F337180

General Info

Members Datasets Scaffolds Average Seq Length
224 167 448 188

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0032830|Ga0501042_0032830_1606_2223
Length 205
Sequence MSVISITLPDISSRYICGVESLSATAYVILGLVRREPRSGYEIKSIVDNTTRFFWAASYGQIYPELKRLSEAGLVVGADAPTGGRRRTVYEITADGEEELVGWLRQPPSTFEMREEGLLKLFFADALPREEVLAILRAMREHRQRANEQLRAMEPGAAAKDDPFPLMVLRGGLEFTEWFAGWCERMEAQVLASLEDAETTEKRSS

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
167 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 6.25
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0032830 3300049578 Bacteria 3677
2 JGI24746J21847_1005380 3300001977 Bacteria 1997
3 JGI24748J21848_1000430 3300002074 Bacteria 4668
4 JGI24034J26672_10000411 3300002239 Bacteria 5564
5 JGI24742J22300_10001028 3300002244 Bacteria 4300
6 Ga0070683_100002626 3300005329 Bacteria 14369
7 Ga0070683_100017182 3300005329 Bacteria 6390
8 Ga0070683_100123964 3300005329 Bacteria 2442
9 Ga0068868_100036794 3300005338 Bacteria 3792
10 Ga0070691_10000014 3300005341 Bacteria 50487
11 Ga0070691_10000822 3300005341 Bacteria 12463
12 Ga0070691_10124063 3300005341 Bacteria 1303
13 Ga0070668_100186583 3300005347 Bacteria 1696
14 Ga0070675_100000008 3300005354 Bacteria 250004
15 Ga0070671_100083139 3300005355 Bacteria 2677
16 Ga0070667_100187005 3300005367 Bacteria 1833
17 Ga0070667_100414769 3300005367 Bacteria 1227
18 Ga0070713_100000143 3300005436 Bacteria 47475
19 Ga0070663_100837034 3300005455 Bacteria 791
20 Ga0070684_100015243 3300005535 Bacteria 6253
21 Ga0070684_100086410 3300005535 Bacteria 2783
22 Ga0070684_100170838 3300005535 Bacteria 1975
23 Ga0070684_100219547 3300005535 Bacteria 1734
24 Ga0068853_100045597 3300005539 Bacteria 3756
25 Ga0070686_100120603 3300005544 Bacteria 1800
26 Ga0070695_100472144 3300005545 Bacteria 965
27 Ga0070696_100695967 3300005546 Unclassified 828
28 Ga0070665_100021652 3300005548 Bacteria 6465
29 Ga0070665_100147478 3300005548 Bacteria 2355
30 Ga0070665_100198545 3300005548 Bacteria 2007
31 Ga0070704_100344674 3300005549 Bacteria 1256
32 Ga0070704_101247614 3300005549 Bacteria 679
33 Ga0068855_100237474 3300005563 Bacteria 2038
34 Ga0070664_100458140 3300005564 Bacteria 1171
35 Ga0068857_100031513 3300005577 Bacteria 4685
36 Ga0068857_100165589 3300005577 Bacteria 2007
37 Ga0068852_100068644 3300005616 Bacteria 3104
38 Ga0068864_100000024 3300005618 Bacteria 252632
39 Ga0068863_100104403 3300005841 Bacteria 2696
40 Ga0068858_100001203 3300005842 Bacteria 26823
41 Ga0068858_100154486 3300005842 Bacteria 2159
42 Ga0068858_100177128 3300005842 Bacteria 2012
43 Ga0068860_100309590 3300005843 Bacteria 1548
44 Ga0068862_100009094 3300005844 Bacteria 8223
45 Ga0068862_100447577 3300005844 Bacteria 1217
46 Ga0081455_10007159 3300005937 Bacteria 11796
47 Ga0081455_10044533 3300005937 Bacteria 3869
48 Ga0081540_1012601 3300005983 Bacteria 5551
49 Ga0081539_10006169 3300005985 Bacteria 11662
50 Ga0075365_10144950 3300006038 Bacteria 1650
