F337119

General Info

Members Datasets Scaffolds Average Seq Length
224 133 224 383

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0085898|Ga0496104_0085898_828_2213
Length 445
Sequence LITPSRRVTAGAARARQSHLITSDPRCAWIAGGYAVSHRFTSAAFVLVALSAVRASAQAAPQPPPDAQALRAAIDDLKKEFDARLSALEMRLAAVEGGPQAPERAPAPGSKVFNPDMAVIGDFLGTAGRVRTDPANHVTPDPAFEMHESEASFQAVVDPYARADFFISFGEQGVDLEEGFVTLTSLPGGLLTKVGKMRAAFGKVNSLHNHVLPWADRPLVIKNLVGGEDGIDDAGVSVAHLIPNPWIFLEATGQVFRGDSGPEEQPLYQTNQRGQLSYVAHLRGYGDLSESTNLDLGFSASRGYNGSGLPQDIDDLTTSLLGFDATLRWKPLRRSIYHSFVGRSEVIWSRREQPNGLQSGMGYYVSADYQLARRWFAGVRFDGSDRAYDSTLHDTGGSALLTFWPSEFSQIRGQYRRTNYAIGPAANELLFQFQFSIGAHGAHPF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.12
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000253 3300003203 Bacteria 23771
2 JGI25406J46586_10000372 3300003203 Bacteria 20484
3 rootL2_10079171 3300003322 Unclassified 2846
4 Ga0065707_10006329 3300005295 Unclassified 4050
5 Ga0070676_10051865 3300005328 Unclassified 2410
6 Ga0070690_100009514 3300005330 Bacteria 5634
7 Ga0070670_100005884 3300005331 Bacteria 10364
8 Ga0070670_100087487 3300005331 Unclassified 2678
9 Ga0070670_100088181 3300005331 Bacteria 2667
10 Ga0070677_10008201 3300005333 Bacteria 3509
11 Ga0070666_10011319 3300005335 Bacteria 5598
12 Ga0070687_100011537 3300005343 Bacteria 3868
13 Ga0070661_100061831 3300005344 Bacteria 2749
14 Ga0070669_100000306 3300005353 Bacteria 38513
15 Ga0070669_100003950 3300005353 Bacteria 10726
16 Ga0070675_100049212 3300005354 Bacteria 3459
17 Ga0070688_100049844 3300005365 Unclassified 2607
18 Ga0070688_100067662 3300005365 Bacteria 2276
19 Ga0070713_100011204 3300005436 Bacteria 6520
20 Ga0070713_100016627 3300005436 Bacteria 5534
21 Ga0070700_100023578 3300005441 Unclassified 3601
22 Ga0070694_100016245 3300005444 Bacteria 4685
23 Ga0070694_100026428 3300005444 Archaea 3761
24 Ga0070694_100128270 3300005444 Bacteria 1829
25 Ga0068867_100005130 3300005459 Bacteria 9254
26 Ga0068867_100051645 3300005459 Bacteria 3033
27 Ga0070707_100319010 3300005468 Bacteria 1510
28 Ga0070698_100000549 3300005471 Bacteria 40084
29 Ga0070698_100022903 3300005471 Bacteria 6531
30 Ga0070698_100078030 3300005471 Bacteria 3311
31 Ga0070699_100001070 3300005518 Bacteria 25499
32 Ga0070699_100006421 3300005518 Bacteria 10241
33 Ga0070699_100019639 3300005518 Bacteria 5822
34 Ga0070699_100052256 3300005518 Unclassified 3537
35 Ga0070699_100093347 3300005518 Bacteria 2633
36 Ga0070672_100069560 3300005543 Unclassified 2795
37 Ga0070696_100022541 3300005546 Unclassified 4280
38 Ga0070696_100110453 3300005546 Unclassified 1979
39 Ga0070696_100116904 3300005546 Unclassified 1926
40 Ga0070665_100003341 3300005548 Bacteria 17173
41 Ga0070704_100000034 3300005549 Bacteria 44933
42 Ga0070704_100042725 3300005549 Bacteria 3137
43 Ga0070664_100006824 3300005564 Bacteria 9207
44 Ga0070664_100119133 3300005564 Unclassified 2310
45 Ga0070664_100219952 3300005564 Bacteria 1699
46 Ga0068857_100016603 3300005577 Bacteria 6449
47 Ga0068859_100001958 3300005617 Bacteria 20998
48 Ga0068859_100270962 3300005617 Bacteria 1790
49 Ga0068864_100021655 3300005618 Bacteria 5383
50 Ga0068861_100011857 3300005719 Bacteria 6068
51 Ga0068870_10001533 3300005840 Bacteria 9381
52 Ga0068870_10036037 3300005840 Bacteria 2543
53 Ga0068863_100007259 3300005841 Bacteria 10854
54 Ga0068858_100047919 3300005842 Bacteria 3961
