3300049577 Ga0501041_0172466 Ga0501041_0172466_382_1296 296
190 3300049578 Ga0501042_0210338 Ga0501042_0210338_17_919 296
191 3300049587 Ga0501071_0075906 Ga0501071_0075906_1331_2245 296
192 3300049588 Ga0501072_0144712 Ga0501072_0144712_826_1740 296
193 3300049592 Ga0501076_0129902 Ga0501076_0129902_105_1019 296
194 3300049824 Ga0501045_0120876 Ga0501045_0120876_26_940 296
195 3300054114 Ga0501084_0316047 Ga0501084_0316047_336_1250 296
196 3300060353 Ga0501082_0108736 Ga0501082_0108736_1300_2214 296
197 3300005336 Ga0070680_100028371 Ga0070680_1000283714 297
198 3300005458 Ga0070681_10094456 Ga0070681_100944563 297
199 3300005530 Ga0070679_100011269 Ga0070679_1000112698 297
200 3300025921 Ga0207652_10054734 Ga0207652_100547343 297
201 3300025936 Ga0207670_10471947 Ga0207670_104719471 297
202 3300002773 JGI25152J39213_1000202 JGI25152J39213_10002027 298
203 3300002774 JGI25150J39212_1000146 JGI25150J39212_100014631 298
204 3300003215 JGI25153J46596_10001631 JGI25153J46596_1000163110 298
205 3300003775 Ga0055524_1000223 Ga0055524_100022316 298
206 3300005719 Ga0068861_100065060 Ga0068861_1000650603 298
207 3300005937 Ga0081455_10053997 Ga0081455_100539972 298
208 3300009553 Ga0105249_10083700 Ga0105249_100837002 298
209 3300025245 Ga0207425_1000001 Ga0207425_10000011075 298
210 3300025258 Ga0209129_1000001 Ga0209129_1000001252 298
211 3300025297 Ga0209758_1000020 Ga0209758_1000020201 298
212 3300025299 Ga0209256_1000028 Ga0209256_1000028174 298
213 3300025304 Ga0209257_1007406 Ga0209257_10074065 298
214 3300025961 Ga0207712_10039796 Ga0207712_100397962 298
215 3300026118 Ga0207675_100088616 Ga0207675_1000886163 298
216 3300030521 Ga0307511_10026743 Ga0307511_100267433 298
217 3300031240 Ga0265320_10038814 Ga0265320_100388142 298
218 3300044673 Ga0453683_0279135 Ga0453683_0279135_90_1001 298
219 3300053095 Ga0500640_005580 Ga0500640_005580_1275_2207 298
220 3300053102 Ga0500554_000363 Ga0500554_000363_420_1352 298
221 3300053111 Ga0500572_006361 Ga0500572_006361_649_1581 298
222 3300053119 Ga0500595_000441 Ga0500595_000441_6380_7312 298
223 3300053123 Ga0500614_000023 Ga0500614_000023_4926_5858 298
224 3300053136 Ga0500559_0046392 Ga0500559_0046392_575_1507 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

145

355

0.93

PF23678

62

100

0.93

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

213

349

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9888 60 292
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9642 60 292
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8851 67 291
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8799 72 294
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8785 72 294
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9876 60 292 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9626 60 292 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8909 68 292 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8845 70 288 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8837 67 288 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2N1UQI7-F1-model_v4 Dienelactone hydrolase 0.9992 178 294 GO:0016787
AF-A0A1Q7Z4Z1-F1-model_v4 Carboxymethylenebutenolidase 0.9979 101 293 GO:0016787
AF-A0A378BQ54-F1-model_v4 Putative enzyme 0.9976 198 292 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9975 180 294 GO:0016787
AF-A0A3M3ATE5-F1-model_v4 Dienelactone hydrolase-related enzyme 0.9965 183 276 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.48 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map