F337366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 153 | 450 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300003752|Ga0055539_1006796|Ga0055539_10067962 |
| Length | 286 |
| Sequence | MSSSHIRPPASTRATPRYGLARVLSKLGVCSRSQAEKAVREGRVSVDGRPVRDPERATDPXREQIHLDGQTVAAAKRVYIALNKPRGVVVSAADERGRDTVYELLAXANLPWLGPVGRLDKASEGLLLLSNDSXWAARLTDPRHHVDKTYXVQIDAIPDQAALDRMLXGVSDKGERLAAKRVSLLRTGEKNAWLEIVLDEGRNRHIRRLLEVQGIGVLRLIRVAIGMLALAELGKGQWRHLSADEVTRLSGAKDEAAATKGTRADAPPAKSARRRDGSGQGPGRRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 25 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 26 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 37 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 42 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 43 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 48 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 77 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 78 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 79 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 80 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 81 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 82 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 83 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 84 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 85 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 86 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 87 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 88 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 89 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 90 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 91 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 92 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 93 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 94 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 95 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 98 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 99 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 100 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 101 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 102 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 118 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 119 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 120 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 121 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 122 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 123 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 124 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 125 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 141 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 142 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 143 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 144 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 145 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 146 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 147 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 148 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 149 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 150 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 151 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 152 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 153 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.33 |
