F337200

General Info

Members Datasets Scaffolds Average Seq Length
224 161 448 292

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0378955|Ga0501044_0378955_113_1093
Length 326
Sequence MDAVAPLCVSCDPAIPLATRRAAGQDHSQTGVPMAYNTLSSQIDGGIATLTLNRPDKMNAFTVEMANELVDYFTRAGSDDAIRAIVVTGAGKAFCAGMDLSIGGNVFGLDEKQRPTLDDMTRRLDDPAILKGVRDTGGRVALSIFNCTKPVIAAISGAAVGIGATMTLPMDFRLASEKARIGFVFGKIGIVPEACSSWFLPRIVGISQALEWTYSAEILDAETALRGGLLKAVVPPDQLLNEAHALARRITEHRSPVAVALTRQMMYRNAAQPHPLEAHRIDSLAMFYASLGDGKEGVQSFLDKRAPQFKSEVPKDLPPFYKDWAK

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
130 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
131 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
132 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
133 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
137 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
138 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
142 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
143 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
146 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
147 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
148 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
149 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
150 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
151 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
157 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
158 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
159 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
160 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
161 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 9.82
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0378955 3300049823 Bacteria 1330
2 rootH2_10218721 3300003320 Bacteria 1609
3 Ga0065707_10082203 3300005295 Bacteria 19236
4 Ga0070676_10001154 3300005328 Bacteria 13192
5 Ga0070666_10011531 3300005335 Bacteria 5550
6 Ga0070666_10016929 3300005335 Bacteria 4667
7 Ga0070668_100000138 3300005347 Bacteria 45978
8 Ga0070668_100043871 3300005347 Bacteria 3429
9 Ga0070669_100125689 3300005353 Bacteria 1962
10 Ga0070671_100006561 3300005355 Bacteria 9302
11 Ga0070671_100008684 3300005355 Bacteria 8152
12 Ga0070674_100059171 3300005356 Bacteria 2666
13 Ga0070667_100000146 3300005367 Bacteria 88847
14 Ga0070667_100017872 3300005367 Bacteria 5878
15 Ga0070709_10039792 3300005434 Bacteria 2887
16 Ga0070710_10005557 3300005437 Bacteria 6001
17 Ga0070700_100032063 3300005441 Bacteria 3155
18 Ga0070678_100080210 3300005456 Bacteria 2471
19 Ga0068867_100003668 3300005459 Bacteria 10804
20 Ga0070707_100086481 3300005468 Bacteria 3032
21 Ga0070698_100008777 3300005471 Bacteria 10878
22 Ga0070672_100057277 3300005543 Bacteria 3058
23 Ga0070665_100000915 3300005548 Bacteria 37838
24 Ga0070665_100018686 3300005548 Bacteria 6949
25 Ga0068855_100066700 3300005563 Bacteria 4196
26 Ga0068856_100015343 3300005614 Bacteria 7404
27 Ga0068859_100000635 3300005617 Bacteria 35152
28 Ga0068859_100076114 3300005617 Bacteria 3397
29 Ga0068859_100079352 3300005617 Bacteria 3322
30 Ga0068864_100000137 3300005618 Bacteria 70702
