F337366

General Info

Members Datasets Scaffolds Average Seq Length
225 153 450 244

Family's Representative Sequence

Representative Sequence 3300003752|Ga0055539_1006796|Ga0055539_10067962
Length 286
Sequence MSSSHIRPPASTRATPRYGLARVLSKLGVCSRSQAEKAVREGRVSVDGRPVRDPERATDPXREQIHLDGQTVAAAKRVYIALNKPRGVVVSAADERGRDTVYELLAXANLPWLGPVGRLDKASEGLLLLSNDSXWAARLTDPRHHVDKTYXVQIDAIPDQAALDRMLXGVSDKGERLAAKRVSLLRTGEKNAWLEIVLDEGRNRHIRRLLEVQGIGVLRLIRVAIGMLALAELGKGQWRHLSADEVTRLSGAKDEAAATKGTRADAPPAKSARRRDGSGQGPGRRR

Samples

Sample ID Description Type Environment
1 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
42 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
89 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
143 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
144 2734482264 Dyella sp. AD052 Isolate Unclassified
145 2739367700 Dyella sp. YR388 Isolate Unclassified
146 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
147 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
148 2884411467 Dyella sp. AD56 Isolate Rhizosphere
149 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
150 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
151 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
152 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
153 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 1.33
Isolates 5.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 0.89
Rhizoplane 3.56
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1006796 3300003752 Bacteria 1459
2 JGI24735J21928_10010635 3300002067 Bacteria 2929
3 rootH1_10051981 3300003316 Bacteria 3098
4 rootH2_10003284 3300003320 Bacteria 3037
5 rootH2_10043603 3300003320 Bacteria 12889
6 rootH2_10075064 3300003320 Bacteria 1175
7 rootL2_10072693 3300003322 Bacteria 3255
8 Ga0055527_1000073 3300003760 Bacteria 83327
9 Ga0055535_1000080 3300003761 Bacteria 108370
10 Ga0055542_1000165 3300003762 Bacteria 83314
11 Ga0055529_1000194 3300003763 Bacteria 83314
12 Ga0065165_1007890 3300005262 Bacteria 5109
13 Ga0070682_100020379 3300005337 Bacteria 3900
14 Ga0070661_100116478 3300005344 Bacteria 1999
15 Ga0070661_100543985 3300005344 Bacteria 934
16 Ga0070688_100120429 3300005365 Bacteria 1757
17 Ga0070667_100231472 3300005367 Bacteria 1648
18 Ga0070714_100003853 3300005435 Bacteria 11267
19 Ga0070663_100121500 3300005455 Bacteria 1973
20 Ga0070681_10484822 3300005458 Bacteria 1149
21 Ga0070685_10023591 3300005466 Bacteria 3370
22 Ga0068853_100109444 3300005539 Bacteria 2452
23 Ga0070696_100050887 3300005546 Bacteria 2880
24 Ga0068855_100017328 3300005563 Bacteria 8667
25 Ga0068855_100053058 3300005563 Bacteria 4771
26 Ga0068854_100003889 3300005578 Bacteria 9360
27 Ga0068856_100040930 3300005614 Bacteria 4552
28 Ga0075428_100047802 3300006844 Bacteria 4698
29 Ga0075431_100294089 3300006847 Unclassified 1642
30 Ga0105240_10029809 3300009093 Bacteria 7101
31 Ga0105240_10075095 3300009093 Bacteria 4170
32 Ga0105240_10341983 3300009093 Bacteria 1699
33 Ga0105247_10001149 3300009101 Bacteria 19614
34 Ga0105243_10028401 3300009148 Bacteria 4295
35 Ga0105237_10000348 3300009545 Bacteria 65042
36 Ga0105237_10032874 3300009545 Bacteria 5252
37 Ga0105237_10124678 3300009545 Bacteria 2570
38 Ga0105238_10595407 3300009551 Bacteria 1113
39 Ga0105239_10026188 3300010375 Bacteria 6419
40 Ga0157371_10150133 3300013102 Bacteria 1662
41 Ga0157370_10059041 3300013104 Bacteria 3646