55 Ga0068860_100049056 3300005843 Bacteria 4023
56 Ga0068860_100180148 3300005843 Bacteria 2042
57 Ga0068862_100000265 3300005844 Bacteria 58275
58 Ga0068862_100032604 3300005844 Bacteria 4402
59 Ga0068862_100071397 3300005844 Unclassified 2998
60 Ga0081455_10070227 3300005937 Bacteria 2909
61 Ga0081539_10000010 3300005985 Bacteria 484386
62 Ga0081539_10009718 3300005985 Bacteria 7963
63 Ga0097621_100001041 3300006237 Bacteria 19462
64 Ga0097621_100058731 3300006237 Bacteria 3147
65 Ga0068871_100008489 3300006358 Bacteria 7390
66 Ga0068871_100008986 3300006358 Bacteria 7215
67 Ga0068871_100055875 3300006358 Bacteria 3207
68 Ga0075430_100001077 3300006846 Bacteria 21644
69 Ga0075431_100005953 3300006847 Bacteria 12071
70 Ga0075431_100247007 3300006847 Unclassified 1814
71 Ga0075433_10001297 3300006852 Bacteria 18280
72 Ga0075433_10022608 3300006852 Bacteria 5280
73 Ga0075433_10203599 3300006852 Bacteria 1759
74 Ga0075434_100015365 3300006871 Bacteria 7335
75 Ga0075434_100021963 3300006871 Bacteria 6212
76 Ga0075434_100191220 3300006871 Bacteria 2067
77 Ga0075434_100252197 3300006871 Bacteria 1784
78 Ga0075429_100127080 3300006880 Bacteria 2229
79 Ga0075429_100171114 3300006880 Bacteria 1903
80 Ga0075429_100196773 3300006880 Bacteria 1766
81 Ga0068865_100051541 3300006881 Bacteria 2849
82 Ga0097620_100001958 3300006931 Bacteria 20998
83 Ga0097620_100270963 3300006931 Bacteria 1790
84 Ga0075435_100026337 3300007076 Bacteria 4535
85 Ga0075435_100033814 3300007076 Unclassified 4045
86 Ga0111539_10018992 3300009094 Bacteria 8498
87 Ga0111539_10030533 3300009094 Bacteria 6549
88 Ga0111539_10051988 3300009094 Bacteria 4879
89 Ga0105245_10013610 3300009098 Bacteria 7087
90 Ga0105247_10028438 3300009101 Bacteria 3383
91 Ga0114129_10000307 3300009147 Bacteria 57086
92 Ga0114129_10020856 3300009147 Bacteria 9309
93 Ga0114129_10022898 3300009147 Bacteria 8860
94 Ga0114129_10024820 3300009147 Bacteria 8497
95 Ga0114129_10038400 3300009147 Bacteria 6755
96 Ga0114129_10066834 3300009147 Bacteria 5014
97 Ga0114129_10082948 3300009147 Bacteria 4454
98 Ga0114129_10307887 3300009147 Unclassified 2110
99 Ga0114129_10340778 3300009147 Bacteria 1988
100 Ga0114129_10375986 3300009147 Bacteria 1877
101 Ga0105248_10041976 3300009177 Bacteria 5129
102 Ga0105248_10096856 3300009177 Bacteria 3324
103 Ga0105248_10125413 3300009177 Bacteria 2896
104 Ga0105248_10144337 3300009177 Bacteria 2686
105 Ga0105248_10151417 3300009177 Unclassified 2617
106 Ga0105237_10004823 3300009545 Bacteria 15491
107 Ga0105249_10007048 3300009553 Bacteria 9806
108 Ga0105249_10468821 3300009553 Bacteria 1300
109 Ga0157374_10029442 3300013296 Bacteria 4973
110 Ga0163162_10209757 3300013306 Unclassified 2077
111 Ga0157375_10006055 3300013308 Bacteria 10548
112 Ga0157375_10344102 3300013308 Bacteria 1657
113 Ga0163163_10000833 3300014325 Bacteria 26251
114 Ga0163163_10034484 3300014325 Bacteria 4902
115 Ga0157380_10019970 3300014326 Bacteria 5001
116 Ga0157379_10218166 3300014968 Unclassified 1728
117 Ga0207697_10002659 3300025315 Bacteria 9149
118 Ga0207710_10026651 3300025900 Bacteria 2499
119 Ga0207688_10003565 3300025901 Bacteria 8494
120 Ga0207680_10065627 3300025903 Bacteria 2229
121 Ga0207643_10001325 3300025908 Bacteria 14342
122 Ga0207643_10009070 3300025908 Bacteria 5343
123 Ga0207671_10018005 3300025914 Bacteria 5432
124 Ga0207662_10022477 3300025918 Unclassified 3617
