F337119
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 224 | 133 | 224 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0085898|Ga0496104_0085898_828_2213 |
| Length | 445 |
| Sequence | LITPSRRVTAGAARARQSHLITSDPRCAWIAGGYAVSHRFTSAAFVLVALSAVRASAQAAPQPPPDAQALRAAIDDLKKEFDARLSALEMRLAAVEGGPQAPERAPAPGSKVFNPDMAVIGDFLGTAGRVRTDPANHVTPDPAFEMHESEASFQAVVDPYARADFFISFGEQGVDLEEGFVTLTSLPGGLLTKVGKMRAAFGKVNSLHNHVLPWADRPLVIKNLVGGEDGIDDAGVSVAHLIPNPWIFLEATGQVFRGDSGPEEQPLYQTNQRGQLSYVAHLRGYGDLSESTNLDLGFSASRGYNGSGLPQDIDDLTTSLLGFDATLRWKPLRRSIYHSFVGRSEVIWSRREQPNGLQSGMGYYVSADYQLARRWFAGVRFDGSDRAYDSTLHDTGGSALLTFWPSEFSQIRGQYRRTNYAIGPAANELLFQFQFSIGAHGAHPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 96 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 97 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 98 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 100 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 118 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 119 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 121 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.12 |
| Rhizosphere | 96.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000253 | 3300003203 | Bacteria | 23771 |
| 2 | JGI25406J46586_10000372 | 3300003203 | Bacteria | 20484 |
| 3 | rootL2_10079171 | 3300003322 | Unclassified | 2846 |
| 4 | Ga0065707_10006329 | 3300005295 | Unclassified | 4050 |
| 5 | Ga0070676_10051865 | 3300005328 | Unclassified | 2410 |
| 6 | Ga0070690_100009514 | 3300005330 | Bacteria | 5634 |
| 7 | Ga0070670_100005884 | 3300005331 | Bacteria | 10364 |
| 8 | Ga0070670_100087487 | 3300005331 | Unclassified | 2678 |
| 9 | Ga0070670_100088181 | 3300005331 | Bacteria | 2667 |
| 10 | Ga0070677_10008201 | 3300005333 | Bacteria | 3509 |
| 11 | Ga0070666_10011319 | 3300005335 | Bacteria | 5598 |
| 12 | Ga0070687_100011537 | 3300005343 | Bacteria | 3868 |
| 13 | Ga0070661_100061831 | 3300005344 | Bacteria | 2749 |
| 14 | Ga0070669_100000306 | 3300005353 | Bacteria | 38513 |
| 15 | Ga0070669_100003950 | 3300005353 | Bacteria | 10726 |
| 16 | Ga0070675_100049212 | 3300005354 | Bacteria | 3459 |
| 17 | Ga0070688_100049844 | 3300005365 | Unclassified | 2607 |
| 18 | Ga0070688_100067662 | 3300005365 | Bacteria | 2276 |
| 19 | Ga0070713_100011204 | 3300005436 | Bacteria | 6520 |
| 20 | Ga0070713_100016627 | 3300005436 | Bacteria | 5534 |
| 21 | Ga0070700_100023578 | 3300005441 | Unclassified | 3601 |
| 22 | Ga0070694_100016245 | 3300005444 | Bacteria | 4685 |
| 23 | Ga0070694_100026428 | 3300005444 | Archaea | 3761 |
| 24 | Ga0070694_100128270 | 3300005444 | Bacteria | 1829 |
| 25 | Ga0068867_100005130 | 3300005459 | Bacteria | 9254 |
| 26 | Ga0068867_100051645 | 3300005459 | Bacteria | 3033 |
| 27 | Ga0070707_100319010 | 3300005468 | Bacteria | 1510 |
| 28 | Ga0070698_100000549 | 3300005471 | Bacteria | 40084 |
| 29 | Ga0070698_100022903 | 3300005471 | Bacteria | 6531 |
| 30 | Ga0070698_100078030 | 3300005471 | Bacteria | 3311 |
| 31 | Ga0070699_100001070 | 3300005518 | Bacteria | 25499 |
| 32 | Ga0070699_100006421 | 3300005518 | Bacteria | 10241 |
| 33 | Ga0070699_100019639 | 3300005518 | Bacteria | 5822 |
| 34 | Ga0070699_100052256 | 3300005518 | Unclassified | 3537 |
| 35 | Ga0070699_100093347 | 3300005518 | Bacteria | 2633 |
| 36 | Ga0070672_100069560 | 3300005543 | Unclassified | 2795 |
| 37 | Ga0070696_100022541 | 3300005546 | Unclassified | 4280 |
| 38 | Ga0070696_100110453 | 3300005546 | Unclassified | 1979 |
| 39 | Ga0070696_100116904 | 3300005546 | Unclassified | 1926 |
| 40 | Ga0070665_100003341 | 3300005548 | Bacteria | 17173 |
| 41 | Ga0070704_100000034 | 3300005549 | Bacteria | 44933 |
| 42 | Ga0070704_100042725 | 3300005549 | Bacteria | 3137 |
| 43 | Ga0070664_100006824 | 3300005564 | Bacteria | 9207 |
| 44 | Ga0070664_100119133 | 3300005564 | Unclassified | 2310 |
| 45 | Ga0070664_100219952 | 3300005564 | Bacteria | 1699 |
| 46 | Ga0068857_100016603 | 3300005577 | Bacteria | 6449 |
| 47 | Ga0068859_100001958 | 3300005617 | Bacteria | 20998 |
| 48 | Ga0068859_100270962 | 3300005617 | Bacteria | 1790 |
| 49 | Ga0068864_100021655 | 3300005618 | Bacteria | 5383 |
