F337226

General Info

Members Datasets Scaffolds Average Seq Length
224 160 448 368

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0016221|Ga0500616_0016221_2775_3968
Length 397
Sequence MPHLPGIFALFVAPFLPSGFAQSHTHSMTTPWYEISNVAEIPTPSLAVWPHRIEENLRRMVKMVQGDPARLRPHMKTHKMPEVIKLHLMHGITKFKCATIAEAEMTASEGADEVLLAYPPVGPNIARLLRLVQKYPHTKFAATSDSETAARALSEACVAAGITMDVYIDLDCGMHRTGIAPDDAALALYRLLTTLPGLKVAGIHAYDGHIHDPDLAARKAAVETAFTTVEAFRDRLLAKGLPVPNYIASGTPTFGIHAVRGSYECSPGTCVLWDWGYGTKHPDLDFLHAALVLTRVISKPSSGRLTVDLGHKAIAAENPHPRVHFLNLPDAKAVMHSEEHLVLETPRADEFQIGDVLYGVPWHICPTVALHSYANVVRDGAVEDTWRVAGRERILSV

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
97 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
145 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
146 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
147 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
148 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
149 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
150 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
151 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
152 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
153 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
154 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
155 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
156 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
157 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
158 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
159 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
160 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 0
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 1.79
Rhizoplane 4.02
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0016221 3300053153 Bacteria 4245
2 rootH2_10143534 3300003320 Bacteria 4107
3 rootH2_10172008 3300003320 Archaea 2371
4 rootH1_10084903 3300003323 Unclassified 2569
5 rootH1_10084904 3300003323 Bacteria 6602
6 Ga0065714_10003618 3300005288 Bacteria 6726
7 Ga0065714_10088251 3300005288 Bacteria 2025
8 Ga0065707_10140541 3300005295 Bacteria 1779
9 Ga0070690_100113578 3300005330 Unclassified 1810
10 Ga0070670_100053483 3300005331 Bacteria 3467
11 Ga0070666_10010477 3300005335 Bacteria 5801
12 Ga0070682_100061823 3300005337 Bacteria 2371
13 Ga0070689_100047056 3300005340 Bacteria 3325
14 Ga0070689_100067200 3300005340 Unclassified 2794
15 Ga0070689_100177054 3300005340 Bacteria 1730
16 Ga0070661_100006139 3300005344 Bacteria 8274
17 Ga0070669_100002575 3300005353 Bacteria 13121
18 Ga0070675_100039918 3300005354 Bacteria 3831
19 Ga0070671_100009785 3300005355 Bacteria 7697
20 Ga0070671_100096911 3300005355 Bacteria 2473
21 Ga0070674_100016256 3300005356 Bacteria 4662
22 Ga0070673_100385778 3300005364 Bacteria 1250
23 Ga0070688_100034225 3300005365 Unclassified 3075
24 Ga0070667_100078569 3300005367 Bacteria 2819
25 Ga0070667_100235830 3300005367 Bacteria 1632
26 Ga0070701_10005579 3300005438 Bacteria 5211
27 Ga0070701_10155921 3300005438 Bacteria 1319
28 Ga0070705_100086871 3300005440 Bacteria 1937
29 Ga0070700_100049420 3300005441 Unclassified 2611
30 Ga0070700_100092106 3300005441 Bacteria 1980
31 Ga0070678_100089222 3300005456 Bacteria 2359
32 Ga0070707_100240972 3300005468 Unclassified 1760
33 Ga0070684_100000858 3300005535 Bacteria 21459
34 Ga0070684_100026002 3300005535 Bacteria 4927
35 Ga0070686_100040512 3300005544 Unclassified 2906
36 Ga0070695_100056699 3300005545 Bacteria 2529
37 Ga0070704_100132220 3300005549 Bacteria 1936