| Metatranscriptomes | 1.33 |
| Isolates | 5.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.11 |
| Nodule | 0.89 |
| Rhizoplane | 3.56 |
| Rhizosphere | 76.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055539_1006796 | 3300003752 | Bacteria | 1459 |
| 2 | JGI24735J21928_10010635 | 3300002067 | Bacteria | 2929 |
| 3 | rootH1_10051981 | 3300003316 | Bacteria | 3098 |
| 4 | rootH2_10003284 | 3300003320 | Bacteria | 3037 |
| 5 | rootH2_10043603 | 3300003320 | Bacteria | 12889 |
| 6 | rootH2_10075064 | 3300003320 | Bacteria | 1175 |
| 7 | rootL2_10072693 | 3300003322 | Bacteria | 3255 |
| 8 | Ga0055527_1000073 | 3300003760 | Bacteria | 83327 |
| 9 | Ga0055535_1000080 | 3300003761 | Bacteria | 108370 |
| 10 | Ga0055542_1000165 | 3300003762 | Bacteria | 83314 |
| 11 | Ga0055529_1000194 | 3300003763 | Bacteria | 83314 |
| 12 | Ga0065165_1007890 | 3300005262 | Bacteria | 5109 |
| 13 | Ga0070682_100020379 | 3300005337 | Bacteria | 3900 |
| 14 | Ga0070661_100116478 | 3300005344 | Bacteria | 1999 |
| 15 | Ga0070661_100543985 | 3300005344 | Bacteria | 934 |
| 16 | Ga0070688_100120429 | 3300005365 | Bacteria | 1757 |
| 17 | Ga0070667_100231472 | 3300005367 | Bacteria | 1648 |
| 18 | Ga0070714_100003853 | 3300005435 | Bacteria | 11267 |
| 19 | Ga0070663_100121500 | 3300005455 | Bacteria | 1973 |
| 20 | Ga0070681_10484822 | 3300005458 | Bacteria | 1149 |
| 21 | Ga0070685_10023591 | 3300005466 | Bacteria | 3370 |
| 22 | Ga0068853_100109444 | 3300005539 | Bacteria | 2452 |
| 23 | Ga0070696_100050887 | 3300005546 | Bacteria | 2880 |
| 24 | Ga0068855_100017328 | 3300005563 | Bacteria | 8667 |
| 25 | Ga0068855_100053058 | 3300005563 | Bacteria | 4771 |
| 26 | Ga0068854_100003889 | 3300005578 | Bacteria | 9360 |
| 27 | Ga0068856_100040930 | 3300005614 | Bacteria | 4552 |
| 28 | Ga0075428_100047802 | 3300006844 | Bacteria | 4698 |
| 29 | Ga0075431_100294089 | 3300006847 | Unclassified | 1642 |
| 30 | Ga0105240_10029809 | 3300009093 | Bacteria | 7101 |
| 31 | Ga0105240_10075095 | 3300009093 | Bacteria | 4170 |
| 32 | Ga0105240_10341983 | 3300009093 | Bacteria | 1699 |
| 33 | Ga0105247_10001149 | 3300009101 | Bacteria | 19614 |
| 34 | Ga0105243_10028401 | 3300009148 | Bacteria | 4295 |
| 35 | Ga0105237_10000348 | 3300009545 | Bacteria | 65042 |
| 36 | Ga0105237_10032874 | 3300009545 | Bacteria | 5252 |
| 37 | Ga0105237_10124678 | 3300009545 | Bacteria | 2570 |
| 38 | Ga0105238_10595407 | 3300009551 | Bacteria | 1113 |
| 39 | Ga0105239_10026188 | 3300010375 | Bacteria | 6419 |
| 40 | Ga0157371_10150133 | 3300013102 | Bacteria | 1662 |
| 41 | Ga0157370_10059041 | 3300013104 | Bacteria | 3646 |
| 42 | Ga0157369_10027899 | 3300013105 | Bacteria | 6253 |
| 43 | Ga0157374_10114658 | 3300013296 | Bacteria | 2595 |
| 44 | Ga0182008_10099230 | 3300014497 | Bacteria | 1438 |
| 45 | Ga0182008_10196470 | 3300014497 | Bacteria | 1025 |
| 46 | Ga0157379_10179395 | 3300014968 | Bacteria | 1913 |
| 47 | Ga0182006_1000476 | 3300015261 | Bacteria | 31364 |