42 Ga0157369_10027899 3300013105 Bacteria 6253
43 Ga0157374_10114658 3300013296 Bacteria 2595
44 Ga0182008_10099230 3300014497 Bacteria 1438
45 Ga0182008_10196470 3300014497 Bacteria 1025
46 Ga0157379_10179395 3300014968 Bacteria 1913
47 Ga0182006_1000476 3300015261 Bacteria 31364
48 Ga0182007_10015974 3300015262 Bacteria 2782
49 Ga0182007_10075917 3300015262 Bacteria 1102
50 Ga0182005_1000916 3300015265 Bacteria 12893
51 Ga0182005_1011808 3300015265 Bacteria 2479
52 Ga0183369_1009 3300015685 Bacteria 346348
53 Ga0183368_1004 3300015687 Bacteria 1211761
54 Ga0163161_10003168 3300017792 Bacteria 11603
55 Ga0163161_10011185 3300017792 Bacteria 6217
56 Ga0206356_10606883 3300020070 Bacteria 1762
57 Ga0206354_10379810 3300020081 Bacteria 1484
58 Ga0206353_11541756 3300020082 Bacteria 2006
59 Ga0209435_104349 3300025206 Bacteria 1605
60 Ga0209674_100175 3300025226 Bacteria 80049
61 Ga0209672_100018 3300025228 Bacteria 432924
62 Ga0209258_100024 3300025242 Bacteria 542096
63 Ga0209258_100547 3300025242 Bacteria 34006
64 Ga0209026_1000248 3300025250 Bacteria 68614
65 Ga0209026_1001250 3300025250 Bacteria 11634
66 Ga0209148_1000009 3300025254 Bacteria 1395625
67 Ga0209759_1001182 3300025256 Bacteria 16371
68 Ga0209759_1002155 3300025256 Bacteria 9040
69 Ga0209233_1001533 3300025261 Bacteria 9056
70 Ga0209455_1000029 3300025272 Bacteria 542096
71 Ga0209758_1008280 3300025297 Bacteria 6797
72 Ga0209758_1053335 3300025297 Bacteria 1390
73 Ga0207710_10021772 3300025900 Bacteria 2750
74 Ga0207647_10004415 3300025904 Bacteria 10430
75 Ga0207647_10041149 3300025904 Bacteria 2908
76 Ga0207707_10104658 3300025912 Bacteria 2473
77 Ga0207707_10394399 3300025912 Bacteria 1189
78 Ga0207695_10012435 3300025913 Bacteria 10220
79 Ga0207695_10043663 3300025913 Bacteria 4776
80 Ga0207695_10155399 3300025913 Bacteria 2222
81 Ga0207695_10281352 3300025913 Bacteria 1557
82 Ga0207671_10000167 3300025914 Bacteria 100428
83 Ga0207657_10160654 3300025919 Bacteria 1825
84 Ga0207649_10020046 3300025920 Bacteria 3828
85 Ga0207649_10157091 3300025920 Bacteria 1572
86 Ga0207664_10000103 3300025929 Bacteria 77654
87 Ga0207690_10057773 3300025932 Bacteria 2622
88 Ga0207709_10000756 3300025935 Bacteria 25515
89 Ga0207667_10000119 3300025949 Bacteria 124365
90 Ga0207667_10283178 3300025949 Bacteria 1694
91 Ga0207667_10363697 3300025949 Bacteria 1475
92 Ga0207651_10045415 3300025960 Bacteria 2947
93 Ga0207640_10000099 3300025981 Bacteria 66535
94 Ga0207640_10187526 3300025981 Bacteria 1556
95 Ga0207658_10392345 3300025986 Bacteria 1218
96 Ga0207678_10001672 3300026067 Bacteria 20361
97 Ga0207678_10216690 3300026067 Bacteria 1638
98 Ga0207702_10005905 3300026078 Bacteria 10647
99 Ga0207702_10026422 3300026078 Bacteria 4820
100 Ga0207674_10154366 3300026116 Bacteria 2251
101 Ga0268266_10104665 3300028379 Bacteria 2499
102 Ga0265331_10056312 3300031250 Bacteria 1867
103 Ga0265316_10004221 3300031344 Bacteria 14350
104 Ga0307408_100137090 3300031548 Bacteria 1916
105 Ga0265342_10138845 3300031712 Bacteria 1357
106 Ga0307412_10005369 3300031911 Bacteria 7192
107 Ga0307409_100334806 3300031995 Bacteria 1422
108 Ga0307416_100684627 3300032002 Bacteria 1113
109 Ga0395899_0000153 3300037312 Bacteria 105214
110 Ga0395899_0238232 3300037312 Bacteria 1253
111 Ga0395900_0000166 3300037418 Bacteria 107636
112 Ga0395900_0017799 3300037418 Bacteria 7254
113 Ga0395898_0000459 3300037466 Bacteria 81813
