F337171

General Info

Members Datasets Scaffolds Average Seq Length
224 135 448 137

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0218070|Ga0501034_0218070_654_1076
Length 140
Sequence VEKNPTSLPALIVVAAALVDADGRVLLQQRAPHRKMAGLWEFPGGKLEPGETPEEALIRELEEELGIQTESACLAPAAFASHRLDDDSHLILLLYVCRKWRGTPRPLDASGLTWVRPQQMFSLAMPPADKPLIGLLDALL

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
104 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
105 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
106 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
107 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
108 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
109 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
110 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
111 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
112 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
113 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
114 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
115 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
121 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
122 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
132 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
133 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
134 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
135 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 0.45
Rhizosphere 75.45
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0218070 3300049571 Bacteria 1861
2 JGI24749J21850_1000334 3300002076 Bacteria 7114
3 Ga0055536_1002809 3300003781 Bacteria 9617
4 Ga0055534_1010483 3300003784 Bacteria 1939
5 Ga0055530_10000149 3300003791 Bacteria 63152
6 Ga0055530_10080671 3300003791 Unclassified 684
7 Ga0055531_10002722 3300003794 Bacteria 11629
8 Ga0065707_10086128 3300005295 Bacteria 5648
9 Ga0070670_100000082 3300005331 Bacteria 91524
10 Ga0070670_100000987 3300005331 Bacteria 22339
11 Ga0070666_10019328 3300005335 Bacteria 4397
12 Ga0070666_10201847 3300005335 Bacteria 1399
13 Ga0070668_100000018 3300005347 Bacteria 99142
14 Ga0070668_100000157 3300005347 Bacteria 43332
15 Ga0070668_100007745 3300005347 Bacteria 7973
16 Ga0070668_100007774 3300005347 Bacteria 7960
17 Ga0070669_100000015 3300005353 Bacteria 197597
18 Ga0070669_100080818 3300005353 Bacteria 2420
19 Ga0070671_100000134 3300005355 Bacteria 47424
20 Ga0070671_100000189 3300005355 Bacteria 41536
21 Ga0070667_100000003 3300005367 Bacteria 447715
22 Ga0070667_100003633 3300005367 Bacteria 13128
23 Ga0068867_102149867 3300005459 Bacteria 529
24 Ga0070679_101418660 3300005530 Bacteria 641
25 Ga0070665_100079057 3300005548 Bacteria 3295
26 Ga0070665_100240498 3300005548 Bacteria 1811
27 Ga0070665_100705230 3300005548 Bacteria 1022
28 Ga0068855_100249736 3300005563 Bacteria 1979
29 Ga0068855_100450124 3300005563 Bacteria 1405
30 Ga0068854_100276492 3300005578 Bacteria 1350
31 Ga0068859_100084792 3300005617 Bacteria 3213
32 Ga0068859_100087170 3300005617 Bacteria 3169
33 Ga0068859_100222720 3300005617 Bacteria 1974
34 Ga0068864_100000590 3300005618 Bacteria 30911
