F337190

General Info

Members Datasets Scaffolds Average Seq Length
224 152 448 213

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0001178|Ga0501070_0001178_12426_13196
Length 256
Sequence MFTGIIEELGEIVDWQASSDAARLTVRAPLAVSDAAHGDSISVSGVCLTVVDRGEDWFTADVMAETIRMSTLTGPKPGDRVNIERAAKLGDRLGGHIVQGHIDGTAEVLAITEGSAWRVVRFSLASELAGLVARKGSIALDGVSLTVSAVGRDESATGIADWFEVSLIPETLAVTTLGLKSPGDLVNVETDILARHVERLVSIRGSADASPLLNRRGQTDPATSLGDVGSEVAGSVGIFGHDLRTDILETNERSKP

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
90 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
93 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
135 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
139 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
140 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
141 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
142 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
143 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
144 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
145 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
146 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
147 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
148 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
149 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
150 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
151 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
152 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.45
Isolates 6.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 10.27
Nodule 0
Rhizoplane 4.91
Rhizosphere 72.32
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0001178 3300049586 Bacteria 23346
2 Ga0070658_10000044 3300005327 Bacteria 131465
3 Ga0070658_10006173 3300005327 Bacteria 9716
4 Ga0070658_10060266 3300005327 Bacteria 3090
5 Ga0070658_10296744 3300005327 Bacteria 1378
6 Ga0070683_100553815 3300005329 Bacteria 1100
7 Ga0068868_100041249 3300005338 Bacteria 3595
8 Ga0070660_100022276 3300005339 Bacteria 4682
9 Ga0070675_100893812 3300005354 Bacteria 814
10 Ga0070671_100689792 3300005355 Bacteria 885
11 Ga0070659_100000308 3300005366 Bacteria 38002
12 Ga0070659_100304875 3300005366 Bacteria 1329
13 Ga0070667_100006716 3300005367 Bacteria 9560
14 Ga0070705_100144576 3300005440 Bacteria 1570
15 Ga0070708_100075493 3300005445 Bacteria 3043
16 Ga0070681_10055322 3300005458 Bacteria 3951
17 Ga0070685_10334898 3300005466 Bacteria 1030
18 Ga0070707_100077389 3300005468 Bacteria 3210
19 Ga0070679_100343996 3300005530 Bacteria 1439
20 Ga0068853_100247839 3300005539 Bacteria 1634
21 Ga0070695_100059279 3300005545 Bacteria 2477
22 Ga0070696_100688595 3300005546 Bacteria 832
23 Ga0070704_100125954 3300005549 Bacteria 1976
24 Ga0068855_100006470 3300005563 Bacteria 14247
25 Ga0068855_100033737 3300005563 Bacteria 6106
26 Ga0068857_100000016 3300005577 Bacteria 97647
27 Ga0068857_100323998 3300005577 Bacteria 1423
28 Ga0068854_100099931 3300005578 Bacteria 2174
29 Ga0068856_100134810 3300005614 Bacteria 2475
30 Ga0068852_100069434 3300005616 Bacteria 3088