51 Ga0075432_10115022 3300006058 Bacteria 1006
52 Ga0070712_100017741 3300006175 Bacteria 4611
53 Ga0068871_100367148 3300006358 Bacteria 1276
54 Ga0075428_100063002 3300006844 Bacteria 4059
55 Ga0075430_100200091 3300006846 Bacteria 1659
56 Ga0075430_100211197 3300006846 Bacteria 1610
57 Ga0075431_100023867 3300006847 Bacteria 6261
58 Ga0075433_10000057 3300006852 Bacteria 48581
59 Ga0075433_10782949 3300006852 Unclassified 834
60 Ga0075429_100597393 3300006880 Bacteria 967
61 Ga0075436_100241009 3300006914 Bacteria 1286
62 Ga0075435_100177001 3300007076 Bacteria 1801
63 Ga0105245_10379215 3300009098 Bacteria 1408
64 Ga0105247_10059634 3300009101 Bacteria 2363
65 Ga0105247_10154514 3300009101 Bacteria 1515
66 Ga0114129_10203402 3300009147 Bacteria 2681
67 Ga0105248_10358232 3300009177 Bacteria 1642
68 Ga0105249_10032203 3300009553 Bacteria 4742
69 Ga0105239_11441366 3300010375 Bacteria 795
70 Ga0105246_10153861 3300011119 Bacteria 1744
71 Ga0157370_10809210 3300013104 Bacteria 852
72 Ga0157378_10009533 3300013297 Bacteria 8455
73 Ga0157379_10216347 3300014968 Bacteria 1735
74 Ga0157376_10034405 3300014969 Bacteria 4091
75 Ga0207710_10039929 3300025900 Bacteria 2078
76 Ga0207693_10041878 3300025915 Bacteria 3605
77 Ga0207663_10022473 3300025916 Bacteria 3605
78 Ga0207659_10000014 3300025926 Bacteria 168481
79 Ga0207687_10072363 3300025927 Unclassified 2466
80 Ga0207700_10000008 3300025928 Bacteria 341717
81 Ga0207644_10348283 3300025931 Bacteria 1202
82 Ga0207709_10298963 3300025935 Archaea 1196
83 Ga0207711_10358997 3300025941 Bacteria 1350
84 Ga0207661_10001925 3300025944 Bacteria 14265
85 Ga0207661_10002334 3300025944 Bacteria 13072
86 Ga0207661_10038325 3300025944 Bacteria 3756
87 Ga0207661_10100794 3300025944 Bacteria 2424
88 Ga0207679_10470658 3300025945 Unclassified 1117
89 Ga0207667_10837967 3300025949 Unclassified 914
90 Ga0207712_10036707 3300025961 Bacteria 3340
91 Ga0207668_10073067 3300025972 Bacteria 2456
92 Ga0207658_10004729 3300025986 Bacteria 9427
93 Ga0207658_10257650 3300025986 Unclassified 1485
94 Ga0207677_10006635 3300026023 Bacteria 6351
95 Ga0207703_10000128 3300026035 Bacteria 91359
96 Ga0207703_10108312 3300026035 Bacteria 2366
97 Ga0207703_10345231 3300026035 Bacteria 1369
98 Ga0207639_10018001 3300026041 Bacteria 5012
99 Ga0207678_10398705 3300026067 Bacteria 1191
100 Ga0207678_11033234 3300026067 Unclassified 727
101 Ga0207702_10009876 3300026078 Bacteria 8000
102 Ga0207702_10150856 3300026078 Bacteria 2114
103 Ga0207702_11136985 3300026078 Bacteria 775
104 Ga0207641_10000265 3300026088 Bacteria 66346
105 Ga0207641_10049055 3300026088 Bacteria 3566
106 Ga0207676_10000065 3300026095 Bacteria 105757
107 Ga0207674_10002488 3300026116 Bacteria 23230
108 Ga0207683_10097071 3300026121 Bacteria 2628
109 Ga0207698_10051187 3300026142 Bacteria 3156
110 Ga0268266_10000020 3300028379 Bacteria 527065
111 Ga0268266_10001032 3300028379 Bacteria 35051
