F337186

General Info

Members Datasets Scaffolds Average Seq Length
224 125 448 158

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0036018|Ga0501047_0036018_2854_3405
Length 183
Sequence LAAPDGSNLYAGQAQWQKEIVMDQTSKPVSVDVEEIKKLLPHRAPFLFLERLTDIVPNESAVGHKAVSINEPHFQGHFPEFAVMPGVLIVEAMAQTAGALVVYSLGRASLSRKVYFMTIDKARFRRPVKPGDMLRFPVKAIRHRGPVWRFSGEAFVGDDLAAEAEFSAMIFDGEDENPSNGNR

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
123 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 0
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0036018 3300049581 Bacteria 4782
2 Ga0070658_10802594 3300005327 Bacteria 818
3 Ga0070683_100401366 3300005329 Bacteria 1307
4 Ga0070680_100000678 3300005336 Bacteria 23649
5 Ga0070691_10068029 3300005341 Bacteria 1724
6 Ga0070661_100000150 3300005344 Bacteria 57095
7 Ga0070674_101913605 3300005356 Bacteria 539
8 Ga0070659_100453277 3300005366 Bacteria 1088
9 Ga0070681_10000001 3300005458 Bacteria 946857
10 Ga0070679_100002973 3300005530 Bacteria 15467
11 Ga0070679_100210344 3300005530 Bacteria 1909
12 Ga0070684_101353719 3300005535 Bacteria 670
13 Ga0068853_100002664 3300005539 Bacteria 13457
14 Ga0068853_100787229 3300005539 Bacteria 910
15 Ga0070696_100062360 3300005546 Bacteria 2609
16 Ga0068855_100067359 3300005563 Bacteria 4171
17 Ga0068855_101311691 3300005563 Bacteria 749
18 Ga0068857_100020640 3300005577 Bacteria 5797
19 Ga0068856_101200593 3300005614 Bacteria 775
20 Ga0068852_100129142 3300005616 Bacteria 2325
21 Ga0068852_100182884 3300005616 Bacteria 1972
22 Ga0068852_101208611 3300005616 Bacteria 777
23 Ga0070712_100045788 3300006175 Bacteria 3022
24 Ga0070712_100090186 3300006175 Bacteria 2244
25 Ga0070712_101203506 3300006175 Unclassified 659
26 Ga0097621_100515950 3300006237 Bacteria 1084
27 Ga0068871_100210861 3300006358 Bacteria 1680
28 Ga0105240_10000122 3300009093 Bacteria 162728
29 Ga0105240_10200640 3300009093 Bacteria 2338
30 Ga0105240_10337341 3300009093 Bacteria 1713
31 Ga0105247_10012247 3300009101 Bacteria 5153
32 Ga0105241_10391852 3300009174 Bacteria 1216
33 Ga0105248_10000005 3300009177 Bacteria 673111
34 Ga0105238_10044118 3300009551 Bacteria 4510
35 Ga0105239_10001682 3300010375 Bacteria 29165
36 Ga0105239_10020204 3300010375 Bacteria 7347
37 Ga0105239_10040279 3300010375 Bacteria 5119
38 Ga0157370_10085929 3300013104 Bacteria 2956
39 Ga0157369_10003771 3300013105 Bacteria 18015
40 Ga0157369_10106843 3300013105 Bacteria 2978
41 Ga0157378_10717148 3300013297 Bacteria 1021
42 Ga0163162_11513114 3300013306 Unclassified 765
43 Ga0163162_11992341 3300013306 Bacteria 665
44 Ga0157372_10024220 3300013307 Bacteria 6589
45 Ga0157372_10024401 3300013307 Bacteria 6568
46 Ga0157372_10031283 3300013307 Bacteria 5827
47 Ga0157372_10392315 3300013307 Bacteria 1617
48 Ga0157375_11685370 3300013308 Bacteria 750
49 Ga0157379_10149808 3300014968 Bacteria 2104
50 Ga0157376_10440145 3300014969 Bacteria 1269
51 Ga0157376_10481599 3300014969 Bacteria 1216