114 Ga0395898_0006284 3300037466 Bacteria 12700
115 Ga0395898_0009981 3300037466 Bacteria 9945
116 Ga0395905_0197428 3300037471 Bacteria 1887
117 Ga0395901_0460501 3300038443 Bacteria 1299
118 Ga0395901_0582919 3300038443 Bacteria 1130
119 Ga0395901_0914295 3300038443 Bacteria 858
120 Ga0439436_0000079 3300041404 Bacteria 24531
121 Ga0451793_1492321 3300041452 Bacteria 3809
122 Ga0466982_0000009 3300044672 Bacteria 221166
123 Ga0466966_0005089 3300044684 Bacteria 8640
124 Ga0466966_0014173 3300044684 Bacteria 5277
125 Ga0466961_0019968 3300044693 Bacteria 4311
126 Ga0466961_0050895 3300044693 Bacteria 2645
127 Ga0466961_0066117 3300044693 Bacteria 2297
128 Ga0466963_0265383 3300044694 Bacteria 1206
129 Ga0466964_0000914 3300044706 Bacteria 9701
130 Ga0466971_0004740 3300044719 Bacteria 5883
131 Ga0466971_0012626 3300044719 Bacteria 3705
132 Ga0466968_0007519 3300044735 Bacteria 4146
133 Ga0466970_0136876 3300044765 Bacteria 1347
134 Ga0466960_0064658 3300044901 Bacteria 1804
135 Ga0466959_0038307 3300045049 Bacteria 3542
136 Ga0466959_0358018 3300045049 Bacteria 994
137 Ga0451576_0230802 3300045051 Unclassified 1933
138 Ga0466958_0036017 3300045836 Bacteria 2960
139 Ga0466958_0125984 3300045836 Bacteria 1606
140 Ga0466967_0276628 3300045976 Bacteria 1610
141 Ga0495617_000561 3300046452 Bacteria 19091
142 Ga0495638_0000038 3300046460 Bacteria 249534
143 Ga0495585_0000415 3300046492 Bacteria 41233
144 Ga0495607_0000088 3300046501 Bacteria 95203
145 Ga0495607_0076909 3300046501 Bacteria 1845
146 Ga0495606_0000338 3300046507 Bacteria 80898
147 Ga0495606_0002747 3300046507 Bacteria 19749
148 Ga0495610_0001019 3300046512 Bacteria 25815
149 Ga0495620_0000834 3300046515 Bacteria 19044
150 Ga0495631_0003490 3300046518 Bacteria 8595
151 Ga0495648_0001205 3300046524 Bacteria 25909
152 Ga0495668_0001221 3300046616 Bacteria 25971
153 Ga0495625_0002591 3300046660 Bacteria 19361
154 Ga0495625_0074281 3300046660 Bacteria 2382
155 Ga0495661_0000438 3300046665 Bacteria 44026
156 Ga0495670_0058643 3300046691 Bacteria 1932
157 Ga0495649_0000369 3300046694 Bacteria 38901
158 Ga0496100_0055700 3300048903 Bacteria 2584
159 Ga0496103_0038389 3300048906 Bacteria 2938
160 Ga0496113_0077952 3300048916 Bacteria 2535
161 Ga0496115_0000045 3300048918 Bacteria 113665
162 Ga0496115_0002907 3300048918 Bacteria 12359
163 Ga0496115_0004265 3300048918 Bacteria 10344
164 Ga0496115_0246815 3300048918 Bacteria 1470
165 Ga0496118_0016906 3300048921 Bacteria 6663
166 Ga0496118_0052434 3300048921 Bacteria 3111
167 Ga0496119_0209598 3300048922 Bacteria 1003
168 Ga0496121_0001056 3300048924 Bacteria 48851
169 Ga0496121_0085554 3300048924 Bacteria 2481
170 Ga0496124_0000849 3300048927 Bacteria 49858
171 Ga0496124_0058348 3300048927 Bacteria 3247
172 Ga0496126_0000033 3300048929 Bacteria 368851
173 Ga0496126_0141948 3300048929 Bacteria 2066
174 Ga0496126_0338758 3300048929 Bacteria 1232
175 Ga0501031_0106908 3300049568 Bacteria 1826
176 Ga0501031_0145409 3300049568 Bacteria 1549
177 Ga0501032_0004445 3300049569 Bacteria 10569
178 Ga0501033_0009333 3300049570 Bacteria 7553
179 Ga0501033_0080406 3300049570 Bacteria 2391
180 Ga0501033_0156774 3300049570 Bacteria 1640
181 Ga0501033_0284947 3300049570 Bacteria 1166
182 Ga0501034_0005146 3300049571 Bacteria 14350
183 Ga0501036_0293339 3300049572 Bacteria 1360
184 Ga0501037_0004096 3300049573 Bacteria 10570
185 Ga0501037_0115046 3300049573 Bacteria 1936