125 Ga0207649_10111352 3300025920 Unclassified 1829
126 Ga0207681_10003377 3300025923 Bacteria 9992
127 Ga0207650_10071837 3300025925 Bacteria 2604
128 Ga0207650_10080759 3300025925 Bacteria 2466
129 Ga0207650_10099420 3300025925 Bacteria 2237
130 Ga0207659_10000470 3300025926 Bacteria 24214
131 Ga0207687_10005111 3300025927 Bacteria 8697
132 Ga0207687_10030831 3300025927 Bacteria 3619
133 Ga0207700_10018465 3300025928 Bacteria 4686
134 Ga0207644_10022420 3300025931 Bacteria 4315
135 Ga0207686_10027904 3300025934 Bacteria 3311
136 Ga0207670_10009918 3300025936 Bacteria 5457
137 Ga0207670_10042387 3300025936 Bacteria 2998
138 Ga0207691_10071282 3300025940 Unclassified 3136
139 Ga0207711_10080532 3300025941 Bacteria 2844
140 Ga0207689_10022314 3300025942 Bacteria 5323
141 Ga0207661_10153800 3300025944 Bacteria 1990
142 Ga0207679_10180789 3300025945 Bacteria 1745
143 Ga0207712_10012172 3300025961 Bacteria 5495
144 Ga0207677_10025457 3300026023 Unclassified 3693
145 Ga0207703_10008884 3300026035 Bacteria 7915
146 Ga0207703_10035285 3300026035 Bacteria 3974
147 Ga0207708_10016982 3300026075 Bacteria 5479
148 Ga0207708_10024909 3300026075 Bacteria 4526
149 Ga0207641_10132206 3300026088 Bacteria 2242
150 Ga0207648_10007270 3300026089 Bacteria 10917
151 Ga0207648_10090136 3300026089 Unclassified 2679
152 Ga0207676_10016132 3300026095 Bacteria 5404
153 Ga0207674_10007513 3300026116 Bacteria 12706
154 Ga0207674_10044359 3300026116 Bacteria 4579
155 Ga0207675_100043069 3300026118 Unclassified 4216
156 Ga0207675_100082694 3300026118 Unclassified 3011
157 Ga0207675_100123509 3300026118 Unclassified 2451
158 Ga0207683_10083520 3300026121 Bacteria 2838
159 Ga0207683_10134531 3300026121 Bacteria 2225
160 Ga0207428_10000958 3300027907 Bacteria 32012
161 Ga0268266_10026010 3300028379 Bacteria 4978
162 Ga0268265_10012569 3300028380 Bacteria 5740
163 Ga0268265_10027027 3300028380 Bacteria 4090
164 Ga0268264_10203590 3300028381 Bacteria 1812
165 Ga0268264_10216050 3300028381 Bacteria 1763
166 Ga0373926_0020340 3300035083 Bacteria 2293
167 Ga0373953_0069600 3300035117 Unclassified 1450
168 Ga0373954_0031330 3300035118 Bacteria 2455
169 Ga0373935_0027870 3300035692 Unclassified 3491
170 Ga0373927_0000944 3300035695 Bacteria 22130
171 Ga0373947_0009693 3300035725 Bacteria 5526
172 Ga0373937_0037163 3300036401 Unclassified 4438
173 Ga0495603_0022932 3300046455 Unclassified 3778
174 Ga0495629_0025888 3300046459 Bacteria 4168
175 Ga0495584_0089273 3300046491 Unclassified 1554
176 Ga0495594_0061316 3300046499 Bacteria 2081
177 Ga0495659_0002461 3300046664 Bacteria 5973
178 Ga0495659_0011395 3300046664 Unclassified 2865
179 Ga0495659_0012217 3300046664 Unclassified 2778
180 Ga0495588_0014854 3300046674 Bacteria 3737
181 Ga0495658_0044749 3300046683 Unclassified 2481
182 Ga0495669_0067590 3300046684 Bacteria 1625
183 Ga0495613_0000865 3300046689 Bacteria 23237
184 Ga0495600_0028825 3300046809 Bacteria 3593
185 Ga0495604_0020219 3300047317 Bacteria 5320
186 Ga0495674_0016885 3300047319 Bacteria 6808
187 Ga0495676_0025407 3300047321 Bacteria 5115
188 Ga0495684_0003376 3300047471 Bacteria 12533
189 Ga0496101_0006393 3300048904 Bacteria 7582
190 Ga0496104_0006403 3300048907 Bacteria 10354
191 Ga0496104_0056328 3300048907 Bacteria 3717
192 Ga0496104_0085898 3300048907 Bacteria 3004
193 Ga0496105_0062347 3300048908 Bacteria 3077