| 48 | Ga0182007_10015974 | 3300015262 | Bacteria | 2782 |
| 49 | Ga0182007_10075917 | 3300015262 | Bacteria | 1102 |
| 50 | Ga0182005_1000916 | 3300015265 | Bacteria | 12893 |
| 51 | Ga0182005_1011808 | 3300015265 | Bacteria | 2479 |
| 52 | Ga0183369_1009 | 3300015685 | Bacteria | 346348 |
| 53 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 54 | Ga0163161_10003168 | 3300017792 | Bacteria | 11603 |
| 55 | Ga0163161_10011185 | 3300017792 | Bacteria | 6217 |
| 56 | Ga0206356_10606883 | 3300020070 | Bacteria | 1762 |
| 57 | Ga0206354_10379810 | 3300020081 | Bacteria | 1484 |
| 58 | Ga0206353_11541756 | 3300020082 | Bacteria | 2006 |
| 59 | Ga0209435_104349 | 3300025206 | Bacteria | 1605 |
| 60 | Ga0209674_100175 | 3300025226 | Bacteria | 80049 |
| 61 | Ga0209672_100018 | 3300025228 | Bacteria | 432924 |
| 62 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 63 | Ga0209258_100547 | 3300025242 | Bacteria | 34006 |
| 64 | Ga0209026_1000248 | 3300025250 | Bacteria | 68614 |
| 65 | Ga0209026_1001250 | 3300025250 | Bacteria | 11634 |
| 66 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 67 | Ga0209759_1001182 | 3300025256 | Bacteria | 16371 |
| 68 | Ga0209759_1002155 | 3300025256 | Bacteria | 9040 |
| 69 | Ga0209233_1001533 | 3300025261 | Bacteria | 9056 |
| 70 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 71 | Ga0209758_1008280 | 3300025297 | Bacteria | 6797 |
| 72 | Ga0209758_1053335 | 3300025297 | Bacteria | 1390 |
| 73 | Ga0207710_10021772 | 3300025900 | Bacteria | 2750 |
| 74 | Ga0207647_10004415 | 3300025904 | Bacteria | 10430 |
| 75 | Ga0207647_10041149 | 3300025904 | Bacteria | 2908 |
| 76 | Ga0207707_10104658 | 3300025912 | Bacteria | 2473 |
| 77 | Ga0207707_10394399 | 3300025912 | Bacteria | 1189 |
| 78 | Ga0207695_10012435 | 3300025913 | Bacteria | 10220 |
| 79 | Ga0207695_10043663 | 3300025913 | Bacteria | 4776 |
| 80 | Ga0207695_10155399 | 3300025913 | Bacteria | 2222 |
| 81 | Ga0207695_10281352 | 3300025913 | Bacteria | 1557 |
| 82 | Ga0207671_10000167 | 3300025914 | Bacteria | 100428 |
| 83 | Ga0207657_10160654 | 3300025919 | Bacteria | 1825 |
| 84 | Ga0207649_10020046 | 3300025920 | Bacteria | 3828 |
| 85 | Ga0207649_10157091 | 3300025920 | Bacteria | 1572 |
| 86 | Ga0207664_10000103 | 3300025929 | Bacteria | 77654 |
| 87 | Ga0207690_10057773 | 3300025932 | Bacteria | 2622 |
| 88 | Ga0207709_10000756 | 3300025935 | Bacteria | 25515 |
| 89 | Ga0207667_10000119 | 3300025949 | Bacteria | 124365 |
| 90 | Ga0207667_10283178 | 3300025949 | Bacteria | 1694 |
| 91 | Ga0207667_10363697 | 3300025949 | Bacteria | 1475 |
| 92 | Ga0207651_10045415 | 3300025960 | Bacteria | 2947 |
| 93 | Ga0207640_10000099 | 3300025981 | Bacteria | 66535 |
| 94 | Ga0207640_10187526 | 3300025981 | Bacteria | 1556 |
| 95 | Ga0207658_10392345 | 3300025986 | Bacteria | 1218 |
| 96 | Ga0207678_10001672 | 3300026067 | Bacteria | 20361 |
| 97 | Ga0207678_10216690 | 3300026067 | Bacteria | 1638 |
| 98 | Ga0207702_10005905 | 3300026078 | Bacteria | 10647 |
| 99 | Ga0207702_10026422 | 3300026078 | Bacteria | 4820 |
| 100 | Ga0207674_10154366 | 3300026116 | Bacteria | 2251 |
| 101 | Ga0268266_10104665 | 3300028379 | Bacteria | 2499 |
| 102 | Ga0265331_10056312 | 3300031250 | Bacteria | 1867 |