| 50 | Ga0068861_100011857 | 3300005719 | Bacteria | 6068 |
| 51 | Ga0068870_10001533 | 3300005840 | Bacteria | 9381 |
| 52 | Ga0068870_10036037 | 3300005840 | Bacteria | 2543 |
| 53 | Ga0068863_100007259 | 3300005841 | Bacteria | 10854 |
| 54 | Ga0068858_100047919 | 3300005842 | Bacteria | 3961 |
| 55 | Ga0068860_100049056 | 3300005843 | Bacteria | 4023 |
| 56 | Ga0068860_100180148 | 3300005843 | Bacteria | 2042 |
| 57 | Ga0068862_100000265 | 3300005844 | Bacteria | 58275 |
| 58 | Ga0068862_100032604 | 3300005844 | Bacteria | 4402 |
| 59 | Ga0068862_100071397 | 3300005844 | Unclassified | 2998 |
| 60 | Ga0081455_10070227 | 3300005937 | Bacteria | 2909 |
| 61 | Ga0081539_10000010 | 3300005985 | Bacteria | 484386 |
| 62 | Ga0081539_10009718 | 3300005985 | Bacteria | 7963 |
| 63 | Ga0097621_100001041 | 3300006237 | Bacteria | 19462 |
| 64 | Ga0097621_100058731 | 3300006237 | Bacteria | 3147 |
| 65 | Ga0068871_100008489 | 3300006358 | Bacteria | 7390 |
| 66 | Ga0068871_100008986 | 3300006358 | Bacteria | 7215 |
| 67 | Ga0068871_100055875 | 3300006358 | Bacteria | 3207 |
| 68 | Ga0075430_100001077 | 3300006846 | Bacteria | 21644 |
| 69 | Ga0075431_100005953 | 3300006847 | Bacteria | 12071 |
| 70 | Ga0075431_100247007 | 3300006847 | Unclassified | 1814 |
| 71 | Ga0075433_10001297 | 3300006852 | Bacteria | 18280 |
| 72 | Ga0075433_10022608 | 3300006852 | Bacteria | 5280 |
| 73 | Ga0075433_10203599 | 3300006852 | Bacteria | 1759 |
| 74 | Ga0075434_100015365 | 3300006871 | Bacteria | 7335 |
| 75 | Ga0075434_100021963 | 3300006871 | Bacteria | 6212 |
| 76 | Ga0075434_100191220 | 3300006871 | Bacteria | 2067 |
| 77 | Ga0075434_100252197 | 3300006871 | Bacteria | 1784 |
| 78 | Ga0075429_100127080 | 3300006880 | Bacteria | 2229 |
| 79 | Ga0075429_100171114 | 3300006880 | Bacteria | 1903 |
| 80 | Ga0075429_100196773 | 3300006880 | Bacteria | 1766 |
| 81 | Ga0068865_100051541 | 3300006881 | Bacteria | 2849 |
| 82 | Ga0097620_100001958 | 3300006931 | Bacteria | 20998 |
| 83 | Ga0097620_100270963 | 3300006931 | Bacteria | 1790 |
| 84 | Ga0075435_100026337 | 3300007076 | Bacteria | 4535 |
| 85 | Ga0075435_100033814 | 3300007076 | Unclassified | 4045 |
| 86 | Ga0111539_10018992 | 3300009094 | Bacteria | 8498 |
| 87 | Ga0111539_10030533 | 3300009094 | Bacteria | 6549 |
| 88 | Ga0111539_10051988 | 3300009094 | Bacteria | 4879 |
| 89 | Ga0105245_10013610 | 3300009098 | Bacteria | 7087 |
| 90 | Ga0105247_10028438 | 3300009101 | Bacteria | 3383 |
| 91 | Ga0114129_10000307 | 3300009147 | Bacteria | 57086 |
| 92 | Ga0114129_10020856 | 3300009147 | Bacteria | 9309 |
| 93 | Ga0114129_10022898 | 3300009147 | Bacteria | 8860 |
| 94 | Ga0114129_10024820 | 3300009147 | Bacteria | 8497 |
| 95 | Ga0114129_10038400 | 3300009147 | Bacteria | 6755 |
| 96 | Ga0114129_10066834 | 3300009147 | Bacteria | 5014 |
| 97 | Ga0114129_10082948 | 3300009147 | Bacteria | 4454 |
| 98 | Ga0114129_10307887 | 3300009147 | Unclassified | 2110 |
| 99 | Ga0114129_10340778 | 3300009147 | Bacteria | 1988 |
| 100 | Ga0114129_10375986 | 3300009147 | Bacteria | 1877 |
| 101 | Ga0105248_10041976 | 3300009177 | Bacteria | 5129 |
| 102 | Ga0105248_10096856 | 3300009177 | Bacteria | 3324 |
| 103 | Ga0105248_10125413 | 3300009177 | Bacteria | 2896 |
| 104 | Ga0105248_10144337 | 3300009177 | Bacteria | 2686 |
| 105 | Ga0105248_10151417 | 3300009177 | Unclassified | 2617 |
| 106 | Ga0105237_10004823 | 3300009545 | Bacteria | 15491 |
| 107 | Ga0105249_10007048 | 3300009553 | Bacteria | 9806 |
| 108 | Ga0105249_10468821 | 3300009553 | Bacteria | 1300 |
| 109 | Ga0157374_10029442 | 3300013296 | Bacteria | 4973 |
| 110 | Ga0163162_10209757 | 3300013306 | Unclassified | 2077 |
| 111 | Ga0157375_10006055 | 3300013308 | Bacteria | 10548 |
| 112 | Ga0157375_10344102 | 3300013308 | Bacteria | 1657 |
| 113 | Ga0163163_10000833 | 3300014325 | Bacteria | 26251 |
| 114 | Ga0163163_10034484 | 3300014325 | Bacteria | 4902 |
| 115 | Ga0157380_10019970 | 3300014326 | Bacteria | 5001 |
| 116 | Ga0157379_10218166 | 3300014968 | Unclassified | 1728 |
| 117 | Ga0207697_10002659 | 3300025315 | Bacteria | 9149 |