31 Ga0068852_100073012 3300005616 Bacteria 3017
32 Ga0068852_101584645 3300005616 Bacteria 677
33 Ga0068864_100152551 3300005618 Bacteria 2094
34 Ga0068851_10000001 3300005834 Bacteria 495512
35 Ga0068863_100190493 3300005841 Bacteria 1971
36 Ga0068863_100231712 3300005841 Bacteria 1782
37 Ga0068858_100000016 3300005842 Bacteria 193130
38 Ga0068862_100467865 3300005844 Bacteria 1191
39 Ga0081539_10243382 3300005985 Bacteria 804
40 Ga0075363_100024882 3300006048 Bacteria 3047
41 Ga0075363_100155670 3300006048 Bacteria 1292
42 Ga0075364_10143794 3300006051 Bacteria 1605
43 Ga0105240_10017581 3300009093 Bacteria 9634
44 Ga0105240_10640152 3300009093 Bacteria 1167
45 Ga0105245_10023956 3300009098 Bacteria 5358
46 Ga0105245_10643092 3300009098 Bacteria 1090
47 Ga0105245_10969003 3300009098 Bacteria 894
48 Ga0105241_10002009 3300009174 Bacteria 15393
49 Ga0105241_10545410 3300009174 Bacteria 1040
50 Ga0105248_10002772 3300009177 Bacteria 19481
51 Ga0105248_10719231 3300009177 Bacteria 1127
52 Ga0105237_10001088 3300009545 Bacteria 36367
53 Ga0105237_10003430 3300009545 Bacteria 18830
54 Ga0105237_10116724 3300009545 Bacteria 2663
55 Ga0105237_10311411 3300009545 Bacteria 1578
56 Ga0105238_10030302 3300009551 Bacteria 5506
57 Ga0105238_10178380 3300009551 Bacteria 2101
58 Ga0105239_10421239 3300010375 Bacteria 1513
59 Ga0157370_10016514 3300013104 Bacteria 7470
60 Ga0157369_10005120 3300013105 Bacteria 15350
61 Ga0157369_10220907 3300013105 Bacteria 1983
62 Ga0157369_10248662 3300013105 Bacteria 1856
63 Ga0157374_10062773 3300013296 Bacteria 3484
64 Ga0157378_10462442 3300013297 Unclassified 1261
65 Ga0163163_10236159 3300014325 Bacteria 1877
66 Ga0157379_10081771 3300014968 Bacteria 2894
67 Ga0157376_10223248 3300014969 Bacteria 1746
68 Ga0206355_1552862 3300020076 Bacteria 3013
69 Ga0213876_10019773 3300021384 Bacteria 3556
70 Ga0207656_10000002 3300025321 Bacteria 792178
71 Ga0207653_10065636 3300025885 Bacteria 1232
72 Ga0207647_10423793 3300025904 Bacteria 748
73 Ga0207705_10000001 3300025909 Bacteria 2061880
74 Ga0207705_10084780 3300025909 Bacteria 2314
75 Ga0207705_10109523 3300025909 Bacteria 2039
76 Ga0207705_10178653 3300025909 Bacteria 1601
77 Ga0207705_10430389 3300025909 Bacteria 1022
78 Ga0207654_10000001 3300025911 Bacteria 1816198
79 Ga0207654_10387436 3300025911 Bacteria 969
80 Ga0207707_10072476 3300025912 Bacteria 3002
81 Ga0207695_10005723 3300025913 Bacteria 16379
82 Ga0207671_10000002 3300025914 Bacteria 1144816
83 Ga0207671_10065066 3300025914 Bacteria 2711
84 Ga0207671_10155564 3300025914 Bacteria 1768
85 Ga0207660_10393756 3300025917 Bacteria 1115
86 Ga0207660_10500156 3300025917 Bacteria 986
87 Ga0207657_10007047 3300025919 Bacteria 11552
88 Ga0207649_10267209 3300025920 Bacteria 1238
89 Ga0207652_10096513 3300025921 Bacteria 2604
90 Ga0207646_10074306 3300025922 Bacteria 3036
91 Ga0207646_10584528 3300025922 Bacteria 1003
92 Ga0207694_10000022 3300025924 Bacteria 288900
93 Ga0207694_10060928 3300025924 Bacteria 2937
94 Ga0207690_10007435 3300025932 Bacteria 6502
95 Ga0207704_10983482 3300025938 Bacteria 713
96 Ga0207711_10002845 3300025941 Bacteria 15187