52 Ga0213874_10009758 3300021377 Bacteria 2385
53 Ga0213874_10082429 3300021377 Bacteria 1044
54 Ga0213876_10000148 3300021384 Bacteria 75586
55 Ga0213876_10031297 3300021384 Bacteria 2808
56 Ga0207692_10498446 3300025898 Bacteria 772
57 Ga0207710_10029834 3300025900 Bacteria 2376
58 Ga0207705_10440040 3300025909 Bacteria 1010
59 Ga0207654_10075193 3300025911 Bacteria 2018
60 Ga0207707_10000048 3300025912 Bacteria 117799
61 Ga0207695_10000173 3300025913 Bacteria 189050
62 Ga0207695_10252785 3300025913 Bacteria 1661
63 Ga0207671_10311359 3300025914 Bacteria 1245
64 Ga0207693_10084643 3300025915 Bacteria 2485
65 Ga0207693_10149522 3300025915 Bacteria 1837
66 Ga0207660_10000072 3300025917 Bacteria 52074
67 Ga0207649_10000162 3300025920 Bacteria 54357
68 Ga0207649_10363949 3300025920 Bacteria 1074
69 Ga0207652_10000509 3300025921 Bacteria 39514
70 Ga0207694_10000005 3300025924 Bacteria 823704
71 Ga0207690_10396103 3300025932 Bacteria 1100
72 Ga0207686_10039234 3300025934 Bacteria 2873
73 Ga0207711_10000002 3300025941 Bacteria 1228676
74 Ga0207667_10000011 3300025949 Bacteria 447785
75 Ga0207639_10003988 3300026041 Bacteria 9964
76 Ga0207683_10703962 3300026121 Bacteria 936
77 Ga0207698_10001097 3300026142 Bacteria 15766
78 Ga0207698_11612939 3300026142 Bacteria 664
79 Ga0265337_1019924 3300028556 Bacteria 2109
80 Ga0265318_10000015 3300028577 Bacteria 187234
81 Ga0265338_10000005 3300028800 Bacteria 571137
82 Ga0265338_10022733 3300028800 Bacteria 6476
83 Ga0265338_10271721 3300028800 Bacteria 1242
84 Ga0265324_10175681 3300029957 Bacteria 727
85 Ga0265330_10005233 3300031235 Bacteria 6480
86 Ga0265330_10255174 3300031235 Bacteria 739
87 Ga0265332_10254315 3300031238 Bacteria 726
88 Ga0265328_10023539 3300031239 Bacteria 2337
89 Ga0265325_10000005 3300031241 Bacteria 321343
90 Ga0265325_10030485 3300031241 Bacteria 2891
91 Ga0265325_10068789 3300031241 Bacteria 1782
92 Ga0265329_10050018 3300031242 Bacteria 1331
93 Ga0265340_10000182 3300031247 Bacteria 31971
94 Ga0265340_10005143 3300031247 Bacteria 7272
95 Ga0265340_10125170 3300031247 Bacteria 1181
96 Ga0265339_10000502 3300031249 Bacteria 30556
97 Ga0265339_10022162 3300031249 Bacteria 3683
98 Ga0265339_10052265 3300031249 Bacteria 2226
99 Ga0265331_10000003 3300031250 Bacteria 499358
100 Ga0265331_10003172 3300031250 Bacteria 10736
101 Ga0265331_10004852 3300031250 Bacteria 8279
102 Ga0265331_10040245 3300031250 Bacteria 2275
103 Ga0265331_10094956 3300031250 Bacteria 1376
104 Ga0265327_10000453 3300031251 Bacteria 73806
105 Ga0265316_10073786 3300031344 Bacteria 2627
106 Ga0265316_10365298 3300031344 Bacteria 1043
107 Ga0265316_10552878 3300031344 Bacteria 819
108 Ga0265316_10759197 3300031344 Bacteria 681
109 Ga0265313_10004669 3300031595 Bacteria 10353
110 Ga0265313_10036321 3300031595 Bacteria 2474
111 Ga0265313_10036660 3300031595 Bacteria 2460
112 Ga0265313_10078119 3300031595 Bacteria 1510
113 Ga0265313_10259298 3300031595 Bacteria 707
114 Ga0265314_10001066 3300031711 Bacteria 31856