| 118 | Ga0207710_10026651 | 3300025900 | Bacteria | 2499 |
| 119 | Ga0207688_10003565 | 3300025901 | Bacteria | 8494 |
| 120 | Ga0207680_10065627 | 3300025903 | Bacteria | 2229 |
| 121 | Ga0207643_10001325 | 3300025908 | Bacteria | 14342 |
| 122 | Ga0207643_10009070 | 3300025908 | Bacteria | 5343 |
| 123 | Ga0207671_10018005 | 3300025914 | Bacteria | 5432 |
| 124 | Ga0207662_10022477 | 3300025918 | Unclassified | 3617 |
| 125 | Ga0207649_10111352 | 3300025920 | Unclassified | 1829 |
| 126 | Ga0207681_10003377 | 3300025923 | Bacteria | 9992 |
| 127 | Ga0207650_10071837 | 3300025925 | Bacteria | 2604 |
| 128 | Ga0207650_10080759 | 3300025925 | Bacteria | 2466 |
| 129 | Ga0207650_10099420 | 3300025925 | Bacteria | 2237 |
| 130 | Ga0207659_10000470 | 3300025926 | Bacteria | 24214 |
| 131 | Ga0207687_10005111 | 3300025927 | Bacteria | 8697 |
| 132 | Ga0207687_10030831 | 3300025927 | Bacteria | 3619 |
| 133 | Ga0207700_10018465 | 3300025928 | Bacteria | 4686 |
| 134 | Ga0207644_10022420 | 3300025931 | Bacteria | 4315 |
| 135 | Ga0207686_10027904 | 3300025934 | Bacteria | 3311 |
| 136 | Ga0207670_10009918 | 3300025936 | Bacteria | 5457 |
| 137 | Ga0207670_10042387 | 3300025936 | Bacteria | 2998 |
| 138 | Ga0207691_10071282 | 3300025940 | Unclassified | 3136 |
| 139 | Ga0207711_10080532 | 3300025941 | Bacteria | 2844 |
| 140 | Ga0207689_10022314 | 3300025942 | Bacteria | 5323 |
| 141 | Ga0207661_10153800 | 3300025944 | Bacteria | 1990 |
| 142 | Ga0207679_10180789 | 3300025945 | Bacteria | 1745 |
| 143 | Ga0207712_10012172 | 3300025961 | Bacteria | 5495 |
| 144 | Ga0207677_10025457 | 3300026023 | Unclassified | 3693 |
| 145 | Ga0207703_10008884 | 3300026035 | Bacteria | 7915 |
| 146 | Ga0207703_10035285 | 3300026035 | Bacteria | 3974 |
| 147 | Ga0207708_10016982 | 3300026075 | Bacteria | 5479 |
| 148 | Ga0207708_10024909 | 3300026075 | Bacteria | 4526 |
| 149 | Ga0207641_10132206 | 3300026088 | Bacteria | 2242 |
| 150 | Ga0207648_10007270 | 3300026089 | Bacteria | 10917 |
| 151 | Ga0207648_10090136 | 3300026089 | Unclassified | 2679 |
| 152 | Ga0207676_10016132 | 3300026095 | Bacteria | 5404 |
| 153 | Ga0207674_10007513 | 3300026116 | Bacteria | 12706 |
| 154 | Ga0207674_10044359 | 3300026116 | Bacteria | 4579 |
| 155 | Ga0207675_100043069 | 3300026118 | Unclassified | 4216 |
| 156 | Ga0207675_100082694 | 3300026118 | Unclassified | 3011 |
| 157 | Ga0207675_100123509 | 3300026118 | Unclassified | 2451 |
| 158 | Ga0207683_10083520 | 3300026121 | Bacteria | 2838 |
| 159 | Ga0207683_10134531 | 3300026121 | Bacteria | 2225 |
| 160 | Ga0207428_10000958 | 3300027907 | Bacteria | 32012 |
| 161 | Ga0268266_10026010 | 3300028379 | Bacteria | 4978 |
| 162 | Ga0268265_10012569 | 3300028380 | Bacteria | 5740 |
| 163 | Ga0268265_10027027 | 3300028380 | Bacteria | 4090 |
| 164 | Ga0268264_10203590 | 3300028381 | Bacteria | 1812 |
| 165 | Ga0268264_10216050 | 3300028381 | Bacteria | 1763 |
| 166 | Ga0373926_0020340 | 3300035083 | Bacteria | 2293 |
| 167 | Ga0373953_0069600 | 3300035117 | Unclassified | 1450 |
| 168 | Ga0373954_0031330 | 3300035118 | Bacteria | 2455 |
| 169 | Ga0373935_0027870 | 3300035692 | Unclassified | 3491 |
| 170 | Ga0373927_0000944 | 3300035695 | Bacteria | 22130 |
| 171 | Ga0373947_0009693 | 3300035725 | Bacteria | 5526 |
| 172 | Ga0373937_0037163 | 3300036401 | Unclassified | 4438 |
| 173 | Ga0495603_0022932 | 3300046455 | Unclassified | 3778 |
| 174 | Ga0495629_0025888 | 3300046459 | Bacteria | 4168 |
| 175 | Ga0495584_0089273 | 3300046491 | Unclassified | 1554 |
| 176 | Ga0495594_0061316 | 3300046499 | Bacteria | 2081 |
| 177 | Ga0495659_0002461 | 3300046664 | Bacteria | 5973 |
| 178 | Ga0495659_0011395 | 3300046664 | Unclassified | 2865 |
| 179 | Ga0495659_0012217 | 3300046664 | Unclassified | 2778 |
| 180 | Ga0495588_0014854 | 3300046674 | Bacteria | 3737 |
| 181 | Ga0495658_0044749 | 3300046683 | Unclassified | 2481 |
| 182 | Ga0495669_0067590 | 3300046684 | Bacteria | 1625 |
| 183 | Ga0495613_0000865 | 3300046689 | Bacteria | 23237 |
| 184 | Ga0495600_0028825 | 3300046809 | Bacteria | 3593 |
| 185 | Ga0495604_0020219 | 3300047317 | Bacteria | 5320 |