97 Ga0207711_10775003 3300025941 Bacteria 894
98 Ga0207667_10000571 3300025949 Bacteria 48073
99 Ga0207667_10029971 3300025949 Bacteria 5893
100 Ga0207667_10112464 3300025949 Bacteria 2808
101 Ga0207667_10338166 3300025949 Bacteria 1536
102 Ga0207640_10092875 3300025981 Bacteria 2095
103 Ga0207658_10030457 3300025986 Bacteria 3820
104 Ga0207677_10363777 3300026023 Bacteria 1216
105 Ga0207703_10000075 3300026035 Bacteria 118422
106 Ga0207639_10056517 3300026041 Bacteria 3008
107 Ga0207639_10228011 3300026041 Bacteria 1613
108 Ga0207678_10065890 3300026067 Bacteria 3110
109 Ga0207702_10070460 3300026078 Bacteria 3007
110 Ga0207641_10021123 3300026088 Bacteria 5351
111 Ga0207674_10009115 3300026116 Bacteria 11389
112 Ga0207698_10004573 3300026142 Bacteria 8446
113 Ga0207698_10014785 3300026142 Bacteria 5202
114 Ga0207698_10278491 3300026142 Bacteria 1546
115 Ga0207698_10321079 3300026142 Bacteria 1450
116 Ga0307511_10272034 3300030521 Bacteria 792
117 Ga0307514_10029647 3300031649 Bacteria 4397
118 Ga0316576_10135774 3300031727 Bacteria 1851
119 Ga0316576_10158204 3300031727 Bacteria 1708
120 Ga0316577_10247730 3300031733 Bacteria 1008
121 Ga0307416_100317893 3300032002 Bacteria 1557
122 Ga0307416_101245577 3300032002 Bacteria 850
123 Ga0316574_0006496 3300035398 Bacteria 6323
124 Ga0316574_0040546 3300035398 Bacteria 2868
125 Ga0316574_0159902 3300035398 Bacteria 1451
126 Ga0316582_0583982 3300036647 Bacteria 769
127 Ga0316584_0000598 3300036712 Bacteria 19526
128 Ga0316584_0078786 3300036712 Unclassified 2468
129 Ga0395900_0700739 3300037418 Bacteria 946
130 Ga0395898_0604949 3300037466 Bacteria 1039
131 Ga0395898_0779811 3300037466 Bacteria 897
132 Ga0395901_0170297 3300038443 Bacteria 2285
133 Ga0436365_1534867 3300039437 Bacteria 1017
134 Ga0439447_036498 3300041407 Bacteria 1214
135 Ga0451789_0953625 3300041443 Bacteria 1646
136 Ga0451793_0203052 3300041452 Bacteria 2733
137 Ga0451793_0825779 3300041452 Bacteria 5789
138 Ga0439452_006263 3300042010 Bacteria 3738
139 Ga0439457_043289 3300042014 Bacteria 1005
140 Ga0466965_0000008 3300044683 Bacteria 131465
141 Ga0466965_0049662 3300044683 Bacteria 2080
142 Ga0466965_0068551 3300044683 Bacteria 1781
143 Ga0466963_0032230 3300044694 Bacteria 3392
144 Ga0466970_0010932 3300044765 Bacteria 4616
145 Ga0466957_0000039 3300044842 Bacteria 47226
146 Ga0466960_0133925 3300044901 Bacteria 1311
147 Ga0495650_0001841 3300046471 Bacteria 18974
148 Ga0495686_0072029 3300047472 Bacteria 2126
149 Ga0496102_0244566 3300048905 Bacteria 1692
150 Ga0496102_0510812 3300048905 Bacteria 1124
151 Ga0496104_0242110 3300048907 Bacteria 1716
152 Ga0496105_0053893 3300048908 Bacteria 3322
153 Ga0496108_0217949 3300048911 Bacteria 1658
154 Ga0496109_0311602 3300048912 Bacteria 1485
155 Ga0496110_0059627 3300048913 Bacteria 3365
156 Ga0496115_0014714 3300048918 Bacteria 5927
157 Ga0496117_0003752 3300048920 Bacteria 17397
158 Ga0496117_0006740 3300048920 Bacteria 11469
159 Ga0496118_0000243 3300048921 Bacteria 96384
160 Ga0496118_0050694 3300048921 Bacteria 3182
161 Ga0496119_0005358 3300048922 Bacteria 12328