38 Ga0070704_100209493 3300005549 Unclassified 1579
39 Ga0070664_100001006 3300005564 Bacteria 22147
40 Ga0070664_100009031 3300005564 Bacteria 8086
41 Ga0068857_100277472 3300005577 Unclassified 1541
42 Ga0068856_100003895 3300005614 Bacteria 14973
43 Ga0070702_100104194 3300005615 Bacteria 1746
44 Ga0068863_100197416 3300005841 Bacteria 1934
45 Ga0068862_100004285 3300005844 Bacteria 12070
46 Ga0081455_10029305 3300005937 Bacteria 5019
47 Ga0097621_100007163 3300006237 Bacteria 7952
48 Ga0075428_100020572 3300006844 Bacteria 7306
49 Ga0075428_100104413 3300006844 Bacteria 3090
50 Ga0075430_100000633 3300006846 Bacteria 26769
51 Ga0075430_100082804 3300006846 Bacteria 2689
52 Ga0075430_100101333 3300006846 Bacteria 2404
53 Ga0075431_100003570 3300006847 Bacteria 15067
54 Ga0075431_100027450 3300006847 Bacteria 5841
55 Ga0075431_100027698 3300006847 Bacteria 5816
56 Ga0075431_100122093 3300006847 Bacteria 2688
57 Ga0075431_100159032 3300006847 Bacteria 2324
58 Ga0075433_10019724 3300006852 Bacteria 5625
59 Ga0075433_10096733 3300006852 Bacteria 2613
60 Ga0075434_100424301 3300006871 Bacteria 1351
61 Ga0075429_100012474 3300006880 Bacteria 7373
62 Ga0075429_100020565 3300006880 Bacteria 5728
63 Ga0075436_100026938 3300006914 Bacteria 3958
64 Ga0099824_1008363 3300006942 Bacteria 13260
65 Ga0099826_10009238 3300006948 Bacteria 7361
66 Ga0075435_100108895 3300007076 Bacteria 2302
67 Ga0105244_10000046 3300009036 Bacteria 143184
68 Ga0111539_10000322 3300009094 Bacteria 58508
69 Ga0111539_10002626 3300009094 Bacteria 23816
70 Ga0111539_10211059 3300009094 Bacteria 2262
71 Ga0114129_10000592 3300009147 Bacteria 44838
72 Ga0114129_10013744 3300009147 Bacteria 11541
73 Ga0114129_10595485 3300009147 Bacteria 1433
74 Ga0114129_10809695 3300009147 Bacteria 1194
75 Ga0105243_10285180 3300009148 Bacteria 1489
76 Ga0105248_10010079 3300009177 Bacteria 10404
77 Ga0105249_10020621 3300009553 Bacteria 5893
78 Ga0157371_10007569 3300013102 Bacteria 8768
79 Ga0157370_10002652 3300013104 Bacteria 21482
80 Ga0157370_10054540 3300013104 Bacteria 3810
81 Ga0157370_10057809 3300013104 Bacteria 3686
82 Ga0157369_10051684 3300013105 Bacteria 4447
83 Ga0157375_10000058 3300013308 Bacteria 121019
84 Ga0157375_10015358 3300013308 Bacteria 6852
85 Ga0163163_10115318 3300014325 Bacteria 2718
86 Ga0157380_10120501 3300014326 Unclassified 2222
87 Ga0182006_1005424 3300015261 Bacteria 6087
88 Ga0182006_1025367 3300015261 Bacteria 2436
89 Ga0163161_10000019 3300017792 Bacteria 216758
90 Ga0163161_10064436 3300017792 Bacteria 2673
91 Ga0207697_10034670 3300025315 Bacteria 2066
92 Ga0207655_1000034 3300025728 Bacteria 364737
93 Ga0207642_10094453 3300025899 Bacteria 1486
94 Ga0207688_10049441 3300025901 Bacteria 2350
95 Ga0207649_10004825 3300025920 Bacteria 7292
96 Ga0207681_10024902 3300025923 Unclassified 3844
97 Ga0207650_10050955 3300025925 Bacteria 3063
98 Ga0207650_10065131 3300025925 Bacteria 2730
99 Ga0207706_10167337 3300025933 Bacteria 1932
100 Ga0207670_10002463 3300025936 Bacteria 9707
101 Ga0207670_10089380 3300025936 Bacteria 2174
102 Ga0207669_10100016 3300025937 Bacteria 1914
103 Ga0207691_10017824 3300025940 Bacteria 6729
104 Ga0207711_10032157 3300025941 Bacteria 4436
105 Ga0207711_10187290 3300025941 Bacteria 1885
106 Ga0207661_10020559 3300025944 Bacteria 4936
107 Ga0207679_10015294 3300025945 Bacteria 5066
108 Ga0207651_10172360 3300025960 Bacteria 1708
109 Ga0207712_10010452 3300025961 Bacteria 5893
110 Ga0207712_10077733 3300025961 Unclassified 2406
111 Ga0207678_10010935 3300026067 Bacteria 7973