| 103 | Ga0265316_10004221 | 3300031344 | Bacteria | 14350 |
| 104 | Ga0307408_100137090 | 3300031548 | Bacteria | 1916 |
| 105 | Ga0265342_10138845 | 3300031712 | Bacteria | 1357 |
| 106 | Ga0307412_10005369 | 3300031911 | Bacteria | 7192 |
| 107 | Ga0307409_100334806 | 3300031995 | Bacteria | 1422 |
| 108 | Ga0307416_100684627 | 3300032002 | Bacteria | 1113 |
| 109 | Ga0395899_0000153 | 3300037312 | Bacteria | 105214 |
| 110 | Ga0395899_0238232 | 3300037312 | Bacteria | 1253 |
| 111 | Ga0395900_0000166 | 3300037418 | Bacteria | 107636 |
| 112 | Ga0395900_0017799 | 3300037418 | Bacteria | 7254 |
| 113 | Ga0395898_0000459 | 3300037466 | Bacteria | 81813 |
| 114 | Ga0395898_0006284 | 3300037466 | Bacteria | 12700 |
| 115 | Ga0395898_0009981 | 3300037466 | Bacteria | 9945 |
| 116 | Ga0395905_0197428 | 3300037471 | Bacteria | 1887 |
| 117 | Ga0395901_0460501 | 3300038443 | Bacteria | 1299 |
| 118 | Ga0395901_0582919 | 3300038443 | Bacteria | 1130 |
| 119 | Ga0395901_0914295 | 3300038443 | Bacteria | 858 |
| 120 | Ga0439436_0000079 | 3300041404 | Bacteria | 24531 |
| 121 | Ga0451793_1492321 | 3300041452 | Bacteria | 3809 |
| 122 | Ga0466982_0000009 | 3300044672 | Bacteria | 221166 |
| 123 | Ga0466966_0005089 | 3300044684 | Bacteria | 8640 |
| 124 | Ga0466966_0014173 | 3300044684 | Bacteria | 5277 |
| 125 | Ga0466961_0019968 | 3300044693 | Bacteria | 4311 |
| 126 | Ga0466961_0050895 | 3300044693 | Bacteria | 2645 |
| 127 | Ga0466961_0066117 | 3300044693 | Bacteria | 2297 |
| 128 | Ga0466963_0265383 | 3300044694 | Bacteria | 1206 |
| 129 | Ga0466964_0000914 | 3300044706 | Bacteria | 9701 |
| 130 | Ga0466971_0004740 | 3300044719 | Bacteria | 5883 |
| 131 | Ga0466971_0012626 | 3300044719 | Bacteria | 3705 |
| 132 | Ga0466968_0007519 | 3300044735 | Bacteria | 4146 |
| 133 | Ga0466970_0136876 | 3300044765 | Bacteria | 1347 |
| 134 | Ga0466960_0064658 | 3300044901 | Bacteria | 1804 |
| 135 | Ga0466959_0038307 | 3300045049 | Bacteria | 3542 |
| 136 | Ga0466959_0358018 | 3300045049 | Bacteria | 994 |
| 137 | Ga0451576_0230802 | 3300045051 | Unclassified | 1933 |
| 138 | Ga0466958_0036017 | 3300045836 | Bacteria | 2960 |
| 139 | Ga0466958_0125984 | 3300045836 | Bacteria | 1606 |
| 140 | Ga0466967_0276628 | 3300045976 | Bacteria | 1610 |
| 141 | Ga0495617_000561 | 3300046452 | Bacteria | 19091 |
| 142 | Ga0495638_0000038 | 3300046460 | Bacteria | 249534 |
| 143 | Ga0495585_0000415 | 3300046492 | Bacteria | 41233 |
| 144 | Ga0495607_0000088 | 3300046501 | Bacteria | 95203 |
| 145 | Ga0495607_0076909 | 3300046501 | Bacteria | 1845 |
| 146 | Ga0495606_0000338 | 3300046507 | Bacteria | 80898 |
| 147 | Ga0495606_0002747 | 3300046507 | Bacteria | 19749 |
| 148 | Ga0495610_0001019 | 3300046512 | Bacteria | 25815 |
| 149 | Ga0495620_0000834 | 3300046515 | Bacteria | 19044 |
| 150 | Ga0495631_0003490 | 3300046518 | Bacteria | 8595 |
| 151 | Ga0495648_0001205 | 3300046524 | Bacteria | 25909 |
| 152 | Ga0495668_0001221 | 3300046616 | Bacteria | 25971 |
| 153 | Ga0495625_0002591 | 3300046660 | Bacteria | 19361 |
| 154 | Ga0495625_0074281 | 3300046660 | Bacteria | 2382 |
| 155 | Ga0495661_0000438 | 3300046665 | Bacteria | 44026 |
| 156 | Ga0495670_0058643 | 3300046691 | Bacteria | 1932 |
| 157 | Ga0495649_0000369 | 3300046694 | Bacteria | 38901 |