186 Ga0501037_0370793 3300049573 Bacteria 985
187 Ga0501038_0000772 3300049574 Bacteria 28412
188 Ga0501038_0234868 3300049574 Bacteria 1457
189 Ga0501039_0004971 3300049575 Bacteria 10089
190 Ga0501043_0002484 3300049579 Bacteria 15597
191 Ga0501043_0022068 3300049579 Bacteria 4995
192 Ga0501043_0036129 3300049579 Bacteria 3886
193 Ga0501046_0309754 3300049580 Bacteria 1152
194 Ga0501047_0015126 3300049581 Bacteria 7346
195 Ga0501047_0016483 3300049581 Bacteria 7053
196 Ga0501047_0055044 3300049581 Bacteria 3847
197 Ga0501047_0098706 3300049581 Bacteria 2799
198 Ga0501047_0809946 3300049581 Bacteria 751
199 Ga0501070_0074823 3300049586 Bacteria 2804
200 Ga0501073_0007176 3300049589 Bacteria 8299
201 Ga0501035_0013767 3300049822 Bacteria 7466
202 Ga0501035_0017890 3300049822 Bacteria 6538
203 Ga0501035_0034783 3300049822 Bacteria 4577
204 Ga0501035_0252198 3300049822 Bacteria 1498
205 Ga0501035_0580263 3300049822 Bacteria 916
206 Ga0501044_0074602 3300049823 Bacteria 3445
207 Ga0501044_0118434 3300049823 Bacteria 2651
208 Ga0501044_0143985 3300049823 Bacteria 2370
209 Ga0501044_0314677 3300049823 Bacteria 1491
210 Ga0501044_0484003 3300049823 Bacteria 1140
211 Ga0500568_0000426 3300053139 Bacteria 31866
212 Ga0466962_0016491 3300061719 Bacteria 3563
213 Ga0466962_0016592 3300061719 Bacteria 3551
214 2595449503 2593339239 Bacteria 4124669
215 2721026588 2718218334 Bacteria 4765486
216 2735833417 2734482264 Unclassified 5014763
217 2739730583 2739367700 Bacteria 4747630
218 2842919810 2842918807 Bacteria 4289178
219 2884341409 2884338543 Bacteria 4610696
220 2884415183 2884411467 Bacteria 5246714
221 2919130136 2919130084 Bacteria 5301837
222 2953995109 2953994433 Bacteria 4303959
223 2970528296 2970524798 Bacteria 6840927
224 8021651820 8021648035 Bacteria 4772378
225 8055620458 8055617313 Bacteria 7548464
226 Ga0055539_1006796
227 JGI24735J21928_10010635
228 rootH1_10051981
229 rootH2_10003284
230 rootH2_10043603
231 rootH2_10075064
232 rootL2_10072693
233 Ga0055527_1000073
234 Ga0055535_1000080
235 Ga0055542_1000165
236 Ga0055529_1000194
237 Ga0065165_1007890
238 Ga0070682_100020379
239 Ga0070661_100116478
240 Ga0070661_100543985
241 Ga0070688_100120429
242 Ga0070667_100231472
243 Ga0070714_100003853
244 Ga0070663_100121500
245 Ga0070681_10484822
246 Ga0070685_10023591
247 Ga0068853_100109444
248 Ga0070696_100050887
249 Ga0068855_100017328
250 Ga0068855_100053058
251 Ga0068854_100003889
252 Ga0068856_100040930
253 Ga0075428_100047802
254 Ga0075431_100294089
255 Ga0105240_10029809
256 Ga0105240_10075095
257 Ga0105240_10341983
258 Ga0105247_10001149
259 Ga0105243_10028401
260 Ga0105237_10000348
261 Ga0105237_10032874
262 Ga0105237_10124678
263 Ga0105238_10595407
264 Ga0105239_10026188
265 Ga0157371_10150133
266 Ga0157370_10059041
267 Ga0157369_10027899
268 Ga0157374_10114658
269 Ga0182008_10099230
270 Ga0182008_10196470
271 Ga0157379_10179395
272 Ga0182006_1000476
273 Ga0182007_10015974
274 Ga0182007_10075917
275 Ga0182005_1000916
276 Ga0182005_1011808
277 Ga0183369_1009
278 Ga0183368_1004
279 Ga0163161_10003168
280 Ga0163161_10011185
281 Ga0206356_10606883
282 Ga0206354_10379810
283 Ga0206353_11541756
284 Ga0209435_104349
285 Ga0209674_100175
286 Ga0209672_100018
287 Ga0209258_100024
288 Ga0209258_100547
289 Ga0209026_1000248
290 Ga0209026_1001250
291 Ga0209148_1000009
292 Ga0209759_1001182
293 Ga0209759_1002155