112 Ga0207708_10048545 3300026075 Bacteria 3231
113 Ga0207641_10198948 3300026088 Bacteria 1846
114 Ga0207676_10064248 3300026095 Bacteria 2918
115 Ga0207676_10101990 3300026095 Bacteria 2381
116 Ga0207674_10259169 3300026116 Unclassified 1686
117 Ga0207683_10196737 3300026121 Unclassified 1832
118 Ga0209489_109199 3300027361 Bacteria 12544
119 Ga0209282_1013625 3300027666 Bacteria 5174
120 Ga0207428_10015625 3300027907 Bacteria 6560
121 Ga0207428_10200141 3300027907 Bacteria 1503
122 Ga0268265_10023323 3300028380 Unclassified 4361
123 Ga0307408_100257807 3300031548 Unclassified 1442
124 Ga0307412_10175692 3300031911 Bacteria 1605
125 Ga0307416_100000874 3300032002 Bacteria 15858
126 Ga0307416_100005122 3300032002 Bacteria 8003
127 Ga0307414_10015547 3300032004 Bacteria 4594
128 Ga0307414_10018157 3300032004 Bacteria 4321
129 Ga0307414_10147812 3300032004 Bacteria 1849
130 Ga0307414_10309899 3300032004 Bacteria 1339
131 Ga0307411_10000009 3300032005 Bacteria 319906
132 Ga0307411_10092384 3300032005 Bacteria 2116
133 Ga0373943_0133878 3300035170 Bacteria 1329
134 Ga0373947_0006889 3300035725 Bacteria 6587
135 Ga0373925_0016224 3300037068 Bacteria 5391
136 Ga0439447_000193 3300041407 Bacteria 21766
137 Ga0451807_1634483 3300041486 Bacteria 2670
138 Ga0450894_002301 3300042131 Bacteria 2585
139 Ga0450908_002716 3300042184 Unclassified 3455
140 Ga0439464_0005832 3300042439 Bacteria 3196
141 Ga0451577_0139562 3300042876 Bacteria 2177
142 Ga0453684_0001244 3300044712 Bacteria 77266
143 Ga0453684_0016770 3300044712 Bacteria 11413
144 Ga0453684_0078184 3300044712 Unclassified 4141
145 Ga0453684_0079511 3300044712 Bacteria 4099
146 Ga0453684_0093296 3300044712 Bacteria 3708
147 Ga0453684_0168254 3300044712 Bacteria 2585
148 Ga0451576_0155549 3300045051 Bacteria 2385
149 Ga0451576_0187786 3300045051 Bacteria 2158
150 Ga0451576_0300089 3300045051 Bacteria 1680
151 Ga0495610_0051632 3300046512 Bacteria 2000
152 Ga0495618_0162185 3300046514 Bacteria 1425
153 Ga0495630_0000017 3300046517 Bacteria 191957
154 Ga0495633_0085474 3300046558 Bacteria 1467
155 Ga0495625_0078054 3300046660 Bacteria 2312
156 Ga0495647_0073370 3300046681 Bacteria 1374
157 Ga0495658_0027100 3300046683 Bacteria 3079
158 Ga0495680_0155346 3300047322 Unclassified 1665
159 Ga0496101_0261020 3300048904 Bacteria 1351
160 Ga0496104_0080565 3300048907 Bacteria 3104
161 Ga0496105_0100826 3300048908 Bacteria 2384
162 Ga0496107_0180855 3300048910 Unclassified 1566
163 Ga0496109_0040566 3300048912 Bacteria 4216
164 Ga0496110_0002917 3300048913 Bacteria 12943
165 Ga0496111_0012545 3300048914 Bacteria 5742
166 Ga0496114_0225047 3300048917 Unclassified 1647
167 Ga0496116_0000075 3300048919 Bacteria 231674
168 Ga0496117_0130468 3300048920 Bacteria 1524
169 Ga0496118_0028781 3300048921 Bacteria 4672
170 Ga0496121_0009080 3300048924 Bacteria 11512
171 Ga0496124_0112022 3300048927 Bacteria 2195
172 Ga0496125_0000070 3300048928 Bacteria 245793
173 Ga0501034_0014150 3300049571 Bacteria 8223
174 Ga0501067_0023901 3300049583 Bacteria 3389
175 Ga0501074_0035910 3300049590 Unclassified 3591
176 Ga0501249_000970 3300049679 Bacteria 6241
177 Ga0501080_0012825 3300049742 Bacteria 7687
178 Ga0501080_0042530 3300049742 Bacteria 4230
179 Ga0501083_0008774 3300049744 Bacteria 7134
180 Ga0501266_000013 3300049763 Bacteria 183849
181 nmdc:mga05p37_1363_c1 3300050507 Bacteria 28411
182 nmdc:mga05p37_3776_c1 3300050507 Bacteria 17724
183 nmdc:mga09592_24995_c1 3300050508 Bacteria 4941
184 nmdc:mga09592_35054_c1 3300050508 Bacteria 4197