112 Ga0268266_10084754 3300028379 Bacteria 2768
113 Ga0268266_10515891 3300028379 Unclassified 1142
114 Ga0268265_10187399 3300028380 Bacteria 1783
115 Ga0268265_10408350 3300028380 Bacteria 1257
116 Ga0268264_10281913 3300028381 Bacteria 1557
117 Ga0268264_10435211 3300028381 Bacteria 1267
118 Ga0307415_100013269 3300032126 Bacteria 4804
119 Ga0373947_0678109 3300035725 Unclassified 703
120 Ga0373925_0767176 3300037068 Unclassified 795
121 Ga0395899_0010989 3300037312 Bacteria 6934
122 Ga0395899_0435183 3300037312 Bacteria 862
123 Ga0395900_0012221 3300037418 Bacteria 8778
124 Ga0395900_0031356 3300037418 Bacteria 5460
125 Ga0395898_0008414 3300037466 Bacteria 10908
126 Ga0395898_0022678 3300037466 Bacteria 6355
127 Ga0395905_0016538 3300037471 Bacteria 7012
128 Ga0395905_0063559 3300037471 Bacteria 3453
129 Ga0395901_0000500 3300038443 Bacteria 45375
130 Ga0395901_0004515 3300038443 Bacteria 14036
131 Ga0395901_0033107 3300038443 Bacteria 5333
132 Ga0451839_1557787 3300041496 Bacteria 917
133 Ga0451853_0068445 3300041512 Bacteria 2082
134 Ga0466957_0311334 3300044842 Bacteria 1060
135 Ga0451576_1697636 3300045051 Bacteria 654
136 Ga0466958_0029233 3300045836 Bacteria 3270
137 Ga0466967_0000005 3300045976 Bacteria 149543
138 Ga0495627_104873 3300046453 Unclassified 805
139 Ga0495603_0053865 3300046455 Bacteria 2386
140 Ga0495591_075854 3300046458 Bacteria 865
141 Ga0495629_0271569 3300046459 Bacteria 1165
142 Ga0495638_0012872 3300046460 Bacteria 5717
143 Ga0495641_0000020 3300046461 Bacteria 115404
144 Ga0495651_0042313 3300046462 Bacteria 3538
145 Ga0495653_0019245 3300046463 Bacteria 5537
146 Ga0495582_0044070 3300046473 Bacteria 2457
147 Ga0495582_0430773 3300046473 Bacteria 761
148 Ga0495605_0059680 3300046474 Bacteria 1831
149 Ga0495585_0105537 3300046492 Bacteria 1503
150 Ga0495607_0172352 3300046501 Bacteria 1092
151 Ga0495606_0000057 3300046507 Bacteria 197956
152 Ga0495608_0000079 3300046511 Bacteria 71469
153 Ga0495610_0070247 3300046512 Bacteria 1636
154 Ga0495628_0148852 3300046516 Bacteria 1784
155 Ga0495630_0071518 3300046517 Bacteria 2611
156 Ga0495631_0099352 3300046518 Bacteria 1253
157 Ga0495644_0053028 3300046523 Bacteria 1524
158 Ga0495642_0174389 3300046528 Bacteria 935
159 Ga0495621_0002863 3300046539 Bacteria 4698
160 Ga0495667_0000022 3300046559 Bacteria 176919
161 Ga0495656_0022537 3300046615 Bacteria 2468
162 Ga0495656_0202238 3300046615 Bacteria 986
163 Ga0495656_0310228 3300046615 Bacteria 810
164 Ga0495625_0001115 3300046660 Bacteria 34819
165 Ga0495625_0168154 3300046660 Bacteria 1465
166 Ga0495588_0000383 3300046674 Bacteria 25465
167 Ga0495588_0018656 3300046674 Bacteria 3387
168 Ga0495657_0000070 3300046675 Bacteria 92382
169 Ga0495623_0147963 3300046679 Bacteria 1391
170 Ga0495647_0062254 3300046681 Bacteria 1475
171 Ga0495658_0041490 3300046683 Bacteria 2564
172 Ga0495669_0240555 3300046684 Bacteria 869
173 Ga0495624_0388670 3300046690 Bacteria 838
174 Ga0495624_0667520 3300046690 Unclassified 618