162 Ga0496119_0012349 3300048922 Bacteria 6946
163 Ga0496119_0289115 3300048922 Bacteria 812
164 Ga0496120_0000899 3300048923 Bacteria 41719
165 Ga0496120_0017535 3300048923 Bacteria 4639
166 Ga0496120_0040659 3300048923 Bacteria 2730
167 Ga0496120_0054210 3300048923 Bacteria 2274
168 Ga0496121_0238772 3300048924 Bacteria 1268
169 Ga0496122_0002238 3300048925 Bacteria 28126
170 Ga0496122_0047629 3300048925 Bacteria 3307
171 Ga0496123_0028532 3300048926 Bacteria 4129
172 Ga0496123_0159381 3300048926 Bacteria 1205
173 Ga0496124_0000040 3300048927 Bacteria 307061
174 Ga0496124_0067514 3300048927 Bacteria 2975
175 Ga0496124_0082059 3300048927 Bacteria 2647
176 Ga0496124_0252464 3300048927 Bacteria 1303
177 Ga0496126_0000565 3300048929 Bacteria 70942
178 Ga0501033_0045317 3300049570 Bacteria 3273
179 Ga0501034_0022357 3300049571 Bacteria 6445
180 Ga0501034_0030519 3300049571 Bacteria 5479
181 Ga0501034_0053524 3300049571 Bacteria 4063
182 Ga0501034_0308423 3300049571 Bacteria 1518
183 Ga0501038_0216661 3300049574 Bacteria 1529
184 Ga0501038_0277485 3300049574 Bacteria 1320
185 Ga0501043_0111506 3300049579 Bacteria 2148
186 Ga0501043_0425309 3300049579 Bacteria 1001
187 Ga0501071_0000949 3300049587 Bacteria 15771
188 Ga0501072_0216492 3300049588 Bacteria 1526
189 Ga0501044_0018844 3300049823 Bacteria 7390
190 nmdc:mga03n38_63311_c1 3300050490 Bacteria 1690
191 nmdc:mga00v17_106262_c1 3300050491 Bacteria 1777
192 nmdc:mga00v17_182175_c1 3300050491 Bacteria 1355
193 nmdc:mga0yw44_22100_c1 3300050492 Bacteria 3560
194 nmdc:mga06z11_106904_c1 3300050494 Bacteria 1543
195 nmdc:mga06z11_563015_c1 3300050494 Bacteria 692
196 Ga0500635_0000004 3300053080 Bacteria 210675
197 Ga0500635_0044740 3300053080 Bacteria 1495
198 Ga0500635_0097271 3300053080 Bacteria 1078
199 Ga0500651_0001679 3300053093 Bacteria 11307
200 Ga0500650_0074129 3300053098 Bacteria 1591
201 Ga0500556_0000001 3300053104 Bacteria 1135060
202 Ga0500559_0015625 3300053136 Bacteria 3205
203 Ga0500568_0000003 3300053139 Bacteria 863587
204 Ga0500568_0011502 3300053139 Bacteria 4101
205 Ga0500577_0005114 3300053142 Bacteria 3511
206 Ga0500590_003298 3300053148 Bacteria 7408
207 Ga0500616_0000040 3300053153 Bacteria 367604
208 Ga0500616_0000109 3300053153 Bacteria 152604
209 Ga0500645_047641 3300053730 Bacteria 1256
210 2753302804 2751185788 Bacteria 4541048
211 2852646361 2852643534 Bacteria 3013378
212 2862994662 2862993130 Bacteria 3860849
213 2904431570 2904430863 Bacteria 3486923
214 2904504089 2904501621 Bacteria 3401437
215 2908677053 2908674828 Bacteria 3382763
216 2909076768 2909074476 Bacteria 3436050
217 2919039380 2919039151 Bacteria 3391018
218 2919042766 2919042368 Bacteria 3905917
219 2928105076 2928104781 Bacteria 3877447
220 2928502196 2928500415 Bacteria 3384541
221 2964327431 2964326757 Bacteria 3290868
222 2966925489 2966924647 Bacteria 3268643
223 2984554953 2984551494 Bacteria 3877562
224 8057345869 8057345674 Bacteria 4160394
225 Ga0501070_0001178
226 Ga0070658_10000044
227 Ga0070658_10006173
228 Ga0070658_10060266
229 Ga0070658_10296744
230 Ga0070683_100553815