31 Ga0068863_100000165 3300005841 Bacteria 71079
32 Ga0068863_100164404 3300005841 Bacteria 2127
33 Ga0068858_100003996 3300005842 Bacteria 14552
34 Ga0068858_100047773 3300005842 Bacteria 3967
35 Ga0068858_100060202 3300005842 Bacteria 3510
36 Ga0068860_100006101 3300005843 Bacteria 12127
37 Ga0068860_100012167 3300005843 Bacteria 8476
38 Ga0068860_100347325 3300005843 Bacteria 1459
39 Ga0068862_100000129 3300005844 Bacteria 88141
40 Ga0068862_100297069 3300005844 Bacteria 1485
41 Ga0070715_10002552 3300006163 Bacteria 5610
42 Ga0070712_100003633 3300006175 Bacteria 9513
43 Ga0068865_100013227 3300006881 Bacteria 5210
44 Ga0097620_100000635 3300006931 Bacteria 35152
45 Ga0097620_100076118 3300006931 Bacteria 3397
46 Ga0097620_100079354 3300006931 Bacteria 3322
47 Ga0105250_10007061 3300009092 Bacteria 4850
48 Ga0111539_10482404 3300009094 Bacteria 1444
49 Ga0105247_10000254 3300009101 Bacteria 49729
50 Ga0105247_10122582 3300009101 Bacteria 1686
51 Ga0105243_10226847 3300009148 Bacteria 1655
52 Ga0105242_10037506 3300009176 Bacteria 3893
53 Ga0105248_10001490 3300009177 Bacteria 26065
54 Ga0105248_10008877 3300009177 Bacteria 11047
55 Ga0105248_10015301 3300009177 Bacteria 8458
56 Ga0105248_10076066 3300009177 Bacteria 3773
57 Ga0105249_10000337 3300009553 Bacteria 47466
58 Ga0105239_10028559 3300010375 Bacteria 6133
59 Ga0157374_10341286 3300013296 Bacteria 1487
60 Ga0163162_10319397 3300013306 Bacteria 1685
61 Ga0163162_10356035 3300013306 Unclassified 1596
62 Ga0157375_10294333 3300013308 Bacteria 1786
63 Ga0163163_10008511 3300014325 Bacteria 9117
64 Ga0163163_10286464 3300014325 Bacteria 1699
65 Ga0157380_10000025 3300014326 Bacteria 107388
66 Ga0157380_10005302 3300014326 Bacteria 9009
67 Ga0157380_10059060 3300014326 Bacteria 3059
68 Ga0157380_10147261 3300014326 Bacteria 2031
69 Ga0182008_10028778 3300014497 Bacteria 2810
70 Ga0157379_10004358 3300014968 Bacteria 12106
71 Ga0157379_10008470 3300014968 Bacteria 8946
72 Ga0157379_10039795 3300014968 Bacteria 4195
73 Ga0213876_10000221 3300021384 Bacteria 56997
74 Ga0207710_10062983 3300025900 Bacteria 1686
75 Ga0207699_10088382 3300025906 Bacteria 1939
76 Ga0207645_10003134 3300025907 Bacteria 12682
77 Ga0207693_10000279 3300025915 Bacteria 47471
78 Ga0207663_10036614 3300025916 Bacteria 2953
79 Ga0207646_10079177 3300025922 Bacteria 2938
80 Ga0207681_10035557 3300025923 Bacteria 3283
81 Ga0207681_10080518 3300025923 Bacteria 2297
82 Ga0207650_10000064 3300025925 Bacteria 142969
83 Ga0207700_10037017 3300025928 Bacteria 3530
84 Ga0207664_10412328 3300025929 Bacteria 1202
85 Ga0207644_10022505 3300025931 Bacteria 4306
86 Ga0207706_10231310 3300025933 Bacteria 1617
87 Ga0207686_10183501 3300025934 Unclassified 1485
88 Ga0207665_10001877 3300025939 Bacteria 14160
89 Ga0207691_10218005 3300025940 Bacteria 1655
90 Ga0207711_10001078 3300025941 Bacteria 26059
91 Ga0207711_10016284 3300025941 Bacteria 6175
92 Ga0207711_10061195 3300025941 Bacteria 3246
93 Ga0207711_10130618 3300025941 Bacteria 2252
94 Ga0207712_10001014 3300025961 Bacteria 19999
95 Ga0207712_10007509 3300025961 Bacteria 6883