35 Ga0068864_100000611 3300005618 Bacteria 30197
36 Ga0068861_100142061 3300005719 Bacteria 1960
37 Ga0068863_100000030 3300005841 Bacteria 176023
38 Ga0068863_100004086 3300005841 Bacteria 14419
39 Ga0068863_100005477 3300005841 Bacteria 12502
40 Ga0068858_100039945 3300005842 Bacteria 4351
41 Ga0068860_100000068 3300005843 Bacteria 179208
42 Ga0068860_100008557 3300005843 Bacteria 10197
43 Ga0068860_100024210 3300005843 Bacteria 5870
44 Ga0068862_100000006 3300005844 Bacteria 346828
45 Ga0068862_100000158 3300005844 Bacteria 75829
46 Ga0068862_100000553 3300005844 Bacteria 39108
47 Ga0068862_100088985 3300005844 Bacteria 2687
48 Ga0068862_100344775 3300005844 Bacteria 1380
49 Ga0068862_101049031 3300005844 Bacteria 808
50 Ga0081539_10027394 3300005985 Bacteria 3611
51 Ga0081539_10029151 3300005985 Bacteria 3455
52 Ga0075370_10098283 3300006353 Bacteria 1693
53 Ga0097620_100045053 3300006931 Bacteria 4432
54 Ga0097620_100084792 3300006931 Bacteria 3213
55 Ga0097620_100087172 3300006931 Bacteria 3169
56 Ga0097620_100222715 3300006931 Bacteria 1974
57 Ga0105247_10006293 3300009101 Bacteria 7357
58 Ga0105248_10005555 3300009177 Bacteria 13855
59 Ga0105248_10213933 3300009177 Bacteria 2171
60 Ga0105248_10222080 3300009177 Bacteria 2127
61 Ga0105249_10001047 3300009553 Bacteria 24478
62 Ga0105249_10040572 3300009553 Bacteria 4228
63 Ga0105239_10924910 3300010375 Bacteria 1001
64 Ga0157370_10197665 3300013104 Bacteria 1866
65 Ga0157369_10006534 3300013105 Bacteria 13501
66 Ga0163162_11432273 3300013306 Bacteria 786
67 Ga0163163_12618016 3300014325 Bacteria 562
68 Ga0157380_10004403 3300014326 Bacteria 9760
69 Ga0157379_10617443 3300014968 Bacteria 1013
70 Ga0213874_10023856 3300021377 Bacteria 1710
71 Ga0213874_10104810 3300021377 Bacteria 944
72 Ga0213875_10009862 3300021388 Bacteria 4814
73 Ga0207425_1028854 3300025245 Bacteria 1122
74 Ga0209676_1000155 3300025292 Bacteria 165151
75 Ga0209050_1001595 3300025298 Bacteria 23432
76 Ga0209050_1013805 3300025298 Bacteria 3549
77 Ga0209257_1000169 3300025304 Bacteria 171227
78 Ga0207680_10107419 3300025903 Bacteria 1804
79 Ga0207680_10171928 3300025903 Bacteria 1460
80 Ga0207681_10000001 3300025923 Bacteria 1105841
81 Ga0207681_10074742 3300025923 Bacteria 2375
82 Ga0207681_10353899 3300025923 Bacteria 1176
83 Ga0207681_10359386 3300025923 Bacteria 1167
84 Ga0207681_11540189 3300025923 Bacteria 557
85 Ga0207650_10000050 3300025925 Bacteria 169589
86 Ga0207650_10001152 3300025925 Bacteria 19412
87 Ga0207650_10121268 3300025925 Bacteria 2036
88 Ga0207644_10000096 3300025931 Bacteria 63618
89 Ga0207644_10000160 3300025931 Bacteria 49009
90 Ga0207711_10001368 3300025941 Bacteria 22973
91 Ga0207711_10051424 3300025941 Bacteria 3528
92 Ga0207711_10281629 3300025941 Bacteria 1531
93 Ga0207667_10027821 3300025949 Bacteria 6148
94 Ga0207667_10442668 3300025949 Bacteria 1321
95 Ga0207712_10000754 3300025961 Bacteria 24470
96 Ga0207712_11365587 3300025961 Bacteria 634
97 Ga0207668_10000045 3300025972 Bacteria 103160
98 Ga0207668_10000082 3300025972 Bacteria 71860
99 Ga0207668_10008192 3300025972 Bacteria 6224
100 Ga0207668_10017957 3300025972 Bacteria 4441
101 Ga0207640_10296223 3300025981 Bacteria 1278