| 158 | Ga0496100_0055700 | 3300048903 | Bacteria | 2584 |
| 159 | Ga0496103_0038389 | 3300048906 | Bacteria | 2938 |
| 160 | Ga0496113_0077952 | 3300048916 | Bacteria | 2535 |
| 161 | Ga0496115_0000045 | 3300048918 | Bacteria | 113665 |
| 162 | Ga0496115_0002907 | 3300048918 | Bacteria | 12359 |
| 163 | Ga0496115_0004265 | 3300048918 | Bacteria | 10344 |
| 164 | Ga0496115_0246815 | 3300048918 | Bacteria | 1470 |
| 165 | Ga0496118_0016906 | 3300048921 | Bacteria | 6663 |
| 166 | Ga0496118_0052434 | 3300048921 | Bacteria | 3111 |
| 167 | Ga0496119_0209598 | 3300048922 | Bacteria | 1003 |
| 168 | Ga0496121_0001056 | 3300048924 | Bacteria | 48851 |
| 169 | Ga0496121_0085554 | 3300048924 | Bacteria | 2481 |
| 170 | Ga0496124_0000849 | 3300048927 | Bacteria | 49858 |
| 171 | Ga0496124_0058348 | 3300048927 | Bacteria | 3247 |
| 172 | Ga0496126_0000033 | 3300048929 | Bacteria | 368851 |
| 173 | Ga0496126_0141948 | 3300048929 | Bacteria | 2066 |
| 174 | Ga0496126_0338758 | 3300048929 | Bacteria | 1232 |
| 175 | Ga0501031_0106908 | 3300049568 | Bacteria | 1826 |
| 176 | Ga0501031_0145409 | 3300049568 | Bacteria | 1549 |
| 177 | Ga0501032_0004445 | 3300049569 | Bacteria | 10569 |
| 178 | Ga0501033_0009333 | 3300049570 | Bacteria | 7553 |
| 179 | Ga0501033_0080406 | 3300049570 | Bacteria | 2391 |
| 180 | Ga0501033_0156774 | 3300049570 | Bacteria | 1640 |
| 181 | Ga0501033_0284947 | 3300049570 | Bacteria | 1166 |
| 182 | Ga0501034_0005146 | 3300049571 | Bacteria | 14350 |
| 183 | Ga0501036_0293339 | 3300049572 | Bacteria | 1360 |
| 184 | Ga0501037_0004096 | 3300049573 | Bacteria | 10570 |
| 185 | Ga0501037_0115046 | 3300049573 | Bacteria | 1936 |
| 186 | Ga0501037_0370793 | 3300049573 | Bacteria | 985 |
| 187 | Ga0501038_0000772 | 3300049574 | Bacteria | 28412 |
| 188 | Ga0501038_0234868 | 3300049574 | Bacteria | 1457 |
| 189 | Ga0501039_0004971 | 3300049575 | Bacteria | 10089 |
| 190 | Ga0501043_0002484 | 3300049579 | Bacteria | 15597 |
| 191 | Ga0501043_0022068 | 3300049579 | Bacteria | 4995 |
| 192 | Ga0501043_0036129 | 3300049579 | Bacteria | 3886 |
| 193 | Ga0501046_0309754 | 3300049580 | Bacteria | 1152 |
| 194 | Ga0501047_0015126 | 3300049581 | Bacteria | 7346 |
| 195 | Ga0501047_0016483 | 3300049581 | Bacteria | 7053 |
| 196 | Ga0501047_0055044 | 3300049581 | Bacteria | 3847 |
| 197 | Ga0501047_0098706 | 3300049581 | Bacteria | 2799 |
| 198 | Ga0501047_0809946 | 3300049581 | Bacteria | 751 |
| 199 | Ga0501070_0074823 | 3300049586 | Bacteria | 2804 |
| 200 | Ga0501073_0007176 | 3300049589 | Bacteria | 8299 |
| 201 | Ga0501035_0013767 | 3300049822 | Bacteria | 7466 |
| 202 | Ga0501035_0017890 | 3300049822 | Bacteria | 6538 |
| 203 | Ga0501035_0034783 | 3300049822 | Bacteria | 4577 |
| 204 | Ga0501035_0252198 | 3300049822 | Bacteria | 1498 |
| 205 | Ga0501035_0580263 | 3300049822 | Bacteria | 916 |
| 206 | Ga0501044_0074602 | 3300049823 | Bacteria | 3445 |
| 207 | Ga0501044_0118434 | 3300049823 | Bacteria | 2651 |
| 208 | Ga0501044_0143985 | 3300049823 | Bacteria | 2370 |
| 209 | Ga0501044_0314677 | 3300049823 | Bacteria | 1491 |
| 210 | Ga0501044_0484003 | 3300049823 | Bacteria | 1140 |
| 211 | Ga0500568_0000426 | 3300053139 | Bacteria | 31866 |
| 212 | Ga0466962_0016491 | 3300061719 | Bacteria | 3563 |