175 Ga0495581_0023951 3300047315 Bacteria 3537
176 Ga0495604_0000416 3300047317 Bacteria 38302
177 Ga0495674_0001603 3300047319 Bacteria 22192
178 Ga0495672_0075534 3300047320 Bacteria 1895
179 Ga0495676_0032990 3300047321 Bacteria 4365
180 Ga0495680_0003889 3300047322 Bacteria 14452
181 Ga0495683_0096206 3300047323 Bacteria 1429
182 Ga0495675_0000569 3300047444 Bacteria 23886
183 Ga0495677_0050345 3300047445 Bacteria 1533
184 Ga0495615_0094938 3300048090 Bacteria 836
185 Ga0495626_0198557 3300048091 Bacteria 824
186 Ga0496102_0128947 3300048905 Bacteria 2366
187 Ga0496104_0007611 3300048907 Bacteria 9588
188 Ga0496105_0001638 3300048908 Bacteria 15935
189 Ga0496106_0230183 3300048909 Bacteria 1480
190 Ga0496109_0106513 3300048912 Bacteria 2604
191 Ga0496110_0069576 3300048913 Bacteria 3117
192 Ga0496110_0073935 3300048913 Bacteria 3025
193 Ga0496110_0150702 3300048913 Bacteria 2106
194 Ga0496111_0011206 3300048914 Bacteria 6035
195 Ga0496111_0219092 3300048914 Bacteria 1414
196 Ga0496111_0397538 3300048914 Bacteria 1018
197 Ga0496111_0495109 3300048914 Bacteria 900
198 Ga0496113_0100520 3300048916 Bacteria 2241
199 Ga0496113_0114765 3300048916 Bacteria 2100
200 Ga0496116_0000423 3300048919 Bacteria 59658
201 Ga0496119_0003452 3300048922 Bacteria 16403
202 Ga0501039_1054774 3300049575 Bacteria 631
203 Ga0501070_0074595 3300049586 Bacteria 2808
204 nmdc:mga0yw44_110782_c1 3300050492 Bacteria 1758
205 nmdc:mga05p37_1072794_c1 3300050507 Bacteria 847
206 nmdc:mga09592_562749_c1 3300050508 Bacteria 979
207 nmdc:mga0qj67_260986_c1 3300050509 Bacteria 1405
208 nmdc:mga0qj67_52668_c1 3300050509 Bacteria 3221
209 nmdc:mga06r32_27200_c1 3300050510 Bacteria 5340
210 nmdc:mga0n895_682265_c1 3300050512 Viruses 1024
211 nmdc:mga0rr50_168000_c1 3300050513 Bacteria 1785
212 nmdc:mga08x19_72712_c1 3300050514 Bacteria 1366
213 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
214 nmdc:mga0a205_712083_c1 3300050515 Bacteria 853
215 Ga0495601_0000031 3300053077 Bacteria 105493
216 Ga0495612_0004236 3300053078 Bacteria 5954
217 Ga0495612_0006017 3300053078 Bacteria 4998
218 Ga0495612_0045141 3300053078 Bacteria 1804
219 Ga0495655_0002118 3300053083 Bacteria 3118
220 Ga0495595_0000004 3300053084 Bacteria 260821
221 Ga0495619_0000061 3300053085 Bacteria 88943
222 Ga0495619_0000194 3300053085 Bacteria 44733
223 Ga0500641_0066895 3300053096 Bacteria 1505
224 Ga0500614_000095 3300053123 Bacteria 20668
225 Ga0501042_0032830
226 JGI24746J21847_1005380
227 JGI24748J21848_1000430
228 JGI24034J26672_10000411
229 JGI24742J22300_10001028
230 Ga0070683_100002626
231 Ga0070683_100017182
232 Ga0070683_100123964
233 Ga0068868_100036794
234 Ga0070691_10000014
235 Ga0070691_10000822
236 Ga0070691_10124063
237 Ga0070668_100186583
238 Ga0070675_100000008
239 Ga0070671_100083139
240 Ga0070667_100187005
241 Ga0070667_100414769
242 Ga0070713_100000143
243 Ga0070663_100837034
244 Ga0070684_100015243
245 Ga0070684_100086410