194 Ga0496108_0003082 3300048911 Bacteria 13396
195 Ga0496112_0015039 3300048915 Bacteria 7203
196 Ga0501068_0043722 3300049584 Unclassified 2696
197 Ga0501069_0047768 3300049585 Unclassified 2376
198 nmdc:mga05p37_16166_c1 3300050507 Bacteria 8984
199 nmdc:mga05p37_252448_c1 3300050507 Unclassified 2115
200 nmdc:mga05p37_67031_c1 3300050507 Bacteria 4416
201 nmdc:mga05p37_71448_c1 3300050507 Bacteria 4269
202 nmdc:mga09592_107101_c1 3300050508 Bacteria 2398
203 nmdc:mga09592_186899_c1 3300050508 Bacteria 1793
204 nmdc:mga0qj67_1253_c1 3300050509 Bacteria 17772
205 nmdc:mga06r32_497_c1 3300050510 Bacteria 33939
206 nmdc:mga08y16_8850_c1 3300050511 Bacteria 10567
207 nmdc:mga0n895_127010_c1 3300050512 Bacteria 2574
208 nmdc:mga0n895_14162_c1 3300050512 Bacteria 7232
209 nmdc:mga0n895_17193_c1 3300050512 Bacteria 6664
210 nmdc:mga0n895_29527_c1 3300050512 Bacteria 5232
211 nmdc:mga0n895_564847_c1 3300050512 Unclassified 1143
212 nmdc:mga0rr50_197798_c1 3300050513 Unclassified 1650
213 nmdc:mga0rr50_39975_c1 3300050513 Bacteria 3406
214 nmdc:mga0rr50_6462_c1 3300050513 Bacteria 7138
215 nmdc:mga08x19_137272_c1 3300050514 Bacteria 1649
216 nmdc:mga08x19_188016_c1 3300050514 Bacteria 1412
217 nmdc:mga0a205_1558_c1 3300050515 Bacteria 19618
218 nmdc:mga0a205_2045_c1 3300050515 Bacteria 17625
219 nmdc:mga0a205_33344_c1 3300050515 Bacteria 4937
220 nmdc:mga0a205_37095_c1 3300050515 Bacteria 4687
221 nmdc:mga0a205_52932_c1 3300050515 Bacteria 3918
222 nmdc:mga0a205_93046_c1 3300050515 Bacteria 2913
223 Ga0495601_0000195 3300053077 Bacteria 32156
224 Ga0495595_0036832 3300053084 Unclassified 2222

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100123509 Ga0207675_1001235091 313
2 3300046674 Ga0495588_0014854 Ga0495588_0014854_2713_3696 326
3 3300009553 Ga0105249_10468821 Ga0105249_104688211 333
4 3300046491 Ga0495584_0089273 Ga0495584_0089273_71_1087 334
5 3300050512 nmdc:mga0n895_564847_c1 nmdc:mga0n895_564847_c1_10_1062 336
6 3300035118 Ga0373954_0031330 Ga0373954_0031330_1149_2381 338
7 3300046684 Ga0495669_0067590 Ga0495669_0067590_39_1055 338
8 3300003322 rootL2_10079171 rootL2_100791712 339
9 3300009098 Ga0105245_10013610 Ga0105245_100136106 347
10 3300048908 Ga0496105_0062347 Ga0496105_0062347_1735_3045 348
11 3300005436 Ga0070713_100016627 Ga0070713_1000166273 349
12 3300005564 Ga0070664_100219952 Ga0070664_1002199522 349
13 3300025928 Ga0207700_10018465 Ga0207700_100184656 349
14 3300005331 Ga0070670_100005884 Ga0070670_10000588411 351
15 3300025925 Ga0207650_10071837 Ga0207650_100718372 351
16 3300005577 Ga0068857_100016603 Ga0068857_1000166032 352
17 3300005840 Ga0068870_10036037 Ga0068870_100360372 352
18 3300025908 Ga0207643_10009070 Ga0207643_100090703 352
19 3300025945 Ga0207679_10180789 Ga0207679_101807892 352
20 3300026116 Ga0207674_10044359 Ga0207674_100443595 352
21 3300005518 Ga0070699_100093347 Ga0070699_1000933472 353
22 3300005546 Ga0070696_100110453 Ga0070696_1001104531 353
23 3300006871 Ga0075434_100021963 Ga0075434_1000219634 353
24 3300046499 Ga0495594_0061316 Ga0495594_0061316_310_1581 353
25 3300050512 nmdc:mga0n895_127010_c1 nmdc:mga0n895_127010_c1_885_2207 353
26 3300005330 Ga0070690_100009514 Ga0070690_1000095142 354
27 3300005353 Ga0070669_100000306 Ga0070669_10000030613 354
28 3300005441 Ga0070700_100023578 Ga0070700_1000235781 354
29 3300005444 Ga0070694_100016245 Ga0070694_1000162455 354