| 213 | Ga0466962_0016592 | 3300061719 | Bacteria | 3551 |
| 214 | 2595449503 | 2593339239 | Bacteria | 4124669 |
| 215 | 2721026588 | 2718218334 | Bacteria | 4765486 |
| 216 | 2735833417 | 2734482264 | Unclassified | 5014763 |
| 217 | 2739730583 | 2739367700 | Bacteria | 4747630 |
| 218 | 2842919810 | 2842918807 | Bacteria | 4289178 |
| 219 | 2884341409 | 2884338543 | Bacteria | 4610696 |
| 220 | 2884415183 | 2884411467 | Bacteria | 5246714 |
| 221 | 2919130136 | 2919130084 | Bacteria | 5301837 |
| 222 | 2953995109 | 2953994433 | Bacteria | 4303959 |
| 223 | 2970528296 | 2970524798 | Bacteria | 6840927 |
| 224 | 8021651820 | 8021648035 | Bacteria | 4772378 |
| 225 | 8055620458 | 8055617313 | Bacteria | 7548464 |
| 226 | Ga0055539_1006796 | |||
| 227 | JGI24735J21928_10010635 | |||
| 228 | rootH1_10051981 | |||
| 229 | rootH2_10003284 | |||
| 230 | rootH2_10043603 | |||
| 231 | rootH2_10075064 | |||
| 232 | rootL2_10072693 | |||
| 233 | Ga0055527_1000073 | |||
| 234 | Ga0055535_1000080 | |||
| 235 | Ga0055542_1000165 | |||
| 236 | Ga0055529_1000194 | |||
| 237 | Ga0065165_1007890 | |||
| 238 | Ga0070682_100020379 | |||
| 239 | Ga0070661_100116478 | |||
| 240 | Ga0070661_100543985 | |||
| 241 | Ga0070688_100120429 | |||
| 242 | Ga0070667_100231472 | |||
| 243 | Ga0070714_100003853 | |||
| 244 | Ga0070663_100121500 | |||
| 245 | Ga0070681_10484822 | |||
| 246 | Ga0070685_10023591 | |||
| 247 | Ga0068853_100109444 | |||
| 248 | Ga0070696_100050887 | |||
| 249 | Ga0068855_100017328 | |||
| 250 | Ga0068855_100053058 | |||
| 251 | Ga0068854_100003889 | |||
| 252 | Ga0068856_100040930 | |||
| 253 | Ga0075428_100047802 | |||
| 254 | Ga0075431_100294089 | |||
| 255 | Ga0105240_10029809 | |||
| 256 | Ga0105240_10075095 | |||
| 257 | Ga0105240_10341983 | |||
| 258 | Ga0105247_10001149 | |||
| 259 | Ga0105243_10028401 | |||
| 260 | Ga0105237_10000348 | |||
| 261 | Ga0105237_10032874 | |||
| 262 | Ga0105237_10124678 | |||
| 263 | Ga0105238_10595407 | |||
| 264 | Ga0105239_10026188 | |||
| 265 | Ga0157371_10150133 | |||
| 266 | Ga0157370_10059041 | |||
| 267 | Ga0157369_10027899 | |||
| 268 | Ga0157374_10114658 | |||
| 269 | Ga0182008_10099230 | |||
| 270 | Ga0182008_10196470 | |||
| 271 | Ga0157379_10179395 | |||
| 272 | Ga0182006_1000476 | |||
| 273 | Ga0182007_10015974 | |||
| 274 | Ga0182007_10075917 | |||
| 275 | Ga0182005_1000916 | |||
| 276 | Ga0182005_1011808 | |||
| 277 | Ga0183369_1009 | |||
| 278 | Ga0183368_1004 | |||
| 279 | Ga0163161_10003168 | |||
| 280 | Ga0163161_10011185 | |||
| 281 | Ga0206356_10606883 | |||
| 282 | Ga0206354_10379810 | |||
| 283 | Ga0206353_11541756 | |||
| 284 | Ga0209435_104349 | |||
| 285 | Ga0209674_100175 | |||
| 286 | Ga0209672_100018 | |||
| 287 | Ga0209258_100024 | |||
| 288 | Ga0209258_100547 | |||
| 289 | Ga0209026_1000248 | |||
| 290 | Ga0209026_1001250 | |||
| 291 | Ga0209148_1000009 | |||
| 292 | Ga0209759_1001182 | |||
| 293 | Ga0209759_1002155 | |||
| 294 | Ga0209233_1001533 | |||
| 295 | Ga0209455_1000029 | |||
| 296 | Ga0209758_1008280 | |||
| 297 | Ga0209758_1053335 | |||
| 298 | Ga0207710_10021772 | |||
| 299 | Ga0207647_10004415 | |||
| 300 | Ga0207647_10041149 | |||
| 301 | Ga0207707_10104658 | |||
| 302 | Ga0207707_10394399 | |||