246 Ga0070684_100170838
247 Ga0070684_100219547
248 Ga0068853_100045597
249 Ga0070686_100120603
250 Ga0070695_100472144
251 Ga0070696_100695967
252 Ga0070665_100021652
253 Ga0070665_100147478
254 Ga0070665_100198545
255 Ga0070704_100344674
256 Ga0070704_101247614
257 Ga0068855_100237474
258 Ga0070664_100458140
259 Ga0068857_100031513
260 Ga0068857_100165589
261 Ga0068852_100068644
262 Ga0068864_100000024
263 Ga0068863_100104403
264 Ga0068858_100001203
265 Ga0068858_100154486
266 Ga0068858_100177128
267 Ga0068860_100309590
268 Ga0068862_100009094
269 Ga0068862_100447577
270 Ga0081455_10007159
271 Ga0081455_10044533
272 Ga0081540_1012601
273 Ga0081539_10006169
274 Ga0075365_10144950
275 Ga0075432_10115022
276 Ga0070712_100017741
277 Ga0068871_100367148
278 Ga0075428_100063002
279 Ga0075430_100200091
280 Ga0075430_100211197
281 Ga0075431_100023867
282 Ga0075433_10000057
283 Ga0075433_10782949
284 Ga0075429_100597393
285 Ga0075436_100241009
286 Ga0075435_100177001
287 Ga0105245_10379215
288 Ga0105247_10059634
289 Ga0105247_10154514
290 Ga0114129_10203402
291 Ga0105248_10358232
292 Ga0105249_10032203
293 Ga0105239_11441366
294 Ga0105246_10153861
295 Ga0157370_10809210
296 Ga0157378_10009533
297 Ga0157379_10216347
298 Ga0157376_10034405
299 Ga0207710_10039929
300 Ga0207693_10041878
301 Ga0207663_10022473
302 Ga0207659_10000014
303 Ga0207687_10072363
304 Ga0207700_10000008
305 Ga0207644_10348283
306 Ga0207709_10298963
307 Ga0207711_10358997
308 Ga0207661_10001925
309 Ga0207661_10002334
310 Ga0207661_10038325
311 Ga0207661_10100794
312 Ga0207679_10470658
313 Ga0207667_10837967
314 Ga0207712_10036707
315 Ga0207668_10073067
316 Ga0207658_10004729
317 Ga0207658_10257650
318 Ga0207677_10006635
319 Ga0207703_10000128
320 Ga0207703_10108312
321 Ga0207703_10345231
322 Ga0207639_10018001
323 Ga0207678_10398705
324 Ga0207678_11033234
325 Ga0207702_10009876
326 Ga0207702_10150856
327 Ga0207702_11136985
328 Ga0207641_10000265
329 Ga0207641_10049055
330 Ga0207676_10000065
331 Ga0207674_10002488
332 Ga0207683_10097071
333 Ga0207698_10051187
334 Ga0268266_10000020
335 Ga0268266_10001032
336 Ga0268266_10084754
337 Ga0268266_10515891
338 Ga0268265_10187399
339 Ga0268265_10408350
340 Ga0268264_10281913
341 Ga0268264_10435211
342 Ga0307415_100013269
343 Ga0373947_0678109
344 Ga0373925_0767176
345 Ga0395899_0010989
346 Ga0395899_0435183
347 Ga0395900_0012221
348 Ga0395900_0031356
349 Ga0395898_0008414
350 Ga0395898_0022678
351 Ga0395905_0016538
352 Ga0395905_0063559
353 Ga0395901_0000500
354 Ga0395901_0004515
355 Ga0395901_0033107
356 Ga0451839_1557787
357 Ga0451853_0068445
358 Ga0466957_0311334
359 Ga0451576_1697636
360 Ga0466958_0029233
361 Ga0466967_0000005
362 Ga0495627_104873
363 Ga0495603_0053865
364 Ga0495591_075854
365 Ga0495629_0271569
366 Ga0495638_0012872
367 Ga0495641_0000020
368 Ga0495651_0042313
369 Ga0495653_0019245
370 Ga0495582_0044070
371 Ga0495582_0430773
372 Ga0495605_0059680
373 Ga0495585_0105537