294 Ga0209233_1001533
295 Ga0209455_1000029
296 Ga0209758_1008280
297 Ga0209758_1053335
298 Ga0207710_10021772
299 Ga0207647_10004415
300 Ga0207647_10041149
301 Ga0207707_10104658
302 Ga0207707_10394399
303 Ga0207695_10012435
304 Ga0207695_10043663
305 Ga0207695_10155399
306 Ga0207695_10281352
307 Ga0207671_10000167
308 Ga0207657_10160654
309 Ga0207649_10020046
310 Ga0207649_10157091
311 Ga0207664_10000103
312 Ga0207690_10057773
313 Ga0207709_10000756
314 Ga0207667_10000119
315 Ga0207667_10283178
316 Ga0207667_10363697
317 Ga0207651_10045415
318 Ga0207640_10000099
319 Ga0207640_10187526
320 Ga0207658_10392345
321 Ga0207678_10001672
322 Ga0207678_10216690
323 Ga0207702_10005905
324 Ga0207702_10026422
325 Ga0207674_10154366
326 Ga0268266_10104665
327 Ga0265331_10056312
328 Ga0265316_10004221
329 Ga0307408_100137090
330 Ga0265342_10138845
331 Ga0307412_10005369
332 Ga0307409_100334806
333 Ga0307416_100684627
334 Ga0395899_0000153
335 Ga0395899_0238232
336 Ga0395900_0000166
337 Ga0395900_0017799
338 Ga0395898_0000459
339 Ga0395898_0006284
340 Ga0395898_0009981
341 Ga0395905_0197428
342 Ga0395901_0460501
343 Ga0395901_0582919
344 Ga0395901_0914295
345 Ga0439436_0000079
346 Ga0451793_1492321
347 Ga0466982_0000009
348 Ga0466966_0005089
349 Ga0466966_0014173
350 Ga0466961_0019968
351 Ga0466961_0050895
352 Ga0466961_0066117
353 Ga0466963_0265383
354 Ga0466964_0000914
355 Ga0466971_0004740
356 Ga0466971_0012626
357 Ga0466968_0007519
358 Ga0466970_0136876
359 Ga0466960_0064658
360 Ga0466959_0038307
361 Ga0466959_0358018
362 Ga0451576_0230802
363 Ga0466958_0036017
364 Ga0466958_0125984
365 Ga0466967_0276628
366 Ga0495617_000561
367 Ga0495638_0000038
368 Ga0495585_0000415
369 Ga0495607_0000088
370 Ga0495607_0076909
371 Ga0495606_0000338
372 Ga0495606_0002747
373 Ga0495610_0001019
374 Ga0495620_0000834
375 Ga0495631_0003490
376 Ga0495648_0001205
377 Ga0495668_0001221
378 Ga0495625_0002591
379 Ga0495625_0074281
380 Ga0495661_0000438
381 Ga0495670_0058643
382 Ga0495649_0000369
383 Ga0496100_0055700
384 Ga0496103_0038389
385 Ga0496113_0077952
386 Ga0496115_0000045
387 Ga0496115_0002907
388 Ga0496115_0004265
389 Ga0496115_0246815
390 Ga0496118_0016906
391 Ga0496118_0052434
392 Ga0496119_0209598
393 Ga0496121_0001056
394 Ga0496121_0085554
395 Ga0496124_0000849
396 Ga0496124_0058348
397 Ga0496126_0000033
398 Ga0496126_0141948
399 Ga0496126_0338758
400 Ga0501031_0106908
401 Ga0501031_0145409
402 Ga0501032_0004445
403 Ga0501033_0009333
404 Ga0501033_0080406
405 Ga0501033_0156774
406 Ga0501033_0284947
407 Ga0501034_0005146
408 Ga0501036_0293339
409 Ga0501037_0004096
410 Ga0501037_0115046
411 Ga0501037_0370793
412 Ga0501038_0000772
413 Ga0501038_0234868
414 Ga0501039_0004971
415 Ga0501043_0002484
416 Ga0501043_0022068
417 Ga0501043_0036129
418 Ga0501046_0309754
419 Ga0501047_0015126
420 Ga0501047_0016483
421 Ga0501047_0055044
422 Ga0501047_0098706
423 Ga0501047_0809946
424 Ga0501070_0074823
425 Ga0501073_0007176
426 Ga0501035_0013767
427 Ga0501035_0017890
428 Ga0501035_0034783
429 Ga0501035_0252198
430 Ga0501035_0580263
431 Ga0501044_0074602
432 Ga0501044_0118434
433 Ga0501044_0143985
434 Ga0501044_0314677
435 Ga0501044_0484003
436 Ga0500568_0000426
437 Ga0466962_0016491
438 Ga0466962_0016592
439 2595449503
440 2721026588
441 2735833417
442 2739730583
443 2842919810
444 2884341409
445 2884415183
446 2919130136
447 2953995109
448 2970528296
449 8021651820
450 8055620458