30 3300005459 Ga0068867_100005130 Ga0068867_1000051309 354
31 3300005518 Ga0070699_100052256 Ga0070699_1000522563 354
32 3300005549 Ga0070704_100000034 Ga0070704_10000003427 354
33 3300005617 Ga0068859_100001958 Ga0068859_1000019585 354
34 3300005618 Ga0068864_100021655 Ga0068864_1000216552 354
35 3300005719 Ga0068861_100011857 Ga0068861_1000118573 354
36 3300005840 Ga0068870_10001533 Ga0068870_100015333 354
37 3300005844 Ga0068862_100000265 Ga0068862_10000026515 354
38 3300006852 Ga0075433_10022608 Ga0075433_100226086 354
39 3300006931 Ga0097620_100001958 Ga0097620_1000019585 354
40 3300009094 Ga0111539_10018992 Ga0111539_100189929 354
41 3300009553 Ga0105249_10007048 Ga0105249_1000704811 354
42 3300013308 Ga0157375_10006055 Ga0157375_100060553 354
43 3300025908 Ga0207643_10001325 Ga0207643_100013253 354
44 3300025936 Ga0207670_10009918 Ga0207670_100099187 354
45 3300025961 Ga0207712_10012172 Ga0207712_100121722 354
46 3300026075 Ga0207708_10024909 Ga0207708_100249094 354
47 3300026089 Ga0207648_10007270 Ga0207648_100072704 354
48 3300026095 Ga0207676_10016132 Ga0207676_100161323 354
49 3300026116 Ga0207674_10007513 Ga0207674_1000751314 354
50 3300026118 Ga0207675_100043069 Ga0207675_1000430694 354
51 3300027907 Ga0207428_10000958 Ga0207428_1000095821 354
52 3300050511 nmdc:mga08y16_8850_c1 nmdc:mga08y16_8850_c1_859_2166 354
53 3300005365 Ga0070688_100049844 Ga0070688_1000498442 355
54 3300005937 Ga0081455_10070227 Ga0081455_100702272 355
55 3300046689 Ga0495613_0000865 Ga0495613_0000865_17559_18851 355
56 3300046809 Ga0495600_0028825 Ga0495600_0028825_1121_2413 355
57 3300047317 Ga0495604_0020219 Ga0495604_0020219_864_2156 355
58 3300047319 Ga0495674_0016885 Ga0495674_0016885_1681_2973 355
59 3300047471 Ga0495684_0003376 Ga0495684_0003376_6111_7403 355
60 3300053077 Ga0495601_0000195 Ga0495601_0000195_4216_5508 355
61 3300005353 Ga0070669_100003950 Ga0070669_10000395011 356
62 3300005844 Ga0068862_100071397 Ga0068862_1000713974 356
63 3300006358 Ga0068871_100055875 Ga0068871_1000558752 356
64 3300009545 Ga0105237_10004823 Ga0105237_100048239 356
65 3300025923 Ga0207681_10003377 Ga0207681_100033778 356
66 3300025927 Ga0207687_10005111 Ga0207687_100051114 356
67 3300028380 Ga0268265_10027027 Ga0268265_100270274 356
68 3300007076 Ga0075435_100033814 Ga0075435_1000338142 358
69 3300009147 Ga0114129_10022898 Ga0114129_100228989 358
70 3300026118 Ga0207675_100082694 Ga0207675_1000826942 358
71 3300046664 Ga0495659_0002461 Ga0495659_0002461_916_2160 358
72 3300050507 nmdc:mga05p37_16166_c1 nmdc:mga05p37_16166_c1_1444_2706 358
73 3300050508 nmdc:mga09592_186899_c1 nmdc:mga09592_186899_c1_65_1333 358
74 3300050515 nmdc:mga0a205_93046_c1 nmdc:mga0a205_93046_c1_1011_2279 358
75 3300009101 Ga0105247_10028438 Ga0105247_100284384 359
76 3300009177 Ga0105248_10041976 Ga0105248_100419764 359
77 3300014325 Ga0163163_10000833 Ga0163163_1000083318 359
78 3300035692 Ga0373935_0027870 Ga0373935_0027870_535_1863 359
79 3300046664 Ga0495659_0011395 Ga0495659_0011395_1041_2327 359
80 3300049584 Ga0501068_0043722 Ga0501068_0043722_33_1340 359
81 3300049585 Ga0501069_0047768 Ga0501069_0047768_982_2289 359
82 3300009177 Ga0105248_10151417 Ga0105248_101514172 362
83 3300026088 Ga0207641_10132206 Ga0207641_101322061 362
84 3300048907 Ga0496104_0006403 Ga0496104_0006403_8076_9386 362
85 3300050514 nmdc:mga08x19_188016_c1 nmdc:mga08x19_188016_c1_54_1373 362