| 186 | Ga0495674_0016885 | 3300047319 | Bacteria | 6808 |
| 187 | Ga0495676_0025407 | 3300047321 | Bacteria | 5115 |
| 188 | Ga0495684_0003376 | 3300047471 | Bacteria | 12533 |
| 189 | Ga0496101_0006393 | 3300048904 | Bacteria | 7582 |
| 190 | Ga0496104_0006403 | 3300048907 | Bacteria | 10354 |
| 191 | Ga0496104_0056328 | 3300048907 | Bacteria | 3717 |
| 192 | Ga0496104_0085898 | 3300048907 | Bacteria | 3004 |
| 193 | Ga0496105_0062347 | 3300048908 | Bacteria | 3077 |
| 194 | Ga0496108_0003082 | 3300048911 | Bacteria | 13396 |
| 195 | Ga0496112_0015039 | 3300048915 | Bacteria | 7203 |
| 196 | Ga0501068_0043722 | 3300049584 | Unclassified | 2696 |
| 197 | Ga0501069_0047768 | 3300049585 | Unclassified | 2376 |
| 198 | nmdc:mga05p37_16166_c1 | 3300050507 | Bacteria | 8984 |
| 199 | nmdc:mga05p37_252448_c1 | 3300050507 | Unclassified | 2115 |
| 200 | nmdc:mga05p37_67031_c1 | 3300050507 | Bacteria | 4416 |
| 201 | nmdc:mga05p37_71448_c1 | 3300050507 | Bacteria | 4269 |
| 202 | nmdc:mga09592_107101_c1 | 3300050508 | Bacteria | 2398 |
| 203 | nmdc:mga09592_186899_c1 | 3300050508 | Bacteria | 1793 |
| 204 | nmdc:mga0qj67_1253_c1 | 3300050509 | Bacteria | 17772 |
| 205 | nmdc:mga06r32_497_c1 | 3300050510 | Bacteria | 33939 |
| 206 | nmdc:mga08y16_8850_c1 | 3300050511 | Bacteria | 10567 |
| 207 | nmdc:mga0n895_127010_c1 | 3300050512 | Bacteria | 2574 |
| 208 | nmdc:mga0n895_14162_c1 | 3300050512 | Bacteria | 7232 |
| 209 | nmdc:mga0n895_17193_c1 | 3300050512 | Bacteria | 6664 |
| 210 | nmdc:mga0n895_29527_c1 | 3300050512 | Bacteria | 5232 |
| 211 | nmdc:mga0n895_564847_c1 | 3300050512 | Unclassified | 1143 |
| 212 | nmdc:mga0rr50_197798_c1 | 3300050513 | Unclassified | 1650 |
| 213 | nmdc:mga0rr50_39975_c1 | 3300050513 | Bacteria | 3406 |
| 214 | nmdc:mga0rr50_6462_c1 | 3300050513 | Bacteria | 7138 |
| 215 | nmdc:mga08x19_137272_c1 | 3300050514 | Bacteria | 1649 |
| 216 | nmdc:mga08x19_188016_c1 | 3300050514 | Bacteria | 1412 |
| 217 | nmdc:mga0a205_1558_c1 | 3300050515 | Bacteria | 19618 |
| 218 | nmdc:mga0a205_2045_c1 | 3300050515 | Bacteria | 17625 |
| 219 | nmdc:mga0a205_33344_c1 | 3300050515 | Bacteria | 4937 |
| 220 | nmdc:mga0a205_37095_c1 | 3300050515 | Bacteria | 4687 |
| 221 | nmdc:mga0a205_52932_c1 | 3300050515 | Bacteria | 3918 |
| 222 | nmdc:mga0a205_93046_c1 | 3300050515 | Bacteria | 2913 |
| 223 | Ga0495601_0000195 | 3300053077 | Bacteria | 32156 |
| 224 | Ga0495595_0036832 | 3300053084 | Unclassified | 2222 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100123509 | Ga0207675_1001235091 | 313 |
| 2 | 3300046674 | Ga0495588_0014854 | Ga0495588_0014854_2713_3696 | 326 |
| 3 | 3300009553 | Ga0105249_10468821 | Ga0105249_104688211 | 333 |
| 4 | 3300046491 | Ga0495584_0089273 | Ga0495584_0089273_71_1087 | 334 |
| 5 | 3300050512 | nmdc:mga0n895_564847_c1 | nmdc:mga0n895_564847_c1_10_1062 | 336 |
| 6 | 3300035118 | Ga0373954_0031330 | Ga0373954_0031330_1149_2381 | 338 |
| 7 | 3300046684 | Ga0495669_0067590 | Ga0495669_0067590_39_1055 | 338 |
| 8 | 3300003322 | rootL2_10079171 | rootL2_100791712 | 339 |
| 9 | 3300009098 | Ga0105245_10013610 | Ga0105245_100136106 | 347 |
| 10 | 3300048908 | Ga0496105_0062347 | Ga0496105_0062347_1735_3045 | 348 |
| 11 | 3300005436 | Ga0070713_100016627 | Ga0070713_1000166273 | 349 |
| 12 | 3300005564 | Ga0070664_100219952 | Ga0070664_1002199522 | 349 |
| 13 | 3300025928 | Ga0207700_10018465 | Ga0207700_100184656 | 349 |
| 14 | 3300005331 | Ga0070670_100005884 | Ga0070670_10000588411 | 351 |
| 15 | 3300025925 | Ga0207650_10071837 | Ga0207650_100718372 | 351 |
| 16 | 3300005577 | Ga0068857_100016603 | Ga0068857_1000166032 | 352 |
| 17 | 3300005840 | Ga0068870_10036037 | Ga0068870_100360372 | 352 |
| 18 | 3300025908 | Ga0207643_10009070 | Ga0207643_100090703 | 352 |
| 19 | 3300025945 | Ga0207679_10180789 | Ga0207679_101807892 | 352 |
| 20 | 3300026116 | Ga0207674_10044359 | Ga0207674_100443595 | 352 |
| 21 | 3300005518 | Ga0070699_100093347 | Ga0070699_1000933472 | 353 |
| 22 | 3300005546 | Ga0070696_100110453 | Ga0070696_1001104531 | 353 |
| 23 | 3300006871 | Ga0075434_100021963 | Ga0075434_1000219634 | 353 |