231 Ga0068868_100041249
232 Ga0070660_100022276
233 Ga0070675_100893812
234 Ga0070671_100689792
235 Ga0070659_100000308
236 Ga0070659_100304875
237 Ga0070667_100006716
238 Ga0070705_100144576
239 Ga0070708_100075493
240 Ga0070681_10055322
241 Ga0070685_10334898
242 Ga0070707_100077389
243 Ga0070679_100343996
244 Ga0068853_100247839
245 Ga0070695_100059279
246 Ga0070696_100688595
247 Ga0070704_100125954
248 Ga0068855_100006470
249 Ga0068855_100033737
250 Ga0068857_100000016
251 Ga0068857_100323998
252 Ga0068854_100099931
253 Ga0068856_100134810
254 Ga0068852_100069434
255 Ga0068852_100073012
256 Ga0068852_101584645
257 Ga0068864_100152551
258 Ga0068851_10000001
259 Ga0068863_100190493
260 Ga0068863_100231712
261 Ga0068858_100000016
262 Ga0068862_100467865
263 Ga0081539_10243382
264 Ga0075363_100024882
265 Ga0075363_100155670
266 Ga0075364_10143794
267 Ga0105240_10017581
268 Ga0105240_10640152
269 Ga0105245_10023956
270 Ga0105245_10643092
271 Ga0105245_10969003
272 Ga0105241_10002009
273 Ga0105241_10545410
274 Ga0105248_10002772
275 Ga0105248_10719231
276 Ga0105237_10001088
277 Ga0105237_10003430
278 Ga0105237_10116724
279 Ga0105237_10311411
280 Ga0105238_10030302
281 Ga0105238_10178380
282 Ga0105239_10421239
283 Ga0157370_10016514
284 Ga0157369_10005120
285 Ga0157369_10220907
286 Ga0157369_10248662
287 Ga0157374_10062773
288 Ga0157378_10462442
289 Ga0163163_10236159
290 Ga0157379_10081771
291 Ga0157376_10223248
292 Ga0206355_1552862
293 Ga0213876_10019773
294 Ga0207656_10000002
295 Ga0207653_10065636
296 Ga0207647_10423793
297 Ga0207705_10000001
298 Ga0207705_10084780
299 Ga0207705_10109523
300 Ga0207705_10178653
301 Ga0207705_10430389
302 Ga0207654_10000001
303 Ga0207654_10387436
304 Ga0207707_10072476
305 Ga0207695_10005723
306 Ga0207671_10000002
307 Ga0207671_10065066
308 Ga0207671_10155564
309 Ga0207660_10393756
310 Ga0207660_10500156
311 Ga0207657_10007047
312 Ga0207649_10267209
313 Ga0207652_10096513
314 Ga0207646_10074306
315 Ga0207646_10584528
316 Ga0207694_10000022
317 Ga0207694_10060928
318 Ga0207690_10007435
319 Ga0207704_10983482
320 Ga0207711_10002845
321 Ga0207711_10775003
322 Ga0207667_10000571
323 Ga0207667_10029971
324 Ga0207667_10112464
325 Ga0207667_10338166
326 Ga0207640_10092875
327 Ga0207658_10030457
328 Ga0207677_10363777
329 Ga0207703_10000075
330 Ga0207639_10056517
331 Ga0207639_10228011
332 Ga0207678_10065890
333 Ga0207702_10070460
334 Ga0207641_10021123
335 Ga0207674_10009115
336 Ga0207698_10004573
337 Ga0207698_10014785
338 Ga0207698_10278491
339 Ga0207698_10321079
340 Ga0307511_10272034
341 Ga0307514_10029647
342 Ga0316576_10135774
343 Ga0316576_10158204
344 Ga0316577_10247730
345 Ga0307416_100317893
346 Ga0307416_101245577
347 Ga0316574_0006496
348 Ga0316574_0040546
349 Ga0316574_0159902
350 Ga0316582_0583982
351 Ga0316584_0000598
352 Ga0316584_0078786
353 Ga0395900_0700739
354 Ga0395898_0604949
355 Ga0395898_0779811
356 Ga0395901_0170297
357 Ga0436365_1534867
358 Ga0439447_036498
359 Ga0451789_0953625
360 Ga0451793_0203052
361 Ga0451793_0825779
362 Ga0439452_006263
363 Ga0439457_043289
364 Ga0466965_0000008