86 3300005295 Ga0065707_10006329 Ga0065707_100063294 363
87 3300005444 Ga0070694_100026428 Ga0070694_1000264282 363
88 3300005468 Ga0070707_100319010 Ga0070707_1003190101 363
89 3300005471 Ga0070698_100022903 Ga0070698_1000229032 363
90 3300005518 Ga0070699_100019639 Ga0070699_1000196396 363
91 3300005546 Ga0070696_100116904 Ga0070696_1001169041 363
92 3300005549 Ga0070704_100042725 Ga0070704_1000427252 363
93 3300006852 Ga0075433_10001297 Ga0075433_1000129717 363
94 3300006852 Ga0075433_10203599 Ga0075433_102035992 363
95 3300006871 Ga0075434_100191220 Ga0075434_1001912202 363
96 3300006880 Ga0075429_100171114 Ga0075429_1001711142 363
97 3300009094 Ga0111539_10030533 Ga0111539_100305336 363
98 3300009147 Ga0114129_10038400 Ga0114129_100384004 363
99 3300009147 Ga0114129_10082948 Ga0114129_100829484 363
100 3300009147 Ga0114129_10375986 Ga0114129_103759862 363
101 3300050512 nmdc:mga0n895_29527_c1 nmdc:mga0n895_29527_c1_2417_3721 363
102 3300050513 nmdc:mga0rr50_197798_c1 nmdc:mga0rr50_197798_c1_96_1418 363
103 3300050513 nmdc:mga0rr50_39975_c1 nmdc:mga0rr50_39975_c1_42_1346 363
104 3300050515 nmdc:mga0a205_1558_c1 nmdc:mga0a205_1558_c1_17609_18931 363
105 3300050515 nmdc:mga0a205_37095_c1 nmdc:mga0a205_37095_c1_244_1548 363
106 3300005471 Ga0070698_100078030 Ga0070698_1000780301 364
107 3300005843 Ga0068860_100180148 Ga0068860_1001801482 364
108 3300006871 Ga0075434_100015365 Ga0075434_1000153654 364
109 3300007076 Ga0075435_100026337 Ga0075435_1000263373 364
110 3300028381 Ga0268264_10203590 Ga0268264_102035902 364
111 3300050512 nmdc:mga0n895_14162_c1 nmdc:mga0n895_14162_c1_4245_5579 364
112 3300050513 nmdc:mga0rr50_6462_c1 nmdc:mga0rr50_6462_c1_3542_4876 364
113 3300050515 nmdc:mga0a205_2045_c1 nmdc:mga0a205_2045_c1_2503_3837 364
114 3300006358 Ga0068871_100008489 Ga0068871_1000084894 365
115 3300013296 Ga0157374_10029442 Ga0157374_100294425 365
116 3300013308 Ga0157375_10344102 Ga0157375_103441021 365
117 3300025914 Ga0207671_10018005 Ga0207671_100180053 365
118 3300025944 Ga0207661_10153800 Ga0207661_101538001 365
119 3300035725 Ga0373947_0009693 Ga0373947_0009693_1742_3058 365
120 3300048904 Ga0496101_0006393 Ga0496101_0006393_2310_3617 365
121 3300050507 nmdc:mga05p37_67031_c1 nmdc:mga05p37_67031_c1_2457_3743 365
122 3300050515 nmdc:mga0a205_52932_c1 nmdc:mga0a205_52932_c1_293_1579 365
123 3300005436 Ga0070713_100011204 Ga0070713_1000112046 366
124 3300005841 Ga0068863_100007259 Ga0068863_1000072597 366
125 3300006847 Ga0075431_100247007 Ga0075431_1002470072 366
126 3300006880 Ga0075429_100196773 Ga0075429_1001967731 366
127 3300026121 Ga0207683_10083520 Ga0207683_100835203 366
128 3300035083 Ga0373926_0020340 Ga0373926_0020340_611_1864 366
129 3300035695 Ga0373927_0000944 Ga0373927_0000944_12868_14121 366
130 3300005444 Ga0070694_100128270 Ga0070694_1001282701 367
131 3300005471 Ga0070698_100000549 Ga0070698_1000005495 367
132 3300005518 Ga0070699_100001070 Ga0070699_10000107019 367
133 3300005546 Ga0070696_100022541 Ga0070696_1000225415 367
134 3300009147 Ga0114129_10307887 Ga0114129_103078872 367
135 3300009147 Ga0114129_10066834 Ga0114129_100668342 368
136 3300009177 Ga0105248_10144337 Ga0105248_101443371 368
137 3300014325 Ga0163163_10034484 Ga0163163_100344844 368
138 3300025941 Ga0207711_10080532 Ga0207711_100805322 368
139 3300028381 Ga0268264_10216050 Ga0268264_102160502 368