96 Ga0207668_10000595 3300025972 Bacteria 22503
97 Ga0207668_10011851 3300025972 Bacteria 5315
98 Ga0207668_10166364 3300025972 Bacteria 1724
99 Ga0207658_10003467 3300025986 Bacteria 11150
100 Ga0207658_10040582 3300025986 Bacteria 3365
101 Ga0207658_10117661 3300025986 Bacteria 2112
102 Ga0207703_10004051 3300026035 Bacteria 12102
103 Ga0207703_10026296 3300026035 Bacteria 4579
104 Ga0207703_10046614 3300026035 Bacteria 3491
105 Ga0207703_10060761 3300026035 Bacteria 3091
106 Ga0207639_10358271 3300026041 Unclassified 1305
107 Ga0207708_10041725 3300026075 Bacteria 3497
108 Ga0207702_10244761 3300026078 Unclassified 1682
109 Ga0207641_10003122 3300026088 Bacteria 14896
110 Ga0207641_10016800 3300026088 Bacteria 5992
111 Ga0207648_10000682 3300026089 Bacteria 37982
112 Ga0207648_10032265 3300026089 Bacteria 4625
113 Ga0207676_10000302 3300026095 Bacteria 42408
114 Ga0207675_100004106 3300026118 Bacteria 14092
115 Ga0207675_100043710 3300026118 Bacteria 4185
116 Ga0207683_10001002 3300026121 Bacteria 25841
117 Ga0268266_10003199 3300028379 Bacteria 16571
118 Ga0268266_10349227 3300028379 Bacteria 1390
119 Ga0268266_10407591 3300028379 Unclassified 1286
120 Ga0268265_10000677 3300028380 Bacteria 33608
121 Ga0268264_10000118 3300028381 Bacteria 193487
122 Ga0268264_10004107 3300028381 Bacteria 12455
123 Ga0265334_10000087 3300028573 Bacteria 66703
124 Ga0307511_10005353 3300030521 Bacteria 13058
125 Ga0265332_10000014 3300031238 Bacteria 249035
126 Ga0265328_10009528 3300031239 Bacteria 3951
127 Ga0265328_10011444 3300031239 Bacteria 3543
128 Ga0265331_10041147 3300031250 Bacteria 2246
129 Ga0265327_10000027 3300031251 Bacteria 364541
130 Ga0265327_10000174 3300031251 Bacteria 138922
131 Ga0265316_10000349 3300031344 Bacteria 51876
132 Ga0307509_10000048 3300031507 Bacteria 167101
133 Ga0307509_10001585 3300031507 Bacteria 38258
134 Ga0373936_0008851 3300035113 Unclassified 3794
135 Ga0373956_0051944 3300035119 Bacteria 1843
136 Ga0373927_0054526 3300035695 Bacteria 2586
137 Ga0373947_0058044 3300035725 Bacteria 2344
138 Ga0373937_0010405 3300036401 Bacteria 8124
139 Ga0373925_0217862 3300037068 Bacteria 1523
140 Ga0395905_0001436 3300037471 Bacteria 28673
141 Ga0436364_1188536 3300037853 Bacteria 1718
142 Ga0395901_0158739 3300038443 Bacteria 2375
143 Ga0436365_1543423 3300039437 Bacteria 31863
144 Ga0451797_0278012 3300041453 Bacteria 1011
145 Ga0451576_0254819 3300045051 Bacteria 1834
146 Ga0495638_0006693 3300046460 Bacteria 8351
147 Ga0495638_0171147 3300046460 Bacteria 1246
148 Ga0495580_0014699 3300046472 Bacteria 5932
149 Ga0495606_0000845 3300046507 Bacteria 46095
150 Ga0495643_0086035 3300046522 Bacteria 1629
151 Ga0495586_0198369 3300046535 Bacteria 1137
152 Ga0495625_0002371 3300046660 Bacteria 20511
153 Ga0495671_0001388 3300046692 Bacteria 16355
154 Ga0495649_0001682 3300046694 Bacteria 16405
155 Ga0495649_0018918 3300046694 Bacteria 3869
156 Ga0495672_0035808 3300047320 Bacteria 3054
157 Ga0495681_0007615 3300047470 Bacteria 6889
158 Ga0496100_0157881 3300048903 Unclassified 1623
159 Ga0496101_0028503 3300048904 Bacteria 3898
160 Ga0496102_0001969 3300048905 Bacteria 17723