185 nmdc:mga09592_4136_c1 3300050508 Bacteria 11723
186 nmdc:mga0qj67_158898_c1 3300050509 Bacteria 1835
187 nmdc:mga0qj67_216705_c1 3300050509 Bacteria 1554
188 nmdc:mga0qj67_2457_c1 3300050509 Bacteria 13197
189 nmdc:mga0qj67_8672_c1 3300050509 Bacteria 7546
190 nmdc:mga06r32_1548_c1 3300050510 Bacteria 20719
191 nmdc:mga06r32_220390_c1 3300050510 Bacteria 1885
192 nmdc:mga06r32_35777_c1 3300050510 Unclassified 4686
193 nmdc:mga06r32_37586_c1 3300050510 Bacteria 4580
194 nmdc:mga06r32_461671_c1 3300050510 Bacteria 1249
195 nmdc:mga08y16_2164_c1 3300050511 Bacteria 20147
196 nmdc:mga08y16_297022_c1 3300050511 Bacteria 1665
197 nmdc:mga08y16_345128_c1 3300050511 Bacteria 1530
198 nmdc:mga08y16_36276_c1 3300050511 Bacteria 5177
199 nmdc:mga08y16_9822_c1 3300050511 Bacteria 10046
200 nmdc:mga0rr50_225947_c1 3300050513 Bacteria 1547
201 nmdc:mga0a205_9558_c1 3300050515 Bacteria 8872
202 Ga0500646_0022946 3300053090 Bacteria 1671
203 Ga0500641_0000012 3300053096 Bacteria 164908
204 Ga0500594_0008525 3300053118 Bacteria 2340
205 Ga0500658_0000005 3300053134 Bacteria 369268
206 Ga0500559_0026013 3300053136 Bacteria 2491
207 Ga0501084_0009382 3300054114 Bacteria 8094
208 2644012760 2643221600 Bacteria 5530138
209 2644370443 2643221667 Bacteria 5627472
210 2644641771 2643221716 Bacteria 4986332
211 2644682110 2643221725 Bacteria 5087956
212 2687237692 2684623219 Bacteria 8442773
213 2738735543 2738541279 Bacteria 6149495
214 2738768120 2738541285 Bacteria 6150075
215 2739217125 2738543007 Bacteria 6149845
216 2740003708 2739367857 Bacteria 5433684
217 2740008525 2739367858 Bacteria 5432813
218 2802655064 2802428842 Bacteria 4926114
219 2857622376 2857618242 Bacteria 5635925
220 2881361080 2881359912 Bacteria 4935907
221 2919194706 2919191525 Bacteria 5765973
222 2929150926 2929150217 Bacteria 5462483
223 8054307936 8054307821 Bacteria 5212224
224 8055597187 8055592153 Bacteria 5961247
225 Ga0500616_0016221
226 rootH2_10143534
227 rootH2_10172008
228 rootH1_10084903
229 rootH1_10084904
230 Ga0065714_10003618
231 Ga0065714_10088251
232 Ga0065707_10140541
233 Ga0070690_100113578
234 Ga0070670_100053483
235 Ga0070666_10010477
236 Ga0070682_100061823
237 Ga0070689_100047056
238 Ga0070689_100067200
239 Ga0070689_100177054
240 Ga0070661_100006139
241 Ga0070669_100002575
242 Ga0070675_100039918
243 Ga0070671_100009785
244 Ga0070671_100096911
245 Ga0070674_100016256
246 Ga0070673_100385778
247 Ga0070688_100034225
248 Ga0070667_100078569
249 Ga0070667_100235830
250 Ga0070701_10005579
251 Ga0070701_10155921
252 Ga0070705_100086871
253 Ga0070700_100049420
254 Ga0070700_100092106
255 Ga0070678_100089222
256 Ga0070707_100240972
257 Ga0070684_100000858
258 Ga0070684_100026002
259 Ga0070686_100040512
260 Ga0070695_100056699
261 Ga0070704_100132220
262 Ga0070704_100209493
263 Ga0070664_100001006
264 Ga0070664_100009031
265 Ga0068857_100277472
266 Ga0068856_100003895
267 Ga0070702_100104194
268 Ga0068863_100197416
269 Ga0068862_100004285
270 Ga0081455_10029305
271 Ga0097621_100007163
272 Ga0075428_100020572
273 Ga0075428_100104413
274 Ga0075430_100000633
275 Ga0075430_100082804
276 Ga0075430_100101333
277 Ga0075431_100003570
278 Ga0075431_100027450
279 Ga0075431_100027698
280 Ga0075431_100122093
281 Ga0075431_100159032
282 Ga0075433_10019724
283 Ga0075433_10096733
284 Ga0075434_100424301
285 Ga0075429_100012474
286 Ga0075429_100020565
287 Ga0075436_100026938
288 Ga0099824_1008363
289 Ga0099826_10009238
290 Ga0075435_100108895
291 Ga0105244_10000046
292 Ga0111539_10000322