140 3300006237 Ga0097621_100001041 Ga0097621_10000104114 369
141 3300006358 Ga0068871_100008986 Ga0068871_1000089862 369
142 3300009177 Ga0105248_10096856 Ga0105248_100968563 369
143 3300050507 nmdc:mga05p37_71448_c1 nmdc:mga05p37_71448_c1_100_1359 369
144 3300005343 Ga0070687_100011537 Ga0070687_1000115373 370
145 3300005365 Ga0070688_100067662 Ga0070688_1000676623 370
146 3300005543 Ga0070672_100069560 Ga0070672_1000695603 370
147 3300005842 Ga0068858_100047919 Ga0068858_1000479194 370
148 3300005843 Ga0068860_100049056 Ga0068860_1000490563 370
149 3300005985 Ga0081539_10009718 Ga0081539_100097189 370
150 3300006871 Ga0075434_100252197 Ga0075434_1002521972 370
151 3300025900 Ga0207710_10026651 Ga0207710_100266512 370
152 3300025918 Ga0207662_10022477 Ga0207662_100224773 370
153 3300025926 Ga0207659_10000470 Ga0207659_100004702 370
154 3300025931 Ga0207644_10022420 Ga0207644_100224204 370
155 3300025936 Ga0207670_10042387 Ga0207670_100423872 370
156 3300025940 Ga0207691_10071282 Ga0207691_100712822 370
157 3300026035 Ga0207703_10008884 Ga0207703_100088843 370
158 3300026035 Ga0207703_10035285 Ga0207703_100352852 370
159 3300046455 Ga0495603_0022932 Ga0495603_0022932_507_1766 370
160 3300046459 Ga0495629_0025888 Ga0495629_0025888_2421_3680 370
161 3300046664 Ga0495659_0012217 Ga0495659_0012217_145_1377 370
162 3300046683 Ga0495658_0044749 Ga0495658_0044749_1040_2299 370
163 3300047321 Ga0495676_0025407 Ga0495676_0025407_3002_4261 370
164 3300048907 Ga0496104_0056328 Ga0496104_0056328_1548_2903 370
165 3300048911 Ga0496108_0003082 Ga0496108_0003082_2474_3829 370
166 3300048915 Ga0496112_0015039 Ga0496112_0015039_199_1554 370
167 3300005617 Ga0068859_100270962 Ga0068859_1002709621 371
168 3300006931 Ga0097620_100270963 Ga0097620_1002709632 371
169 3300014968 Ga0157379_10218166 Ga0157379_102181661 371
170 3300005518 Ga0070699_100006421 Ga0070699_1000064216 372
171 3300035117 Ga0373953_0069600 Ga0373953_0069600_179_1429 372
172 3300036401 Ga0373937_0037163 Ga0373937_0037163_1615_2865 372
173 3300053084 Ga0495595_0036832 Ga0495595_0036832_671_1981 372
174 3300005328 Ga0070676_10051865 Ga0070676_100518653 373
175 3300005331 Ga0070670_100088181 Ga0070670_1000881813 373
176 3300005548 Ga0070665_100003341 Ga0070665_10000334115 373
177 3300025925 Ga0207650_10099420 Ga0207650_100994202 373
178 3300025927 Ga0207687_10030831 Ga0207687_100308313 373
179 3300025934 Ga0207686_10027904 Ga0207686_100279042 373
180 3300025942 Ga0207689_10022314 Ga0207689_100223143 373
181 3300026023 Ga0207677_10025457 Ga0207677_100254572 373
182 3300026121 Ga0207683_10134531 Ga0207683_101345312 373
183 3300028379 Ga0268266_10026010 Ga0268266_100260104 373
184 3300006881 Ga0068865_100051541 Ga0068865_1000515412 374
185 3300009147 Ga0114129_10024820 Ga0114129_100248208 374
186 3300013306 Ga0163162_10209757 Ga0163162_102097572 374
187 3300026089 Ga0207648_10090136 Ga0207648_100901362 374
188 3300048907 Ga0496104_0085898 Ga0496104_0085898_828_2213 374
189 3300050507 nmdc:mga05p37_252448_c1 nmdc:mga05p37_252448_c1_699_2033 374
190 3300009147 Ga0114129_10000307 Ga0114129_1000030745 375
191 3300050512 nmdc:mga0n895_17193_c1 nmdc:mga0n895_17193_c1_1676_2995 378
192 3300050514 nmdc:mga08x19_137272_c1 nmdc:mga08x19_137272_c1_264_1583 378
193 3300050515 nmdc:mga0a205_33344_c1 nmdc:mga0a205_33344_c1_970_2289 378
194 3300005331 Ga0070670_100087487 Ga0070670_1000874872 379