161 Ga0496102_0071019 3300048905 Bacteria 3197
162 Ga0496102_0158654 3300048905 Bacteria 2127
163 Ga0496103_0012850 3300048906 Bacteria 4967
164 Ga0496103_0050831 3300048906 Bacteria 2565
165 Ga0496105_0070153 3300048908 Bacteria 2896
166 Ga0496107_0050783 3300048910 Bacteria 2990
167 Ga0496108_0068833 3300048911 Unclassified 2986
168 Ga0496109_0007737 3300048912 Bacteria 9099
169 Ga0496109_0017825 3300048912 Bacteria 6229
170 Ga0496109_0066288 3300048912 Bacteria 3306
171 Ga0496110_0052785 3300048913 Bacteria 3572
172 Ga0496110_0058918 3300048913 Bacteria 3383
173 Ga0496110_0071960 3300048913 Bacteria 3067
174 Ga0496111_0334817 3300048914 Bacteria 1120
175 Ga0496112_0154245 3300048915 Bacteria 2264
176 Ga0496112_0300734 3300048915 Bacteria 1550
177 Ga0496114_0008309 3300048917 Bacteria 8224
178 Ga0496115_0093514 3300048918 Bacteria 2458
179 Ga0496118_0071667 3300048921 Bacteria 2493
180 Ga0496119_0001037 3300048922 Bacteria 35545
181 Ga0496119_0016724 3300048922 Bacteria 5561
182 Ga0496120_0000843 3300048923 Bacteria 43594
183 Ga0496121_0000058 3300048924 Bacteria 281335
184 Ga0496121_0001029 3300048924 Bacteria 49692
185 Ga0496121_0251601 3300048924 Bacteria 1225
186 Ga0496124_0009135 3300048927 Bacteria 10240
187 Ga0496125_0023296 3300048928 Bacteria 5718
188 Ga0496126_0000952 3300048929 Bacteria 49599
189 Ga0495682_0057299 3300049460 Bacteria 1411
190 Ga0501290_000123 3300049513 Bacteria 11816
191 Ga0501292_000006 3300049515 Bacteria 90286
192 Ga0501298_016407 3300049521 Bacteria 1342
193 Ga0501300_000185 3300049523 Bacteria 9444
194 Ga0501040_0108503 3300049576 Bacteria 1941
195 Ga0501047_0115523 3300049581 Bacteria 2566
196 Ga0501047_0239370 3300049581 Bacteria 1666
197 Ga0501223_000023 3300049663 Bacteria 64396
198 Ga0501223_002415 3300049663 Bacteria 4157
199 Ga0501224_000001 3300049664 Bacteria 308131
200 Ga0501233_000014 3300049668 Bacteria 27843
201 Ga0501233_002690 3300049668 Bacteria 3150
202 Ga0501235_000582 3300049669 Bacteria 7355
203 Ga0501249_021640 3300049679 Bacteria 1404
204 Ga0501259_000251 3300049688 Bacteria 8442
205 Ga0501261_000001 3300049690 Bacteria 126537
206 Ga0501221_001335 3300049704 Bacteria 4054
207 Ga0501225_0000012 3300049705 Bacteria 73262
208 Ga0501245_002985 3300049708 Bacteria 2282
209 Ga0501264_001644 3300049761 Bacteria 2313
210 Ga0501279_000006 3300049775 Bacteria 152264
211 Ga0501280_000087 3300049776 Bacteria 24626
212 Ga0501282_000076 3300049778 Bacteria 11743
213 Ga0501283_000533 3300049779 Bacteria 4997
214 Ga0501226_000050 3300049853 Bacteria 51521
215 nmdc:mga0qj67_45620_c1 3300050509 Bacteria 3458
216 nmdc:mga06r32_157259_c1 3300050510 Bacteria 2254
217 Ga0500564_013021 3300053138 Bacteria 3714
218 Ga0500568_0078740 3300053139 Bacteria 1253
219 Ga0500639_099817 3300053163 Unclassified 1431
220 Ga0500637_0027975 3300053178 Unclassified 3115
221 2739286133 2738543020 Bacteria 5718238
222 2739291446 2738543021 Bacteria 5718241
223 2895885751 2895880812 Bacteria 11255272
224 2990198760 2990196909 Bacteria 4054280
225 Ga0501044_0378955
226 rootH2_10218721
227 Ga0065707_10082203
228 Ga0070676_10001154
229 Ga0070666_10011531
230 Ga0070666_10016929