293 Ga0111539_10002626
294 Ga0111539_10211059
295 Ga0114129_10000592
296 Ga0114129_10013744
297 Ga0114129_10595485
298 Ga0114129_10809695
299 Ga0105243_10285180
300 Ga0105248_10010079
301 Ga0105249_10020621
302 Ga0157371_10007569
303 Ga0157370_10002652
304 Ga0157370_10054540
305 Ga0157370_10057809
306 Ga0157369_10051684
307 Ga0157375_10000058
308 Ga0157375_10015358
309 Ga0163163_10115318
310 Ga0157380_10120501
311 Ga0182006_1005424
312 Ga0182006_1025367
313 Ga0163161_10000019
314 Ga0163161_10064436
315 Ga0207697_10034670
316 Ga0207655_1000034
317 Ga0207642_10094453
318 Ga0207688_10049441
319 Ga0207649_10004825
320 Ga0207681_10024902
321 Ga0207650_10050955
322 Ga0207650_10065131
323 Ga0207706_10167337
324 Ga0207670_10002463
325 Ga0207670_10089380
326 Ga0207669_10100016
327 Ga0207691_10017824
328 Ga0207711_10032157
329 Ga0207711_10187290
330 Ga0207661_10020559
331 Ga0207679_10015294
332 Ga0207651_10172360
333 Ga0207712_10010452
334 Ga0207712_10077733
335 Ga0207678_10010935
336 Ga0207708_10048545
337 Ga0207641_10198948
338 Ga0207676_10064248
339 Ga0207676_10101990
340 Ga0207674_10259169
341 Ga0207683_10196737
342 Ga0209489_109199
343 Ga0209282_1013625
344 Ga0207428_10015625
345 Ga0207428_10200141
346 Ga0268265_10023323
347 Ga0307408_100257807
348 Ga0307412_10175692
349 Ga0307416_100000874
350 Ga0307416_100005122
351 Ga0307414_10015547
352 Ga0307414_10018157
353 Ga0307414_10147812
354 Ga0307414_10309899
355 Ga0307411_10000009
356 Ga0307411_10092384
357 Ga0373943_0133878
358 Ga0373947_0006889
359 Ga0373925_0016224
360 Ga0439447_000193
361 Ga0451807_1634483
362 Ga0450894_002301
363 Ga0450908_002716
364 Ga0439464_0005832
365 Ga0451577_0139562
366 Ga0453684_0001244
367 Ga0453684_0016770
368 Ga0453684_0078184
369 Ga0453684_0079511
370 Ga0453684_0093296
371 Ga0453684_0168254
372 Ga0451576_0155549
373 Ga0451576_0187786
374 Ga0451576_0300089
375 Ga0495610_0051632
376 Ga0495618_0162185
377 Ga0495630_0000017
378 Ga0495633_0085474
379 Ga0495625_0078054
380 Ga0495647_0073370
381 Ga0495658_0027100
382 Ga0495680_0155346
383 Ga0496101_0261020
384 Ga0496104_0080565
385 Ga0496105_0100826
386 Ga0496107_0180855
387 Ga0496109_0040566
388 Ga0496110_0002917
389 Ga0496111_0012545
390 Ga0496114_0225047
391 Ga0496116_0000075
392 Ga0496117_0130468
393 Ga0496118_0028781
394 Ga0496121_0009080
395 Ga0496124_0112022
396 Ga0496125_0000070
397 Ga0501034_0014150
398 Ga0501067_0023901
399 Ga0501074_0035910
400 Ga0501249_000970
401 Ga0501080_0012825
402 Ga0501080_0042530
403 Ga0501083_0008774
404 Ga0501266_000013
405 nmdc:mga05p37_1363_c1
406 nmdc:mga05p37_3776_c1
407 nmdc:mga09592_24995_c1
408 nmdc:mga09592_35054_c1
409 nmdc:mga09592_4136_c1
410 nmdc:mga0qj67_158898_c1
411 nmdc:mga0qj67_216705_c1
412 nmdc:mga0qj67_2457_c1
413 nmdc:mga0qj67_8672_c1
414 nmdc:mga06r32_1548_c1
415 nmdc:mga06r32_220390_c1
416 nmdc:mga06r32_35777_c1
417 nmdc:mga06r32_37586_c1
418 nmdc:mga06r32_461671_c1
419 nmdc:mga08y16_2164_c1
420 nmdc:mga08y16_297022_c1
421 nmdc:mga08y16_345128_c1
422 nmdc:mga08y16_36276_c1
423 nmdc:mga08y16_9822_c1
424 nmdc:mga0rr50_225947_c1
425 nmdc:mga0a205_9558_c1
426 Ga0500646_0022946
427 Ga0500641_0000012
428 Ga0500594_0008525
429 Ga0500658_0000005
430 Ga0500559_0026013
431 Ga0501084_0009382
432 2644012760
433 2644370443
434 2644641771
435 2644682110
436 2687237692
437 2738735543
438 2738768120
439 2739217125
440 2740003708
441 2740008525
442 2802655064
443 2857622376
444 2881361080
445 2919194706
446 2929150926
447 8054307936
448 8055597187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