374 Ga0495607_0172352
375 Ga0495606_0000057
376 Ga0495608_0000079
377 Ga0495610_0070247
378 Ga0495628_0148852
379 Ga0495630_0071518
380 Ga0495631_0099352
381 Ga0495644_0053028
382 Ga0495642_0174389
383 Ga0495621_0002863
384 Ga0495667_0000022
385 Ga0495656_0022537
386 Ga0495656_0202238
387 Ga0495656_0310228
388 Ga0495625_0001115
389 Ga0495625_0168154
390 Ga0495588_0000383
391 Ga0495588_0018656
392 Ga0495657_0000070
393 Ga0495623_0147963
394 Ga0495647_0062254
395 Ga0495658_0041490
396 Ga0495669_0240555
397 Ga0495624_0388670
398 Ga0495624_0667520
399 Ga0495581_0023951
400 Ga0495604_0000416
401 Ga0495674_0001603
402 Ga0495672_0075534
403 Ga0495676_0032990
404 Ga0495680_0003889
405 Ga0495683_0096206
406 Ga0495675_0000569
407 Ga0495677_0050345
408 Ga0495615_0094938
409 Ga0495626_0198557
410 Ga0496102_0128947
411 Ga0496104_0007611
412 Ga0496105_0001638
413 Ga0496106_0230183
414 Ga0496109_0106513
415 Ga0496110_0069576
416 Ga0496110_0073935
417 Ga0496110_0150702
418 Ga0496111_0011206
419 Ga0496111_0219092
420 Ga0496111_0397538
421 Ga0496111_0495109
422 Ga0496113_0100520
423 Ga0496113_0114765
424 Ga0496116_0000423
425 Ga0496119_0003452
426 Ga0501039_1054774
427 Ga0501070_0074595
428 nmdc:mga0yw44_110782_c1
429 nmdc:mga05p37_1072794_c1
430 nmdc:mga09592_562749_c1
431 nmdc:mga0qj67_260986_c1
432 nmdc:mga0qj67_52668_c1
433 nmdc:mga06r32_27200_c1
434 nmdc:mga0n895_682265_c1
435 nmdc:mga0rr50_168000_c1
436 nmdc:mga08x19_72712_c1
437 nmdc:mga0a205_1_c2
438 nmdc:mga0a205_712083_c1
439 Ga0495601_0000031
440 Ga0495612_0004236
441 Ga0495612_0006017
442 Ga0495612_0045141
443 Ga0495655_0002118
444 Ga0495595_0000004
445 Ga0495619_0000061
446 Ga0495619_0000194
447 Ga0500641_0066895
448 Ga0500614_000095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

29

101

0.97

PF10400

Vir_act_alpha_C

Virulence activator alpha C-term

113

190

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9225 7 85
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9204 6 85
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.9095 5 86
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.9078 7 85
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9004 6 86
ID Description Score Start End Superfamily
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9302 1 93 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9225 7 85 1.10.10.10
5h20A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9078 7 85 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9045 7 85 1.10.10.10
af_Q57807_1_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9029 4 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5U799-F1-model_v4 PadR family transcriptional regulator 0.9625 1 171
AF-A0A4R1SA42-F1-model_v4 PadR family transcriptional regulator 0.9524 6 171
AF-A0A535RA41-F1-model_v4 PadR family transcriptional regulator 0.9472 3 173
AF-A0A1Y4NFL1-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9466 6 86
AF-A0A7J2N5G4-F1-model_v4 deleted 0.946 6 85

Map