| 303 | Ga0207695_10012435 | |||
| 304 | Ga0207695_10043663 | |||
| 305 | Ga0207695_10155399 | |||
| 306 | Ga0207695_10281352 | |||
| 307 | Ga0207671_10000167 | |||
| 308 | Ga0207657_10160654 | |||
| 309 | Ga0207649_10020046 | |||
| 310 | Ga0207649_10157091 | |||
| 311 | Ga0207664_10000103 | |||
| 312 | Ga0207690_10057773 | |||
| 313 | Ga0207709_10000756 | |||
| 314 | Ga0207667_10000119 | |||
| 315 | Ga0207667_10283178 | |||
| 316 | Ga0207667_10363697 | |||
| 317 | Ga0207651_10045415 | |||
| 318 | Ga0207640_10000099 | |||
| 319 | Ga0207640_10187526 | |||
| 320 | Ga0207658_10392345 | |||
| 321 | Ga0207678_10001672 | |||
| 322 | Ga0207678_10216690 | |||
| 323 | Ga0207702_10005905 | |||
| 324 | Ga0207702_10026422 | |||
| 325 | Ga0207674_10154366 | |||
| 326 | Ga0268266_10104665 | |||
| 327 | Ga0265331_10056312 | |||
| 328 | Ga0265316_10004221 | |||
| 329 | Ga0307408_100137090 | |||
| 330 | Ga0265342_10138845 | |||
| 331 | Ga0307412_10005369 | |||
| 332 | Ga0307409_100334806 | |||
| 333 | Ga0307416_100684627 | |||
| 334 | Ga0395899_0000153 | |||
| 335 | Ga0395899_0238232 | |||
| 336 | Ga0395900_0000166 | |||
| 337 | Ga0395900_0017799 | |||
| 338 | Ga0395898_0000459 | |||
| 339 | Ga0395898_0006284 | |||
| 340 | Ga0395898_0009981 | |||
| 341 | Ga0395905_0197428 | |||
| 342 | Ga0395901_0460501 | |||
| 343 | Ga0395901_0582919 | |||
| 344 | Ga0395901_0914295 | |||
| 345 | Ga0439436_0000079 | |||
| 346 | Ga0451793_1492321 | |||
| 347 | Ga0466982_0000009 | |||
| 348 | Ga0466966_0005089 | |||
| 349 | Ga0466966_0014173 | |||
| 350 | Ga0466961_0019968 | |||
| 351 | Ga0466961_0050895 | |||
| 352 | Ga0466961_0066117 | |||
| 353 | Ga0466963_0265383 | |||
| 354 | Ga0466964_0000914 | |||
| 355 | Ga0466971_0004740 | |||
| 356 | Ga0466971_0012626 | |||
| 357 | Ga0466968_0007519 | |||
| 358 | Ga0466970_0136876 | |||
| 359 | Ga0466960_0064658 | |||
| 360 | Ga0466959_0038307 | |||
| 361 | Ga0466959_0358018 | |||
| 362 | Ga0451576_0230802 | |||
| 363 | Ga0466958_0036017 | |||
| 364 | Ga0466958_0125984 | |||
| 365 | Ga0466967_0276628 | |||
| 366 | Ga0495617_000561 | |||
| 367 | Ga0495638_0000038 | |||
| 368 | Ga0495585_0000415 | |||
| 369 | Ga0495607_0000088 | |||
| 370 | Ga0495607_0076909 | |||
| 371 | Ga0495606_0000338 | |||
| 372 | Ga0495606_0002747 | |||
| 373 | Ga0495610_0001019 | |||
| 374 | Ga0495620_0000834 | |||
| 375 | Ga0495631_0003490 | |||
| 376 | Ga0495648_0001205 | |||
| 377 | Ga0495668_0001221 | |||
| 378 | Ga0495625_0002591 | |||
| 379 | Ga0495625_0074281 | |||
| 380 | Ga0495661_0000438 | |||
| 381 | Ga0495670_0058643 | |||
| 382 | Ga0495649_0000369 | |||
| 383 | Ga0496100_0055700 | |||
| 384 | Ga0496103_0038389 | |||
| 385 | Ga0496113_0077952 | |||
| 386 | Ga0496115_0000045 | |||
| 387 | Ga0496115_0002907 | |||
| 388 | Ga0496115_0004265 | |||
| 389 | Ga0496115_0246815 | |||
| 390 | Ga0496118_0016906 | |||
| 391 | Ga0496118_0052434 | |||
| 392 | Ga0496119_0209598 | |||
| 393 | Ga0496121_0001056 | |||
| 394 | Ga0496121_0085554 | |||
| 395 | Ga0496124_0000849 | |||
| 396 | Ga0496124_0058348 | |||
| 397 | Ga0496126_0000033 | |||
| 398 | Ga0496126_0141948 | |||
| 399 | Ga0496126_0338758 | |||
| 400 | Ga0501031_0106908 | |||
| 401 | Ga0501031_0145409 | |||
| 402 | Ga0501032_0004445 | |||