289

377

0.88

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

49

272

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dib-assembly1.cif.gz_B crystal structure of d-threonine aldolase from filomicrobium marinum 0.9182 9 359
7yqa-assembly2.cif.gz_D crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.9137 3 360
7yqa-assembly1.cif.gz_B crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.9135 4 360
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.9091 4 360
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.9083 9 359
ID Description Score Start End Superfamily
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9164 21 240 3.20.20.10
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9007 21 240 3.20.20.10
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8888 21 240 3.20.20.10
4v15B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.8852 243 360 2.40.37.20
3awoA01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.877 242 360 2.40.37.20
ID Description Score Start End GO Terms
AF-A0A2V6FF74-F1-model_v4 Threonine aldolase 0.9906 10 358 GO:0008721
GO:0036088
AF-A0A3N7HB83-F1-model_v4 D-TA family PLP-dependent enzyme 0.9865 1 159 GO:0008721
GO:0036088
AF-A0A5M6DBG1-F1-model_v4 D-TA family PLP-dependent enzyme 0.9857 7 363 GO:0008721
GO:0036088
AF-A0A3M1ML19-F1-model_v4 D-TA family PLP-dependent enzyme 0.9855 6 102 GO:0008721
GO:0036088
AF-A0A2P8GGR8-F1-model_v4 D-serine deaminase-like pyridoxal phosphate-dependent protein 0.9847 1 361 GO:0008721
GO:0036088

Map