365 Ga0466965_0049662
366 Ga0466965_0068551
367 Ga0466963_0032230
368 Ga0466970_0010932
369 Ga0466957_0000039
370 Ga0466960_0133925
371 Ga0495650_0001841
372 Ga0495686_0072029
373 Ga0496102_0244566
374 Ga0496102_0510812
375 Ga0496104_0242110
376 Ga0496105_0053893
377 Ga0496108_0217949
378 Ga0496109_0311602
379 Ga0496110_0059627
380 Ga0496115_0014714
381 Ga0496117_0003752
382 Ga0496117_0006740
383 Ga0496118_0000243
384 Ga0496118_0050694
385 Ga0496119_0005358
386 Ga0496119_0012349
387 Ga0496119_0289115
388 Ga0496120_0000899
389 Ga0496120_0017535
390 Ga0496120_0040659
391 Ga0496120_0054210
392 Ga0496121_0238772
393 Ga0496122_0002238
394 Ga0496122_0047629
395 Ga0496123_0028532
396 Ga0496123_0159381
397 Ga0496124_0000040
398 Ga0496124_0067514
399 Ga0496124_0082059
400 Ga0496124_0252464
401 Ga0496126_0000565
402 Ga0501033_0045317
403 Ga0501034_0022357
404 Ga0501034_0030519
405 Ga0501034_0053524
406 Ga0501034_0308423
407 Ga0501038_0216661
408 Ga0501038_0277485
409 Ga0501043_0111506
410 Ga0501043_0425309
411 Ga0501071_0000949
412 Ga0501072_0216492
413 Ga0501044_0018844
414 nmdc:mga03n38_63311_c1
415 nmdc:mga00v17_106262_c1
416 nmdc:mga00v17_182175_c1
417 nmdc:mga0yw44_22100_c1
418 nmdc:mga06z11_106904_c1
419 nmdc:mga06z11_563015_c1
420 Ga0500635_0000004
421 Ga0500635_0044740
422 Ga0500635_0097271
423 Ga0500651_0001679
424 Ga0500650_0074129
425 Ga0500556_0000001
426 Ga0500559_0015625
427 Ga0500568_0000003
428 Ga0500568_0011502
429 Ga0500577_0005114
430 Ga0500590_003298
431 Ga0500616_0000040
432 Ga0500616_0000109
433 Ga0500645_047641
434 2753302804
435 2852646361
436 2862994662
437 2904431570
438 2904504089
439 2908677053
440 2909076768
441 2919039380
442 2919042766
443 2928105076
444 2928502196
445 2964327431
446 2966925489
447 2984554953
448 8057345869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

3

86

0.95

PF00677

Lum_binding

Lumazine binding domain

99

191

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9672 1 199
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9646 1 200
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9574 1 199
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.955 1 200
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9525 1 86
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9811 1 88 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9746 1 87 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9703 1 88 2.40.30.20
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9689 101 200 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9616 1 88 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A517YJA9-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9856 2 200 GO:0004746
GO:0009231
AF-A0A852SU08-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9839 1 200 GO:0004746
GO:0009231
AF-A0A5C6AW56-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9836 1 199 GO:0004746
GO:0009231
AF-F9EGA6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9831 1 200 GO:0004746
GO:0009231
AF-A0A1L7CY51-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.983 1 198 GO:0004746
GO:0009231

Map