| 403 | Ga0501033_0009333 | |||
| 404 | Ga0501033_0080406 | |||
| 405 | Ga0501033_0156774 | |||
| 406 | Ga0501033_0284947 | |||
| 407 | Ga0501034_0005146 | |||
| 408 | Ga0501036_0293339 | |||
| 409 | Ga0501037_0004096 | |||
| 410 | Ga0501037_0115046 | |||
| 411 | Ga0501037_0370793 | |||
| 412 | Ga0501038_0000772 | |||
| 413 | Ga0501038_0234868 | |||
| 414 | Ga0501039_0004971 | |||
| 415 | Ga0501043_0002484 | |||
| 416 | Ga0501043_0022068 | |||
| 417 | Ga0501043_0036129 | |||
| 418 | Ga0501046_0309754 | |||
| 419 | Ga0501047_0015126 | |||
| 420 | Ga0501047_0016483 | |||
| 421 | Ga0501047_0055044 | |||
| 422 | Ga0501047_0098706 | |||
| 423 | Ga0501047_0809946 | |||
| 424 | Ga0501070_0074823 | |||
| 425 | Ga0501073_0007176 | |||
| 426 | Ga0501035_0013767 | |||
| 427 | Ga0501035_0017890 | |||
| 428 | Ga0501035_0034783 | |||
| 429 | Ga0501035_0252198 | |||
| 430 | Ga0501035_0580263 | |||
| 431 | Ga0501044_0074602 | |||
| 432 | Ga0501044_0118434 | |||
| 433 | Ga0501044_0143985 | |||
| 434 | Ga0501044_0314677 | |||
| 435 | Ga0501044_0484003 | |||
| 436 | Ga0500568_0000426 | |||
| 437 | Ga0466962_0016491 | |||
| 438 | Ga0466962_0016592 | |||
| 439 | 2595449503 | |||
| 440 | 2721026588 | |||
| 441 | 2735833417 | |||
| 442 | 2739730583 | |||
| 443 | 2842919810 | |||
| 444 | 2884341409 | |||
| 445 | 2884415183 | |||
| 446 | 2919130136 | |||
| 447 | 2953995109 | |||
| 448 | 2970528296 | |||
| 449 | 8021651820 | |||
| 450 | 8055620458 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zag-assembly1.cif.gz_D | cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. | 0.9132 | 18 | 58 |
| 5z81-assembly1.cif.gz_C | trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution | 0.9073 | 16 | 67 |
| 7mq9-assembly1.cif.gz_LZ | cryo-em structure of the human ssu processome, state pre-a1* | 0.9058 | 18 | 58 |
| 7oyc-assembly1.cif.gz_J2 | cryo-em structure of the xenopus egg 80s ribosome | 0.9056 | 18 | 58 |
| 7oya-assembly1.cif.gz_J2 | cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome | 0.9051 | 18 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6JNZ0_152_214_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9543 | 17 | 75 | 3.10.290.10 |
| af_Q2FY78_59_131_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9483 | 72 | 144 | 3.30.70.580 |
| af_Q8I5D3_12_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9477 | 19 | 72 | 3.10.290.10 |
| af_Q2FXH7_1_58_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9465 | 19 | 73 | 3.10.290.10 |
| af_Q2FY78_1_58_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.938 | 16 | 70 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X6CME4-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9741 | 16 | 250 |
GO:0000455
GO:0003723 GO:0160138 |
| AF-A0A1F7FID4-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9712 | 19 | 247 |
GO:0000455
GO:0003723 GO:0120159 |
| AF-A0A7W3Y5B5-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9706 | 16 | 250 |
GO:0000455
GO:0003723 GO:0120159 |
| AF-A0A527GPD1-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9704 | 64 | 249 |
GO:0001522
GO:0003723 GO:0006364 GO:0009982 GO:0140098 |
| AF-A0A2W6IED5-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9682 | 24 | 239 |
GO:0000455
GO:0003723 GO:0160138 |