231 Ga0070668_100000138
232 Ga0070668_100043871
233 Ga0070669_100125689
234 Ga0070671_100006561
235 Ga0070671_100008684
236 Ga0070674_100059171
237 Ga0070667_100000146
238 Ga0070667_100017872
239 Ga0070709_10039792
240 Ga0070710_10005557
241 Ga0070700_100032063
242 Ga0070678_100080210
243 Ga0068867_100003668
244 Ga0070707_100086481
245 Ga0070698_100008777
246 Ga0070672_100057277
247 Ga0070665_100000915
248 Ga0070665_100018686
249 Ga0068855_100066700
250 Ga0068856_100015343
251 Ga0068859_100000635
252 Ga0068859_100076114
253 Ga0068859_100079352
254 Ga0068864_100000137
255 Ga0068863_100000165
256 Ga0068863_100164404
257 Ga0068858_100003996
258 Ga0068858_100047773
259 Ga0068858_100060202
260 Ga0068860_100006101
261 Ga0068860_100012167
262 Ga0068860_100347325
263 Ga0068862_100000129
264 Ga0068862_100297069
265 Ga0070715_10002552
266 Ga0070712_100003633
267 Ga0068865_100013227
268 Ga0097620_100000635
269 Ga0097620_100076118
270 Ga0097620_100079354
271 Ga0105250_10007061
272 Ga0111539_10482404
273 Ga0105247_10000254
274 Ga0105247_10122582
275 Ga0105243_10226847
276 Ga0105242_10037506
277 Ga0105248_10001490
278 Ga0105248_10008877
279 Ga0105248_10015301
280 Ga0105248_10076066
281 Ga0105249_10000337
282 Ga0105239_10028559
283 Ga0157374_10341286
284 Ga0163162_10319397
285 Ga0163162_10356035
286 Ga0157375_10294333
287 Ga0163163_10008511
288 Ga0163163_10286464
289 Ga0157380_10000025
290 Ga0157380_10005302
291 Ga0157380_10059060
292 Ga0157380_10147261
293 Ga0182008_10028778
294 Ga0157379_10004358
295 Ga0157379_10008470
296 Ga0157379_10039795
297 Ga0213876_10000221
298 Ga0207710_10062983
299 Ga0207699_10088382
300 Ga0207645_10003134
301 Ga0207693_10000279
302 Ga0207663_10036614
303 Ga0207646_10079177
304 Ga0207681_10035557
305 Ga0207681_10080518
306 Ga0207650_10000064
307 Ga0207700_10037017
308 Ga0207664_10412328
309 Ga0207644_10022505
310 Ga0207706_10231310
311 Ga0207686_10183501
312 Ga0207665_10001877
313 Ga0207691_10218005
314 Ga0207711_10001078
315 Ga0207711_10016284
316 Ga0207711_10061195
317 Ga0207711_10130618
318 Ga0207712_10001014
319 Ga0207712_10007509
320 Ga0207668_10000595
321 Ga0207668_10011851
322 Ga0207668_10166364
323 Ga0207658_10003467
324 Ga0207658_10040582
325 Ga0207658_10117661
326 Ga0207703_10004051
327 Ga0207703_10026296
328 Ga0207703_10046614
329 Ga0207703_10060761
330 Ga0207639_10358271
331 Ga0207708_10041725
332 Ga0207702_10244761
333 Ga0207641_10003122
334 Ga0207641_10016800
335 Ga0207648_10000682
336 Ga0207648_10032265
337 Ga0207676_10000302
338 Ga0207675_100004106
339 Ga0207675_100043710
340 Ga0207683_10001002
341 Ga0268266_10003199
342 Ga0268266_10349227
343 Ga0268266_10407591
344 Ga0268265_10000677
345 Ga0268264_10000118
346 Ga0268264_10004107
347 Ga0265334_10000087
348 Ga0307511_10005353
349 Ga0265332_10000014
350 Ga0265328_10009528
351 Ga0265328_10011444
352 Ga0265331_10041147
353 Ga0265327_10000027
354 Ga0265327_10000174
355 Ga0265316_10000349
356 Ga0307509_10000048
357 Ga0307509_10001585
358 Ga0373936_0008851
359 Ga0373956_0051944
360 Ga0373927_0054526
361 Ga0373947_0058044
362 Ga0373937_0010405
363 Ga0373925_0217862
364 Ga0395905_0001436
365 Ga0436364_1188536