| 24 | 3300046499 | Ga0495594_0061316 | Ga0495594_0061316_310_1581 | 353 |
| 25 | 3300050512 | nmdc:mga0n895_127010_c1 | nmdc:mga0n895_127010_c1_885_2207 | 353 |
| 26 | 3300005330 | Ga0070690_100009514 | Ga0070690_1000095142 | 354 |
| 27 | 3300005353 | Ga0070669_100000306 | Ga0070669_10000030613 | 354 |
| 28 | 3300005441 | Ga0070700_100023578 | Ga0070700_1000235781 | 354 |
| 29 | 3300005444 | Ga0070694_100016245 | Ga0070694_1000162455 | 354 |
| 30 | 3300005459 | Ga0068867_100005130 | Ga0068867_1000051309 | 354 |
| 31 | 3300005518 | Ga0070699_100052256 | Ga0070699_1000522563 | 354 |
| 32 | 3300005549 | Ga0070704_100000034 | Ga0070704_10000003427 | 354 |
| 33 | 3300005617 | Ga0068859_100001958 | Ga0068859_1000019585 | 354 |
| 34 | 3300005618 | Ga0068864_100021655 | Ga0068864_1000216552 | 354 |
| 35 | 3300005719 | Ga0068861_100011857 | Ga0068861_1000118573 | 354 |
| 36 | 3300005840 | Ga0068870_10001533 | Ga0068870_100015333 | 354 |
| 37 | 3300005844 | Ga0068862_100000265 | Ga0068862_10000026515 | 354 |
| 38 | 3300006852 | Ga0075433_10022608 | Ga0075433_100226086 | 354 |
| 39 | 3300006931 | Ga0097620_100001958 | Ga0097620_1000019585 | 354 |
| 40 | 3300009094 | Ga0111539_10018992 | Ga0111539_100189929 | 354 |
| 41 | 3300009553 | Ga0105249_10007048 | Ga0105249_1000704811 | 354 |
| 42 | 3300013308 | Ga0157375_10006055 | Ga0157375_100060553 | 354 |
| 43 | 3300025908 | Ga0207643_10001325 | Ga0207643_100013253 | 354 |
| 44 | 3300025936 | Ga0207670_10009918 | Ga0207670_100099187 | 354 |
| 45 | 3300025961 | Ga0207712_10012172 | Ga0207712_100121722 | 354 |
| 46 | 3300026075 | Ga0207708_10024909 | Ga0207708_100249094 | 354 |
| 47 | 3300026089 | Ga0207648_10007270 | Ga0207648_100072704 | 354 |
| 48 | 3300026095 | Ga0207676_10016132 | Ga0207676_100161323 | 354 |
| 49 | 3300026116 | Ga0207674_10007513 | Ga0207674_1000751314 | 354 |
| 50 | 3300026118 | Ga0207675_100043069 | Ga0207675_1000430694 | 354 |
| 51 | 3300027907 | Ga0207428_10000958 | Ga0207428_1000095821 | 354 |
| 52 | 3300050511 | nmdc:mga08y16_8850_c1 | nmdc:mga08y16_8850_c1_859_2166 | 354 |
| 53 | 3300005365 | Ga0070688_100049844 | Ga0070688_1000498442 | 355 |
| 54 | 3300005937 | Ga0081455_10070227 | Ga0081455_100702272 | 355 |
| 55 | 3300046689 | Ga0495613_0000865 | Ga0495613_0000865_17559_18851 | 355 |
| 56 | 3300046809 | Ga0495600_0028825 | Ga0495600_0028825_1121_2413 | 355 |
| 57 | 3300047317 | Ga0495604_0020219 | Ga0495604_0020219_864_2156 | 355 |
| 58 | 3300047319 | Ga0495674_0016885 | Ga0495674_0016885_1681_2973 | 355 |
| 59 | 3300047471 | Ga0495684_0003376 | Ga0495684_0003376_6111_7403 | 355 |
| 60 | 3300053077 | Ga0495601_0000195 | Ga0495601_0000195_4216_5508 | 355 |
| 61 | 3300005353 | Ga0070669_100003950 | Ga0070669_10000395011 | 356 |
| 62 | 3300005844 | Ga0068862_100071397 | Ga0068862_1000713974 | 356 |
| 63 | 3300006358 | Ga0068871_100055875 | Ga0068871_1000558752 | 356 |
| 64 | 3300009545 | Ga0105237_10004823 | Ga0105237_100048239 | 356 |
| 65 | 3300025923 | Ga0207681_10003377 | Ga0207681_100033778 | 356 |
| 66 | 3300025927 | Ga0207687_10005111 | Ga0207687_100051114 | 356 |
| 67 | 3300028380 | Ga0268265_10027027 | Ga0268265_100270274 | 356 |
| 68 | 3300007076 | Ga0075435_100033814 | Ga0075435_1000338142 | 358 |
| 69 | 3300009147 | Ga0114129_10022898 | Ga0114129_100228989 | 358 |
| 70 | 3300026118 | Ga0207675_100082694 | Ga0207675_1000826942 | 358 |
| 71 | 3300046664 | Ga0495659_0002461 | Ga0495659_0002461_916_2160 | 358 |
| 72 | 3300050507 | nmdc:mga05p37_16166_c1 | nmdc:mga05p37_16166_c1_1444_2706 | 358 |
| 73 | 3300050508 | nmdc:mga09592_186899_c1 | nmdc:mga09592_186899_c1_65_1333 | 358 |
| 74 | 3300050515 | nmdc:mga0a205_93046_c1 | nmdc:mga0a205_93046_c1_1011_2279 | 358 |
| 75 | 3300009101 | Ga0105247_10028438 | Ga0105247_100284384 | 359 |
| 76 | 3300009177 | Ga0105248_10041976 | Ga0105248_100419764 | 359 |
| 77 | 3300014325 | Ga0163163_10000833 | Ga0163163_1000083318 | 359 |
| 78 | 3300035692 | Ga0373935_0027870 | Ga0373935_0027870_535_1863 | 359 |
| 79 | 3300046664 | Ga0495659_0011395 | Ga0495659_0011395_1041_2327 | 359 |
| 80 | 3300049584 | Ga0501068_0043722 | Ga0501068_0043722_33_1340 | 359 |