115 Ga0265314_10010159 3300031711 Bacteria 7888
116 Ga0265314_10014519 3300031711 Bacteria 6296
117 Ga0265314_10027232 3300031711 Bacteria 4283
118 Ga0265314_10046627 3300031711 Bacteria 3056
119 Ga0265314_10068570 3300031711 Bacteria 2384
120 Ga0265314_10071262 3300031711 Bacteria 2326
121 Ga0265314_10192567 3300031711 Bacteria 1212
122 Ga0265342_10019403 3300031712 Bacteria 4383
123 Ga0265342_10051946 3300031712 Bacteria 2444
124 Ga0265342_10065356 3300031712 Bacteria 2132
125 Ga0307516_10028379 3300031730 Bacteria 5663
126 Ga0373926_0198543 3300035083 Bacteria 772
127 Ga0373945_0003086 3300035116 Bacteria 5234
128 Ga0373943_0001631 3300035170 Bacteria 10178
129 Ga0373946_0039800 3300035171 Bacteria 1920
130 Ga0373955_0119517 3300035172 Bacteria 1531
131 Ga0373935_0359157 3300035692 Bacteria 1040
132 Ga0373927_0073369 3300035695 Bacteria 2216
133 Ga0373933_0985937 3300035724 Unclassified 555
134 Ga0373947_0012891 3300035725 Bacteria 4792
135 Ga0373947_0063236 3300035725 Bacteria 2254
136 Ga0373937_0304043 3300036401 Bacteria 1508
137 Ga0373937_0362368 3300036401 Unclassified 1374
138 Ga0373925_0003618 3300037068 Bacteria 11903
139 Ga0373925_0481338 3300037068 Bacteria 1018
140 Ga0436365_0040755 3300039437 Bacteria 3579
141 Ga0436365_1201434 3300039437 Bacteria 113887
142 Ga0436363_0671455 3300039450 Bacteria 2050
143 Ga0436363_1537794 3300039450 Bacteria 5547
144 Ga0495592_0414510 3300046454 Bacteria 851
145 Ga0495651_0206644 3300046462 Bacteria 1370
146 Ga0495580_0010986 3300046472 Bacteria 7018
147 Ga0495580_0182490 3300046472 Bacteria 1449
148 Ga0495664_0221356 3300046477 Bacteria 1146
149 Ga0495606_0281484 3300046507 Bacteria 909
150 Ga0495608_0709991 3300046511 Unclassified 598
151 Ga0495652_0014997 3300046529 Bacteria 6942
152 Ga0495645_0084120 3300046543 Bacteria 2278
153 Ga0495599_0280796 3300046678 Bacteria 1009
154 Ga0495658_0001457 3300046683 Bacteria 12459
155 Ga0495613_0261955 3300046689 Bacteria 1204
156 Ga0495674_0067845 3300047319 Bacteria 3089
157 Ga0495684_0267742 3300047471 Bacteria 1237
158 Ga0495682_0017653 3300049460 Bacteria 2690
159 Ga0501031_0145431 3300049568 Bacteria 1549
160 Ga0501031_0606990 3300049568 Bacteria 704
161 Ga0501032_0023989 3300049569 Bacteria 4214
162 Ga0501033_0005941 3300049570 Bacteria 9582
163 Ga0501033_0011542 3300049570 Bacteria 6759
164 Ga0501034_0008345 3300049571 Bacteria 10959
165 Ga0501034_0128084 3300049571 Bacteria 2523
166 Ga0501036_0003392 3300049572 Bacteria 12727
167 Ga0501036_0191212 3300049572 Bacteria 1722
168 Ga0501037_0095241 3300049573 Bacteria 2152
169 Ga0501037_0492482 3300049573 Bacteria 832
170 Ga0501038_0033902 3300049574 Bacteria 4492
171 Ga0501038_0498065 3300049574 Bacteria 932
172 Ga0501038_0538145 3300049574 Bacteria 889
173 Ga0501039_0102394 3300049575 Bacteria 2235
174 Ga0501043_0178126 3300049579 Bacteria 1657
175 Ga0501043_0390808 3300049579 Bacteria 1052
176 Ga0501046_0008185 3300049580 Bacteria 9134
177 Ga0501046_0084392 3300049580 Bacteria 2450