366 Ga0395901_0158739
367 Ga0436365_1543423
368 Ga0451797_0278012
369 Ga0451576_0254819
370 Ga0495638_0006693
371 Ga0495638_0171147
372 Ga0495580_0014699
373 Ga0495606_0000845
374 Ga0495643_0086035
375 Ga0495586_0198369
376 Ga0495625_0002371
377 Ga0495671_0001388
378 Ga0495649_0001682
379 Ga0495649_0018918
380 Ga0495672_0035808
381 Ga0495681_0007615
382 Ga0496100_0157881
383 Ga0496101_0028503
384 Ga0496102_0001969
385 Ga0496102_0071019
386 Ga0496102_0158654
387 Ga0496103_0012850
388 Ga0496103_0050831
389 Ga0496105_0070153
390 Ga0496107_0050783
391 Ga0496108_0068833
392 Ga0496109_0007737
393 Ga0496109_0017825
394 Ga0496109_0066288
395 Ga0496110_0052785
396 Ga0496110_0058918
397 Ga0496110_0071960
398 Ga0496111_0334817
399 Ga0496112_0154245
400 Ga0496112_0300734
401 Ga0496114_0008309
402 Ga0496115_0093514
403 Ga0496118_0071667
404 Ga0496119_0001037
405 Ga0496119_0016724
406 Ga0496120_0000843
407 Ga0496121_0000058
408 Ga0496121_0001029
409 Ga0496121_0251601
410 Ga0496124_0009135
411 Ga0496125_0023296
412 Ga0496126_0000952
413 Ga0495682_0057299
414 Ga0501290_000123
415 Ga0501292_000006
416 Ga0501298_016407
417 Ga0501300_000185
418 Ga0501040_0108503
419 Ga0501047_0115523
420 Ga0501047_0239370
421 Ga0501223_000023
422 Ga0501223_002415
423 Ga0501224_000001
424 Ga0501233_000014
425 Ga0501233_002690
426 Ga0501235_000582
427 Ga0501249_021640
428 Ga0501259_000251
429 Ga0501261_000001
430 Ga0501221_001335
431 Ga0501225_0000012
432 Ga0501245_002985
433 Ga0501264_001644
434 Ga0501279_000006
435 Ga0501280_000087
436 Ga0501282_000076
437 Ga0501283_000533
438 Ga0501226_000050
439 nmdc:mga0qj67_45620_c1
440 nmdc:mga06r32_157259_c1
441 Ga0500564_013021
442 Ga0500568_0078740
443 Ga0500639_099817
444 Ga0500637_0027975
445 2739286133
446 2739291446
447 2895885751
448 2990198760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

47

299

0.83

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

42

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9347 6 255
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9334 1 278
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.926 1 278
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9222 6 255
3qre-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase echa12_1 from mycobacterium marinum 0.9202 4 239
ID Description Score Start End Superfamily
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.95 116 217 3.90.226.20
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9413 1 202 3.90.226.10
3fduF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9347 6 255 3.90.226.10
3fduC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9335 2 201 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.925 1 202 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6I2J468-F1-model_v4 deleted 0.9602 124 209
AF-A0A0L8MY38-F1-model_v4 deleted 0.9533 116 216
AF-A0A7S3B998-F1-model_v4 Enoyl-CoA hydratase 0.9402 104 213 GO:0005739
GO:0006635
GO:0016836
AF-A0A839RZS7-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9323 2 152 GO:0003824
GO:0006631
AF-A0A3C1KRZ3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9313 2 118 GO:0004165
GO:0004300
GO:0005777

Map