| 81 | 3300049585 | Ga0501069_0047768 | Ga0501069_0047768_982_2289 | 359 |
| 82 | 3300009177 | Ga0105248_10151417 | Ga0105248_101514172 | 362 |
| 83 | 3300026088 | Ga0207641_10132206 | Ga0207641_101322061 | 362 |
| 84 | 3300048907 | Ga0496104_0006403 | Ga0496104_0006403_8076_9386 | 362 |
| 85 | 3300050514 | nmdc:mga08x19_188016_c1 | nmdc:mga08x19_188016_c1_54_1373 | 362 |
| 86 | 3300005295 | Ga0065707_10006329 | Ga0065707_100063294 | 363 |
| 87 | 3300005444 | Ga0070694_100026428 | Ga0070694_1000264282 | 363 |
| 88 | 3300005468 | Ga0070707_100319010 | Ga0070707_1003190101 | 363 |
| 89 | 3300005471 | Ga0070698_100022903 | Ga0070698_1000229032 | 363 |
| 90 | 3300005518 | Ga0070699_100019639 | Ga0070699_1000196396 | 363 |
| 91 | 3300005546 | Ga0070696_100116904 | Ga0070696_1001169041 | 363 |
| 92 | 3300005549 | Ga0070704_100042725 | Ga0070704_1000427252 | 363 |
| 93 | 3300006852 | Ga0075433_10001297 | Ga0075433_1000129717 | 363 |
| 94 | 3300006852 | Ga0075433_10203599 | Ga0075433_102035992 | 363 |
| 95 | 3300006871 | Ga0075434_100191220 | Ga0075434_1001912202 | 363 |
| 96 | 3300006880 | Ga0075429_100171114 | Ga0075429_1001711142 | 363 |
| 97 | 3300009094 | Ga0111539_10030533 | Ga0111539_100305336 | 363 |
| 98 | 3300009147 | Ga0114129_10038400 | Ga0114129_100384004 | 363 |
| 99 | 3300009147 | Ga0114129_10082948 | Ga0114129_100829484 | 363 |
| 100 | 3300009147 | Ga0114129_10375986 | Ga0114129_103759862 | 363 |
| 101 | 3300050512 | nmdc:mga0n895_29527_c1 | nmdc:mga0n895_29527_c1_2417_3721 | 363 |
| 102 | 3300050513 | nmdc:mga0rr50_197798_c1 | nmdc:mga0rr50_197798_c1_96_1418 | 363 |
| 103 | 3300050513 | nmdc:mga0rr50_39975_c1 | nmdc:mga0rr50_39975_c1_42_1346 | 363 |
| 104 | 3300050515 | nmdc:mga0a205_1558_c1 | nmdc:mga0a205_1558_c1_17609_18931 | 363 |
| 105 | 3300050515 | nmdc:mga0a205_37095_c1 | nmdc:mga0a205_37095_c1_244_1548 | 363 |
| 106 | 3300005471 | Ga0070698_100078030 | Ga0070698_1000780301 | 364 |
| 107 | 3300005843 | Ga0068860_100180148 | Ga0068860_1001801482 | 364 |
| 108 | 3300006871 | Ga0075434_100015365 | Ga0075434_1000153654 | 364 |
| 109 | 3300007076 | Ga0075435_100026337 | Ga0075435_1000263373 | 364 |
| 110 | 3300028381 | Ga0268264_10203590 | Ga0268264_102035902 | 364 |
| 111 | 3300050512 | nmdc:mga0n895_14162_c1 | nmdc:mga0n895_14162_c1_4245_5579 | 364 |
| 112 | 3300050513 | nmdc:mga0rr50_6462_c1 | nmdc:mga0rr50_6462_c1_3542_4876 | 364 |
| 113 | 3300050515 | nmdc:mga0a205_2045_c1 | nmdc:mga0a205_2045_c1_2503_3837 | 364 |
| 114 | 3300006358 | Ga0068871_100008489 | Ga0068871_1000084894 | 365 |
| 115 | 3300013296 | Ga0157374_10029442 | Ga0157374_100294425 | 365 |
| 116 | 3300013308 | Ga0157375_10344102 | Ga0157375_103441021 | 365 |
| 117 | 3300025914 | Ga0207671_10018005 | Ga0207671_100180053 | 365 |
| 118 | 3300025944 | Ga0207661_10153800 | Ga0207661_101538001 | 365 |
| 119 | 3300035725 | Ga0373947_0009693 | Ga0373947_0009693_1742_3058 | 365 |
| 120 | 3300048904 | Ga0496101_0006393 | Ga0496101_0006393_2310_3617 | 365 |
| 121 | 3300050507 | nmdc:mga05p37_67031_c1 | nmdc:mga05p37_67031_c1_2457_3743 | 365 |
| 122 | 3300050515 | nmdc:mga0a205_52932_c1 | nmdc:mga0a205_52932_c1_293_1579 | 365 |
| 123 | 3300005436 | Ga0070713_100011204 | Ga0070713_1000112046 | 366 |
| 124 | 3300005841 | Ga0068863_100007259 | Ga0068863_1000072597 | 366 |
| 125 | 3300006847 | Ga0075431_100247007 | Ga0075431_1002470072 | 366 |
| 126 | 3300006880 | Ga0075429_100196773 | Ga0075429_1001967731 | 366 |
| 127 | 3300026121 | Ga0207683_10083520 | Ga0207683_100835203 | 366 |
| 128 | 3300035083 | Ga0373926_0020340 | Ga0373926_0020340_611_1864 | 366 |
| 129 | 3300035695 | Ga0373927_0000944 | Ga0373927_0000944_12868_14121 | 366 |
| 130 | 3300005444 | Ga0070694_100128270 | Ga0070694_1001282701 | 367 |
| 131 | 3300005471 | Ga0070698_100000549 | Ga0070698_1000005495 | 367 |
| 132 | 3300005518 | Ga0070699_100001070 | Ga0070699_10000107019 | 367 |
| 133 | 3300005546 | Ga0070696_100022541 | Ga0070696_1000225415 | 367 |
| 134 | 3300009147 | Ga0114129_10307887 | Ga0114129_103078872 | 367 |
| 135 | 3300009147 | Ga0114129_10066834 | Ga0114129_100668342 | 368 |