102 Ga0207658_10000002 3300025986 Bacteria 1364188
103 Ga0207658_10001979 3300025986 Bacteria 15290
104 Ga0207703_10000862 3300026035 Bacteria 29697
105 Ga0207641_10000001 3300026088 Bacteria 1180841
106 Ga0207641_10000277 3300026088 Bacteria 64441
107 Ga0207641_10018526 3300026088 Bacteria 5709
108 Ga0207641_10020991 3300026088 Bacteria 5369
109 Ga0207641_11227240 3300026088 Bacteria 750
110 Ga0207676_10000004 3300026095 Bacteria 725417
111 Ga0207676_10002101 3300026095 Bacteria 14423
112 Ga0207674_10784872 3300026116 Bacteria 919
113 Ga0207675_100000295 3300026118 Bacteria 48065
114 Ga0207675_100150221 3300026118 Bacteria 2217
115 Ga0207698_10233857 3300026142 Bacteria 1670
116 Ga0209974_10121085 3300027876 Bacteria 927
117 Ga0268266_10084595 3300028379 Bacteria 2770
118 Ga0268266_11072881 3300028379 Bacteria 779
119 Ga0268265_10000002 3300028380 Bacteria 1035381
120 Ga0268265_10000863 3300028380 Bacteria 28360
121 Ga0268265_10002804 3300028380 Bacteria 12834
122 Ga0268265_10102595 3300028380 Bacteria 2314
123 Ga0268265_10525374 3300028380 Unclassified 1119
124 Ga0268264_10000103 3300028381 Bacteria 222439
125 Ga0268264_10005457 3300028381 Bacteria 10777
126 Ga0268264_10051483 3300028381 Bacteria 3431
127 Ga0307513_10206581 3300031456 Bacteria 1799
128 Ga0307408_100096394 3300031548 Bacteria 2244
129 Ga0307405_10049434 3300031731 Bacteria 2599
130 Ga0307413_11763662 3300031824 Bacteria 553
131 Ga0307406_10043429 3300031901 Bacteria 2811
132 Ga0307406_10052217 3300031901 Bacteria 2599
133 Ga0307412_10000374 3300031911 Bacteria 27876
134 Ga0307412_10120880 3300031911 Bacteria 1885
135 Ga0307416_100086067 3300032002 Bacteria 2678
136 Ga0307414_10000144 3300032004 Bacteria 48442
137 Ga0307414_10000204 3300032004 Bacteria 39795
138 Ga0307414_10001310 3300032004 Bacteria 12846
139 Ga0307414_10024881 3300032004 Bacteria 3825
140 Ga0307414_10105658 3300032004 Bacteria 2129
141 Ga0307414_10319024 3300032004 Bacteria 1322
142 Ga0307414_10596389 3300032004 Bacteria 990
143 Ga0395905_0233607 3300037471 Bacteria 1719
144 Ga0436364_0024756 3300037853 Bacteria 185423
145 Ga0436363_1340139 3300039450 Bacteria 1569
146 Ga0436363_1455987 3300039450 Bacteria 582
147 Ga0436363_1469920 3300039450 Bacteria 1814
148 Ga0439461_0036024 3300041410 Bacteria 1052
149 Ga0451791_0759008 3300041451 Bacteria 897
150 Ga0451843_0637931 3300041509 Bacteria 1031
151 Ga0466973_0256329 3300044659 Bacteria 1224
152 Ga0466968_0027833 3300044735 Bacteria 2327
153 Ga0466968_0066687 3300044735 Bacteria 1559
154 Ga0466970_0430200 3300044765 Bacteria 755
155 Ga0495590_0178989 3300046457 Bacteria 775
156 Ga0495638_0016606 3300046460 Bacteria 4926
157 Ga0495607_0017292 3300046501 Bacteria 4633
158 Ga0495606_0064732 3300046507 Bacteria 2325
159 Ga0495654_0038575 3300046530 Bacteria 2388
160 Ga0495654_0073397 3300046530 Bacteria 1618
161 Ga0495668_0000002 3300046616 Bacteria 763179
162 Ga0495625_0000281 3300046660 Bacteria 79314
163 Ga0495681_0134047 3300047470 Bacteria 1052
164 Ga0495686_0000280 3300047472 Bacteria 90032
165 Ga0495686_0009528 3300047472 Bacteria 6987
166 Ga0495686_0126465 3300047472 Bacteria 1519