178 Ga0501046_0183242 3300049580 Bacteria 1565
179 Ga0501047_0010315 3300049581 Bacteria 8835
180 Ga0501047_0037428 3300049581 Bacteria 4691
181 Ga0501047_0037683 3300049581 Bacteria 4676
182 Ga0501047_0093477 3300049581 Bacteria 2886
183 Ga0501047_0199001 3300049581 Bacteria 1865
184 Ga0501047_0265594 3300049581 Bacteria 1563
185 Ga0501047_0931307 3300049581 Unclassified 682
186 Ga0501067_0027301 3300049583 Bacteria 3163
187 Ga0501067_0407460 3300049583 Bacteria 758
188 Ga0501068_0032307 3300049584 Bacteria 3113
189 Ga0501069_0007161 3300049585 Bacteria 5846
190 Ga0501069_0069537 3300049585 Bacteria 1971
191 Ga0501070_0018697 3300049586 Bacteria 5813
192 Ga0501070_0023113 3300049586 Bacteria 5207
193 Ga0501070_0027976 3300049586 Bacteria 4729
194 Ga0501070_0133375 3300049586 Bacteria 2051
195 Ga0501073_0045384 3300049589 Bacteria 3094
196 Ga0501073_0311760 3300049589 Bacteria 1085
197 Ga0501074_0062472 3300049590 Bacteria 2682
198 Ga0501074_0276948 3300049590 Bacteria 1193
199 Ga0501074_0358426 3300049590 Bacteria 1035
200 Ga0501079_0004550 3300049741 Bacteria 10280
201 Ga0501080_0009629 3300049742 Bacteria 8821
202 Ga0501080_0126877 3300049742 Bacteria 2363
203 Ga0501080_0180241 3300049742 Bacteria 1944
204 Ga0501080_0293429 3300049742 Bacteria 1476
205 Ga0501080_0627873 3300049742 Bacteria 952
206 Ga0501083_0048503 3300049744 Bacteria 2866
207 Ga0501083_0315182 3300049744 Bacteria 1017
208 Ga0501035_0028867 3300049822 Bacteria 5061
209 Ga0501035_0054492 3300049822 Bacteria 3573
210 Ga0501035_0093556 3300049822 Bacteria 2644
211 Ga0501035_0114583 3300049822 Bacteria 2360
212 Ga0501035_0186648 3300049822 Bacteria 1784
213 Ga0501035_0219940 3300049822 Bacteria 1622
214 Ga0501035_0276278 3300049822 Bacteria 1421
215 Ga0501044_0005208 3300049823 Bacteria 14476
216 Ga0501044_0016703 3300049823 Bacteria 7879
217 Ga0501044_0023502 3300049823 Bacteria 6557
218 Ga0501044_0231232 3300049823 Bacteria 1796
219 Ga0501044_0532399 3300049823 Bacteria 1073
220 Ga0500573_0000008 3300053140 Bacteria 237795
221 Ga0500619_023906 3300053154 Bacteria 1791
222 Ga0501084_0000017 3300054114 Bacteria 148659
223 Ga0501084_0043454 3300054114 Bacteria 3759
224 Ga0501082_0113783 3300060353 Bacteria 2343
225 Ga0501047_0036018
226 Ga0070658_10802594
227 Ga0070683_100401366
228 Ga0070680_100000678
229 Ga0070691_10068029
230 Ga0070661_100000150
231 Ga0070674_101913605
232 Ga0070659_100453277
233 Ga0070681_10000001
234 Ga0070679_100002973
235 Ga0070679_100210344
236 Ga0070684_101353719
237 Ga0068853_100002664
238 Ga0068853_100787229
239 Ga0070696_100062360
240 Ga0068855_100067359
241 Ga0068855_101311691
242 Ga0068857_100020640
243 Ga0068856_101200593
244 Ga0068852_100129142
245 Ga0068852_100182884
246 Ga0068852_101208611
247 Ga0070712_100045788
248 Ga0070712_100090186
249 Ga0070712_101203506
250 Ga0097621_100515950
251 Ga0068871_100210861
252 Ga0105240_10000122
253 Ga0105240_10200640
254 Ga0105240_10337341
255 Ga0105247_10012247