| 136 | 3300009177 | Ga0105248_10144337 | Ga0105248_101443371 | 368 |
| 137 | 3300014325 | Ga0163163_10034484 | Ga0163163_100344844 | 368 |
| 138 | 3300025941 | Ga0207711_10080532 | Ga0207711_100805322 | 368 |
| 139 | 3300028381 | Ga0268264_10216050 | Ga0268264_102160502 | 368 |
| 140 | 3300006237 | Ga0097621_100001041 | Ga0097621_10000104114 | 369 |
| 141 | 3300006358 | Ga0068871_100008986 | Ga0068871_1000089862 | 369 |
| 142 | 3300009177 | Ga0105248_10096856 | Ga0105248_100968563 | 369 |
| 143 | 3300050507 | nmdc:mga05p37_71448_c1 | nmdc:mga05p37_71448_c1_100_1359 | 369 |
| 144 | 3300005343 | Ga0070687_100011537 | Ga0070687_1000115373 | 370 |
| 145 | 3300005365 | Ga0070688_100067662 | Ga0070688_1000676623 | 370 |
| 146 | 3300005543 | Ga0070672_100069560 | Ga0070672_1000695603 | 370 |
| 147 | 3300005842 | Ga0068858_100047919 | Ga0068858_1000479194 | 370 |
| 148 | 3300005843 | Ga0068860_100049056 | Ga0068860_1000490563 | 370 |
| 149 | 3300005985 | Ga0081539_10009718 | Ga0081539_100097189 | 370 |
| 150 | 3300006871 | Ga0075434_100252197 | Ga0075434_1002521972 | 370 |
| 151 | 3300025900 | Ga0207710_10026651 | Ga0207710_100266512 | 370 |
| 152 | 3300025918 | Ga0207662_10022477 | Ga0207662_100224773 | 370 |
| 153 | 3300025926 | Ga0207659_10000470 | Ga0207659_100004702 | 370 |
| 154 | 3300025931 | Ga0207644_10022420 | Ga0207644_100224204 | 370 |
| 155 | 3300025936 | Ga0207670_10042387 | Ga0207670_100423872 | 370 |
| 156 | 3300025940 | Ga0207691_10071282 | Ga0207691_100712822 | 370 |
| 157 | 3300026035 | Ga0207703_10008884 | Ga0207703_100088843 | 370 |
| 158 | 3300026035 | Ga0207703_10035285 | Ga0207703_100352852 | 370 |
| 159 | 3300046455 | Ga0495603_0022932 | Ga0495603_0022932_507_1766 | 370 |
| 160 | 3300046459 | Ga0495629_0025888 | Ga0495629_0025888_2421_3680 | 370 |
| 161 | 3300046664 | Ga0495659_0012217 | Ga0495659_0012217_145_1377 | 370 |
| 162 | 3300046683 | Ga0495658_0044749 | Ga0495658_0044749_1040_2299 | 370 |
| 163 | 3300047321 | Ga0495676_0025407 | Ga0495676_0025407_3002_4261 | 370 |
| 164 | 3300048907 | Ga0496104_0056328 | Ga0496104_0056328_1548_2903 | 370 |
| 165 | 3300048911 | Ga0496108_0003082 | Ga0496108_0003082_2474_3829 | 370 |
| 166 | 3300048915 | Ga0496112_0015039 | Ga0496112_0015039_199_1554 | 370 |
| 167 | 3300005617 | Ga0068859_100270962 | Ga0068859_1002709621 | 371 |
| 168 | 3300006931 | Ga0097620_100270963 | Ga0097620_1002709632 | 371 |
| 169 | 3300014968 | Ga0157379_10218166 | Ga0157379_102181661 | 371 |
| 170 | 3300005518 | Ga0070699_100006421 | Ga0070699_1000064216 | 372 |
| 171 | 3300035117 | Ga0373953_0069600 | Ga0373953_0069600_179_1429 | 372 |
| 172 | 3300036401 | Ga0373937_0037163 | Ga0373937_0037163_1615_2865 | 372 |
| 173 | 3300053084 | Ga0495595_0036832 | Ga0495595_0036832_671_1981 | 372 |
| 174 | 3300005328 | Ga0070676_10051865 | Ga0070676_100518653 | 373 |
| 175 | 3300005331 | Ga0070670_100088181 | Ga0070670_1000881813 | 373 |
| 176 | 3300005548 | Ga0070665_100003341 | Ga0070665_10000334115 | 373 |
| 177 | 3300025925 | Ga0207650_10099420 | Ga0207650_100994202 | 373 |
| 178 | 3300025927 | Ga0207687_10030831 | Ga0207687_100308313 | 373 |
| 179 | 3300025934 | Ga0207686_10027904 | Ga0207686_100279042 | 373 |
| 180 | 3300025942 | Ga0207689_10022314 | Ga0207689_100223143 | 373 |
| 181 | 3300026023 | Ga0207677_10025457 | Ga0207677_100254572 | 373 |
| 182 | 3300026121 | Ga0207683_10134531 | Ga0207683_101345312 | 373 |
| 183 | 3300028379 | Ga0268266_10026010 | Ga0268266_100260104 | 373 |
| 184 | 3300006881 | Ga0068865_100051541 | Ga0068865_1000515412 | 374 |
| 185 | 3300009147 | Ga0114129_10024820 | Ga0114129_100248208 | 374 |
| 186 | 3300013306 | Ga0163162_10209757 | Ga0163162_102097572 | 374 |
| 187 | 3300026089 | Ga0207648_10090136 | Ga0207648_100901362 | 374 |
| 188 | 3300048907 | Ga0496104_0085898 | Ga0496104_0085898_828_2213 | 374 |
| 189 | 3300050507 | nmdc:mga05p37_252448_c1 | nmdc:mga05p37_252448_c1_699_2033 | 374 |
| 190 | 3300009147 | Ga0114129_10000307 | Ga0114129_1000030745 | 375 |
| 191 | 3300050512 | nmdc:mga0n895_17193_c1 | nmdc:mga0n895_17193_c1_1676_2995 | 378 |
| 192 | 3300050514 | nmdc:mga08x19_137272_c1 | nmdc:mga08x19_137272_c1_264_1583 | 378 |