167 Ga0495686_0186785 3300047472 Bacteria 1197
168 Ga0495686_0192160 3300047472 Bacteria 1176
169 Ga0496117_0035482 3300048920 Bacteria 3742
170 Ga0496118_0003914 3300048921 Bacteria 18229
171 Ga0496121_0165994 3300048924 Bacteria 1609
172 Ga0496123_0307758 3300048926 Bacteria 753
173 Ga0496124_0100403 3300048927 Bacteria 2346
174 Ga0496124_0493052 3300048927 Bacteria 824
175 Ga0496124_0879944 3300048927 Bacteria 546
176 Ga0496125_0131899 3300048928 Bacteria 1757
177 Ga0496126_0750892 3300048929 Bacteria 753
178 Ga0501293_002761 3300049516 Bacteria 1340
179 Ga0501034_0447144 3300049571 Bacteria 1210
180 Ga0501043_0071837 3300049579 Bacteria 2718
181 Ga0501046_0467476 3300049580 Bacteria 906
182 Ga0501047_0035623 3300049581 Bacteria 4807
183 Ga0501047_0741092 3300049581 Unclassified 799
184 Ga0501048_0175816 3300049582 Bacteria 1517
185 Ga0501223_000070 3300049663 Bacteria 31069
186 Ga0501224_000012 3300049664 Bacteria 92585
187 Ga0501233_002559 3300049668 Bacteria 3212
188 Ga0501235_023213 3300049669 Bacteria 1382
189 Ga0501249_001919 3300049679 Bacteria 4225
190 Ga0501257_000067 3300049686 Bacteria 28497
191 Ga0501225_0000019 3300049705 Bacteria 59374
192 Ga0501229_044063 3300049706 Bacteria 643
193 Ga0501234_009850 3300049707 Bacteria 1491
194 Ga0501282_003404 3300049778 Bacteria 1714
195 Ga0501204_003755 3300049850 Bacteria 1613
196 Ga0501226_000064 3300049853 Bacteria 35696
197 Ga0501284_02254 3300050005 Bacteria 1059
198 nmdc:mga03683_187381_c1 3300050489 Bacteria 946
199 nmdc:mga03n38_664871_c1 3300050490 Bacteria 598
200 nmdc:mga0qj67_21757_c1 3300050509 Bacteria 4920
201 Ga0500643_000260 3300053087 Bacteria 47191
202 Ga0500643_003053 3300053087 Bacteria 8256
203 Ga0500643_092148 3300053087 Bacteria 826
204 Ga0500641_0009228 3300053096 Bacteria 3542
205 Ga0500650_0518956 3300053098 Bacteria 505
206 Ga0500592_000195 3300053116 Bacteria 11538
207 Ga0500592_006138 3300053116 Bacteria 1914
208 Ga0500652_317196 3300053131 Bacteria 598
209 Ga0500658_0336106 3300053134 Bacteria 694
210 Ga0500559_0021972 3300053136 Bacteria 2706
211 Ga0500559_0105602 3300053136 Bacteria 1301
212 Ga0500568_0001615 3300053139 Bacteria 14250
213 Ga0500604_0141909 3300053151 Bacteria 812
214 Ga0500616_0012599 3300053153 Bacteria 4946
215 Ga0500616_0015194 3300053153 Bacteria 4407
216 Ga0500627_0000015 3300053158 Bacteria 132947
217 Ga0500627_0000144 3300053158 Bacteria 20890
218 Ga0500627_0037844 3300053158 Bacteria 2060
219 Ga0500645_001058 3300053730 Bacteria 15269
220 2643832898 2643221563 Bacteria 4726935
221 2644037067 2643221605 Bacteria 4772303
222 2644053307 2643221608 Bacteria 4724829
223 2852656531 2852653556 Bacteria 4050083
224 2852684748 2852680915 Bacteria 4100189
225 Ga0501034_0218070
226 JGI24749J21850_1000334
227 Ga0055536_1002809
228 Ga0055534_1010483
229 Ga0055530_10000149
230 Ga0055530_10080671
231 Ga0055531_10002722
232 Ga0065707_10086128
233 Ga0070670_100000082
234 Ga0070670_100000987
235 Ga0070666_10019328
236 Ga0070666_10201847
237 Ga0070668_100000018
238 Ga0070668_100000157
239 Ga0070668_100007745
240 Ga0070668_100007774
241 Ga0070669_100000015
242 Ga0070669_100080818
243 Ga0070671_100000134