256 Ga0105241_10391852
257 Ga0105248_10000005
258 Ga0105238_10044118
259 Ga0105239_10001682
260 Ga0105239_10020204
261 Ga0105239_10040279
262 Ga0157370_10085929
263 Ga0157369_10003771
264 Ga0157369_10106843
265 Ga0157378_10717148
266 Ga0163162_11513114
267 Ga0163162_11992341
268 Ga0157372_10024220
269 Ga0157372_10024401
270 Ga0157372_10031283
271 Ga0157372_10392315
272 Ga0157375_11685370
273 Ga0157379_10149808
274 Ga0157376_10440145
275 Ga0157376_10481599
276 Ga0213874_10009758
277 Ga0213874_10082429
278 Ga0213876_10000148
279 Ga0213876_10031297
280 Ga0207692_10498446
281 Ga0207710_10029834
282 Ga0207705_10440040
283 Ga0207654_10075193
284 Ga0207707_10000048
285 Ga0207695_10000173
286 Ga0207695_10252785
287 Ga0207671_10311359
288 Ga0207693_10084643
289 Ga0207693_10149522
290 Ga0207660_10000072
291 Ga0207649_10000162
292 Ga0207649_10363949
293 Ga0207652_10000509
294 Ga0207694_10000005
295 Ga0207690_10396103
296 Ga0207686_10039234
297 Ga0207711_10000002
298 Ga0207667_10000011
299 Ga0207639_10003988
300 Ga0207683_10703962
301 Ga0207698_10001097
302 Ga0207698_11612939
303 Ga0265337_1019924
304 Ga0265318_10000015
305 Ga0265338_10000005
306 Ga0265338_10022733
307 Ga0265338_10271721
308 Ga0265324_10175681
309 Ga0265330_10005233
310 Ga0265330_10255174
311 Ga0265332_10254315
312 Ga0265328_10023539
313 Ga0265325_10000005
314 Ga0265325_10030485
315 Ga0265325_10068789
316 Ga0265329_10050018
317 Ga0265340_10000182
318 Ga0265340_10005143
319 Ga0265340_10125170
320 Ga0265339_10000502
321 Ga0265339_10022162
322 Ga0265339_10052265
323 Ga0265331_10000003
324 Ga0265331_10003172
325 Ga0265331_10004852
326 Ga0265331_10040245
327 Ga0265331_10094956
328 Ga0265327_10000453
329 Ga0265316_10073786
330 Ga0265316_10365298
331 Ga0265316_10552878
332 Ga0265316_10759197
333 Ga0265313_10004669
334 Ga0265313_10036321
335 Ga0265313_10036660
336 Ga0265313_10078119
337 Ga0265313_10259298
338 Ga0265314_10001066
339 Ga0265314_10010159
340 Ga0265314_10014519
341 Ga0265314_10027232
342 Ga0265314_10046627
343 Ga0265314_10068570
344 Ga0265314_10071262
345 Ga0265314_10192567
346 Ga0265342_10019403
347 Ga0265342_10051946
348 Ga0265342_10065356
349 Ga0307516_10028379
350 Ga0373926_0198543
351 Ga0373945_0003086
352 Ga0373943_0001631
353 Ga0373946_0039800
354 Ga0373955_0119517
355 Ga0373935_0359157
356 Ga0373927_0073369
357 Ga0373933_0985937
358 Ga0373947_0012891
359 Ga0373947_0063236
360 Ga0373937_0304043
361 Ga0373937_0362368
362 Ga0373925_0003618
363 Ga0373925_0481338
364 Ga0436365_0040755
365 Ga0436365_1201434
366 Ga0436363_0671455
367 Ga0436363_1537794
368 Ga0495592_0414510
369 Ga0495651_0206644
370 Ga0495580_0010986
371 Ga0495580_0182490
372 Ga0495664_0221356
373 Ga0495606_0281484
374 Ga0495608_0709991
375 Ga0495652_0014997
376 Ga0495645_0084120
377 Ga0495599_0280796
378 Ga0495658_0001457
379 Ga0495613_0261955
380 Ga0495674_0067845
381 Ga0495684_0267742
382 Ga0495682_0017653
383 Ga0501031_0145431
384 Ga0501031_0606990
385 Ga0501032_0023989
386 Ga0501033_0005941