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

78

212

0.95

PF01479

S4

S4 domain

19

59

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zag-assembly1.cif.gz_D cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. 0.9132 18 58
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.9073 16 67
7mq9-assembly1.cif.gz_LZ cryo-em structure of the human ssu processome, state pre-a1* 0.9058 18 58
7oyc-assembly1.cif.gz_J2 cryo-em structure of the xenopus egg 80s ribosome 0.9056 18 58
7oya-assembly1.cif.gz_J2 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.9051 18 58
ID Description Score Start End Superfamily
af_A0A1D6JNZ0_152_214_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9543 17 75 3.10.290.10
af_Q2FY78_59_131_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9483 72 144 3.30.70.580
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9477 19 72 3.10.290.10
af_Q2FXH7_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9465 19 73 3.10.290.10
af_Q2FY78_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.938 16 70 3.10.290.10
ID Description Score Start End GO Terms
AF-X6CME4-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9741 16 250 GO:0000455
GO:0003723
GO:0160138
AF-A0A1F7FID4-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9712 19 247 GO:0000455
GO:0003723
GO:0120159
AF-A0A7W3Y5B5-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9706 16 250 GO:0000455
GO:0003723
GO:0120159
AF-A0A527GPD1-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9704 64 249 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A2W6IED5-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9682 24 239 GO:0000455
GO:0003723
GO:0160138

Map