244 Ga0070671_100000189
245 Ga0070667_100000003
246 Ga0070667_100003633
247 Ga0068867_102149867
248 Ga0070679_101418660
249 Ga0070665_100079057
250 Ga0070665_100240498
251 Ga0070665_100705230
252 Ga0068855_100249736
253 Ga0068855_100450124
254 Ga0068854_100276492
255 Ga0068859_100084792
256 Ga0068859_100087170
257 Ga0068859_100222720
258 Ga0068864_100000590
259 Ga0068864_100000611
260 Ga0068861_100142061
261 Ga0068863_100000030
262 Ga0068863_100004086
263 Ga0068863_100005477
264 Ga0068858_100039945
265 Ga0068860_100000068
266 Ga0068860_100008557
267 Ga0068860_100024210
268 Ga0068862_100000006
269 Ga0068862_100000158
270 Ga0068862_100000553
271 Ga0068862_100088985
272 Ga0068862_100344775
273 Ga0068862_101049031
274 Ga0081539_10027394
275 Ga0081539_10029151
276 Ga0075370_10098283
277 Ga0097620_100045053
278 Ga0097620_100084792
279 Ga0097620_100087172
280 Ga0097620_100222715
281 Ga0105247_10006293
282 Ga0105248_10005555
283 Ga0105248_10213933
284 Ga0105248_10222080
285 Ga0105249_10001047
286 Ga0105249_10040572
287 Ga0105239_10924910
288 Ga0157370_10197665
289 Ga0157369_10006534
290 Ga0163162_11432273
291 Ga0163163_12618016
292 Ga0157380_10004403
293 Ga0157379_10617443
294 Ga0213874_10023856
295 Ga0213874_10104810
296 Ga0213875_10009862
297 Ga0207425_1028854
298 Ga0209676_1000155
299 Ga0209050_1001595
300 Ga0209050_1013805
301 Ga0209257_1000169
302 Ga0207680_10107419
303 Ga0207680_10171928
304 Ga0207681_10000001
305 Ga0207681_10074742
306 Ga0207681_10353899
307 Ga0207681_10359386
308 Ga0207681_11540189
309 Ga0207650_10000050
310 Ga0207650_10001152
311 Ga0207650_10121268
312 Ga0207644_10000096
313 Ga0207644_10000160
314 Ga0207711_10001368
315 Ga0207711_10051424
316 Ga0207711_10281629
317 Ga0207667_10027821
318 Ga0207667_10442668
319 Ga0207712_10000754
320 Ga0207712_11365587
321 Ga0207668_10000045
322 Ga0207668_10000082
323 Ga0207668_10008192
324 Ga0207668_10017957
325 Ga0207640_10296223
326 Ga0207658_10000002
327 Ga0207658_10001979
328 Ga0207703_10000862
329 Ga0207641_10000001
330 Ga0207641_10000277
331 Ga0207641_10018526
332 Ga0207641_10020991
333 Ga0207641_11227240
334 Ga0207676_10000004
335 Ga0207676_10002101
336 Ga0207674_10784872
337 Ga0207675_100000295
338 Ga0207675_100150221
339 Ga0207698_10233857
340 Ga0209974_10121085
341 Ga0268266_10084595
342 Ga0268266_11072881
343 Ga0268265_10000002
344 Ga0268265_10000863
345 Ga0268265_10002804
346 Ga0268265_10102595
347 Ga0268265_10525374
348 Ga0268264_10000103
349 Ga0268264_10005457
350 Ga0268264_10051483
351 Ga0307513_10206581
352 Ga0307408_100096394
353 Ga0307405_10049434
354 Ga0307413_11763662
355 Ga0307406_10043429
356 Ga0307406_10052217
357 Ga0307412_10000374
358 Ga0307412_10120880
359 Ga0307416_100086067
360 Ga0307414_10000144
361 Ga0307414_10000204
362 Ga0307414_10001310
363 Ga0307414_10024881
364 Ga0307414_10105658
365 Ga0307414_10319024
366 Ga0307414_10596389
367 Ga0395905_0233607
368 Ga0436364_0024756
369 Ga0436363_1340139
370 Ga0436363_1455987
371 Ga0436363_1469920
372 Ga0439461_0036024
373 Ga0451791_0759008
374 Ga0451843_0637931
375 Ga0466973_0256329
376 Ga0466968_0027833
377 Ga0466968_0066687
378 Ga0466970_0430200
379 Ga0495590_0178989