195 3300005344 Ga0070661_100061831 Ga0070661_1000618313 379
196 3300005354 Ga0070675_100049212 Ga0070675_1000492123 379
197 3300005564 Ga0070664_100119133 Ga0070664_1001191332 379
198 3300005844 Ga0068862_100032604 Ga0068862_1000326042 379
199 3300006846 Ga0075430_100001077 Ga0075430_10000107716 379
200 3300006847 Ga0075431_100005953 Ga0075431_1000059538 379
201 3300006880 Ga0075429_100127080 Ga0075429_1001270803 379
202 3300009147 Ga0114129_10340778 Ga0114129_103407782 379
203 3300025920 Ga0207649_10111352 Ga0207649_101113522 379
204 3300025925 Ga0207650_10080759 Ga0207650_100807592 379
205 3300028380 Ga0268265_10012569 Ga0268265_100125693 379
206 3300050508 nmdc:mga09592_107101_c1 nmdc:mga09592_107101_c1_55_1383 379
207 3300050509 nmdc:mga0qj67_1253_c1 nmdc:mga0qj67_1253_c1_15405_16733 379
208 3300050510 nmdc:mga06r32_497_c1 nmdc:mga06r32_497_c1_17721_19049 379
209 3300009147 Ga0114129_10020856 Ga0114129_100208565 380
210 3300005333 Ga0070677_10008201 Ga0070677_100082013 382
211 3300005335 Ga0070666_10011319 Ga0070666_100113197 382
212 3300005459 Ga0068867_100051645 Ga0068867_1000516451 382
213 3300005564 Ga0070664_100006824 Ga0070664_1000068245 382
214 3300006237 Ga0097621_100058731 Ga0097621_1000587312 382
215 3300009094 Ga0111539_10051988 Ga0111539_100519886 382
216 3300009177 Ga0105248_10125413 Ga0105248_101254132 382
217 3300014326 Ga0157380_10019970 Ga0157380_100199705 382
218 3300025315 Ga0207697_10002659 Ga0207697_100026594 382
219 3300025901 Ga0207688_10003565 Ga0207688_100035658 382
220 3300025903 Ga0207680_10065627 Ga0207680_100656272 382
221 3300026075 Ga0207708_10016982 Ga0207708_100169826 382
222 3300003203 JGI25406J46586_10000372 JGI25406J46586_1000037214 383
223 3300003203 JGI25406J46586_10000253 JGI25406J46586_1000025315 384
224 3300005985 Ga0081539_10000010 Ga0081539_10000010151 384

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gey-assembly1.cif.gz_A high ph structure of pseudomonas putida oprb 0.7024 56 376
4rjw-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa opro 0.7001 59 376
4rjx-assembly1.cif.gz_A-3 crystal structure of the opro mutant protein f62y/d114y 0.6977 59 376
2o4v-assembly1.cif.gz_B an arginine ladder in oprp mediates phosphate specific transfer across the outer membrane 0.6903 53 376
3fyx-assembly1.cif.gz_A the structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator 0.6898 61 376
ID Description Score Start End Superfamily
2o4vB00 Mainly Beta;Beta Barrel;Porin;Porin 0.6903 53 376 2.40.160.10
af_A0A1D6LMU3_87_381_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6423 61 374 2.40.160.10
af_A0A1D6LMU3_87_381_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6369 61 374 2.40.160.10
4kr4C00 Mainly Beta;Beta Barrel;Porin;Porin 0.6302 61 376 2.40.160.10
af_A0A1D6GQ95_139_503_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.623 63 372 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A2V9ZB27-F1-model_v4 LptD C-terminal domain-containing protein 0.9463 118 384
AF-A0A2V9ZB27-F1-model_v4 LptD C-terminal domain-containing protein 0.9427 118 384
AF-A0A7V2XJV2-F1-model_v4 Zinc-regulated TonB-dependent outer membrane receptor 0.9226 115 384
AF-A0A2V8EQ02-F1-model_v4 Uncharacterized protein 0.9221 214 384
AF-A0A2V7VAH4-F1-model_v4 TonB-dependent receptor 0.9141 43 311

Feature Viewer

pLDDT pTM Quality
77.56 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map