387 Ga0501033_0011542
388 Ga0501034_0008345
389 Ga0501034_0128084
390 Ga0501036_0003392
391 Ga0501036_0191212
392 Ga0501037_0095241
393 Ga0501037_0492482
394 Ga0501038_0033902
395 Ga0501038_0498065
396 Ga0501038_0538145
397 Ga0501039_0102394
398 Ga0501043_0178126
399 Ga0501043_0390808
400 Ga0501046_0008185
401 Ga0501046_0084392
402 Ga0501046_0183242
403 Ga0501047_0010315
404 Ga0501047_0037428
405 Ga0501047_0037683
406 Ga0501047_0093477
407 Ga0501047_0199001
408 Ga0501047_0265594
409 Ga0501047_0931307
410 Ga0501067_0027301
411 Ga0501067_0407460
412 Ga0501068_0032307
413 Ga0501069_0007161
414 Ga0501069_0069537
415 Ga0501070_0018697
416 Ga0501070_0023113
417 Ga0501070_0027976
418 Ga0501070_0133375
419 Ga0501073_0045384
420 Ga0501073_0311760
421 Ga0501074_0062472
422 Ga0501074_0276948
423 Ga0501074_0358426
424 Ga0501079_0004550
425 Ga0501080_0009629
426 Ga0501080_0126877
427 Ga0501080_0180241
428 Ga0501080_0293429
429 Ga0501080_0627873
430 Ga0501083_0048503
431 Ga0501083_0315182
432 Ga0501035_0028867
433 Ga0501035_0054492
434 Ga0501035_0093556
435 Ga0501035_0114583
436 Ga0501035_0186648
437 Ga0501035_0219940
438 Ga0501035_0276278
439 Ga0501044_0005208
440 Ga0501044_0016703
441 Ga0501044_0023502
442 Ga0501044_0231232
443 Ga0501044_0532399
444 Ga0500573_0000008
445 Ga0500619_023906
446 Ga0501084_0000017
447 Ga0501084_0043454
448 Ga0501082_0113783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

40

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i83-assembly1.cif.gz_F crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18 0.9529 8 147
8ayb-assembly1.cif.gz_A anammox-specific fabz from scalindua brodae 0.9478 9 147
8ayc-assembly1.cif.gz_A scalindua brodae amxfabz, i69g mutant 0.9472 9 147
3d6x-assembly1.cif.gz_F crystal structure of campylobacter jejuni fabz 0.9465 9 148
3d6x-assembly1.cif.gz_B crystal structure of campylobacter jejuni fabz 0.9447 9 150
ID Description Score Start End Superfamily
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.945 7 147 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9427 7 147 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9343 9 147 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9322 7 151 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9292 7 147 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A448MTU2-F1-model_v4 (3R)-hydroxymyristoyl-ACP dehydratase (EC 4.2.1.-) 0.9607 32 148 GO:0016829
AF-A0A2E4E2M0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9591 8 150 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2E7FXR6-F1-model_v4 deleted 0.9576 9 148
AF-A0A356GQQ0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9564 37 148 GO:0016829
AF-A0A661TZG4-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acyl-N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) (EC 3.5.1.108) (UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase)] 0.9562 10 150 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
GO:0046872
GO:0103117

Map