380 Ga0495638_0016606
381 Ga0495607_0017292
382 Ga0495606_0064732
383 Ga0495654_0038575
384 Ga0495654_0073397
385 Ga0495668_0000002
386 Ga0495625_0000281
387 Ga0495681_0134047
388 Ga0495686_0000280
389 Ga0495686_0009528
390 Ga0495686_0126465
391 Ga0495686_0186785
392 Ga0495686_0192160
393 Ga0496117_0035482
394 Ga0496118_0003914
395 Ga0496121_0165994
396 Ga0496123_0307758
397 Ga0496124_0100403
398 Ga0496124_0493052
399 Ga0496124_0879944
400 Ga0496125_0131899
401 Ga0496126_0750892
402 Ga0501293_002761
403 Ga0501034_0447144
404 Ga0501043_0071837
405 Ga0501046_0467476
406 Ga0501047_0035623
407 Ga0501047_0741092
408 Ga0501048_0175816
409 Ga0501223_000070
410 Ga0501224_000012
411 Ga0501233_002559
412 Ga0501235_023213
413 Ga0501249_001919
414 Ga0501257_000067
415 Ga0501225_0000019
416 Ga0501229_044063
417 Ga0501234_009850
418 Ga0501282_003404
419 Ga0501204_003755
420 Ga0501226_000064
421 Ga0501284_02254
422 nmdc:mga03683_187381_c1
423 nmdc:mga03n38_664871_c1
424 nmdc:mga0qj67_21757_c1
425 Ga0500643_000260
426 Ga0500643_003053
427 Ga0500643_092148
428 Ga0500641_0009228
429 Ga0500650_0518956
430 Ga0500592_000195
431 Ga0500592_006138
432 Ga0500652_317196
433 Ga0500658_0336106
434 Ga0500559_0021972
435 Ga0500559_0105602
436 Ga0500568_0001615
437 Ga0500604_0141909
438 Ga0500616_0012599
439 Ga0500616_0015194
440 Ga0500627_0000015
441 Ga0500627_0000144
442 Ga0500627_0037844
443 Ga0500645_001058
444 2643832898
445 2644037067
446 2644053307
447 2852656531
448 2852684748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22327

Nudt16-like

U8 snoRNA-decapping enzyme-like

24

104

0.92

PF14815

NUDIX_4

NUDIX domain

14

135

0.86

PF00293

NUDIX

NUDIX domain

9

136

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9679 5 135
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9607 5 135
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9602 6 135
3hhj-assembly1.cif.gz_A crystal structure of mutator mutt from bartonella henselae 0.9434 5 133
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9313 6 135
ID Description Score Start End Superfamily
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9594 6 135 3.90.79.10
af_P77788_1_135_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9544 5 134 3.90.79.10
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9301 6 135 3.90.79.10
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9247 7 134 3.90.79.10
af_Q54BB8_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9172 5 133 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A520INE6-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9977 7 111 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A2S8B6Z3-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9975 7 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A2N3D164-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.997 5 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A196MDB0-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9958 6 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A848HUH3-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9956 6 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716

Map