| 193 | 3300050515 | nmdc:mga0a205_33344_c1 | nmdc:mga0a205_33344_c1_970_2289 | 378 |
| 194 | 3300005331 | Ga0070670_100087487 | Ga0070670_1000874872 | 379 |
| 195 | 3300005344 | Ga0070661_100061831 | Ga0070661_1000618313 | 379 |
| 196 | 3300005354 | Ga0070675_100049212 | Ga0070675_1000492123 | 379 |
| 197 | 3300005564 | Ga0070664_100119133 | Ga0070664_1001191332 | 379 |
| 198 | 3300005844 | Ga0068862_100032604 | Ga0068862_1000326042 | 379 |
| 199 | 3300006846 | Ga0075430_100001077 | Ga0075430_10000107716 | 379 |
| 200 | 3300006847 | Ga0075431_100005953 | Ga0075431_1000059538 | 379 |
| 201 | 3300006880 | Ga0075429_100127080 | Ga0075429_1001270803 | 379 |
| 202 | 3300009147 | Ga0114129_10340778 | Ga0114129_103407782 | 379 |
| 203 | 3300025920 | Ga0207649_10111352 | Ga0207649_101113522 | 379 |
| 204 | 3300025925 | Ga0207650_10080759 | Ga0207650_100807592 | 379 |
| 205 | 3300028380 | Ga0268265_10012569 | Ga0268265_100125693 | 379 |
| 206 | 3300050508 | nmdc:mga09592_107101_c1 | nmdc:mga09592_107101_c1_55_1383 | 379 |
| 207 | 3300050509 | nmdc:mga0qj67_1253_c1 | nmdc:mga0qj67_1253_c1_15405_16733 | 379 |
| 208 | 3300050510 | nmdc:mga06r32_497_c1 | nmdc:mga06r32_497_c1_17721_19049 | 379 |
| 209 | 3300009147 | Ga0114129_10020856 | Ga0114129_100208565 | 380 |
| 210 | 3300005333 | Ga0070677_10008201 | Ga0070677_100082013 | 382 |
| 211 | 3300005335 | Ga0070666_10011319 | Ga0070666_100113197 | 382 |
| 212 | 3300005459 | Ga0068867_100051645 | Ga0068867_1000516451 | 382 |
| 213 | 3300005564 | Ga0070664_100006824 | Ga0070664_1000068245 | 382 |
| 214 | 3300006237 | Ga0097621_100058731 | Ga0097621_1000587312 | 382 |
| 215 | 3300009094 | Ga0111539_10051988 | Ga0111539_100519886 | 382 |
| 216 | 3300009177 | Ga0105248_10125413 | Ga0105248_101254132 | 382 |
| 217 | 3300014326 | Ga0157380_10019970 | Ga0157380_100199705 | 382 |
| 218 | 3300025315 | Ga0207697_10002659 | Ga0207697_100026594 | 382 |
| 219 | 3300025901 | Ga0207688_10003565 | Ga0207688_100035658 | 382 |
| 220 | 3300025903 | Ga0207680_10065627 | Ga0207680_100656272 | 382 |
| 221 | 3300026075 | Ga0207708_10016982 | Ga0207708_100169826 | 382 |
| 222 | 3300003203 | JGI25406J46586_10000372 | JGI25406J46586_1000037214 | 383 |
| 223 | 3300003203 | JGI25406J46586_10000253 | JGI25406J46586_1000025315 | 384 |
| 224 | 3300005985 | Ga0081539_10000010 | Ga0081539_10000010151 | 384 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gey-assembly1.cif.gz_A | high ph structure of pseudomonas putida oprb | 0.7024 | 56 | 376 |
| 4rjw-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa opro | 0.7001 | 59 | 376 |
| 4rjx-assembly1.cif.gz_A-3 | crystal structure of the opro mutant protein f62y/d114y | 0.6977 | 59 | 376 |
| 2o4v-assembly1.cif.gz_B | an arginine ladder in oprp mediates phosphate specific transfer across the outer membrane | 0.6903 | 53 | 376 |
| 3fyx-assembly1.cif.gz_A | the structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator | 0.6898 | 61 | 376 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o4vB00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6903 | 53 | 376 | 2.40.160.10 |
| af_A0A1D6LMU3_87_381_2.40.160.10 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6423 | 61 | 374 | 2.40.160.10 |
| af_A0A1D6LMU3_87_381_2.40.160.10 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6369 | 61 | 374 | 2.40.160.10 |
| 4kr4C00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6302 | 61 | 376 | 2.40.160.10 |
| af_A0A1D6GQ95_139_503_2.40.160.10 | Mainly Beta;Beta Barrel;Porin;Porin | 0.623 | 63 | 372 | 2.40.160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9ZB27-F1-model_v4 | LptD C-terminal domain-containing protein | 0.9463 | 118 | 384 |
|
| AF-A0A2V9ZB27-F1-model_v4 | LptD C-terminal domain-containing protein | 0.9427 | 118 | 384 |
|
| AF-A0A7V2XJV2-F1-model_v4 | Zinc-regulated TonB-dependent outer membrane receptor | 0.9226 | 115 | 384 |
|
| AF-A0A2V8EQ02-F1-model_v4 | Uncharacterized protein | 0.9221 | 214 | 384 |
|
| AF-A0A2V7VAH4-F1-model_v4 | TonB-dependent receptor | 0.9141 | 43 | 311 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar