F337385

General Info

Members Datasets Scaffolds Average Seq Length
225 161 450 226

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1024744|Ga0065165_10247442
Length 232
Sequence VNELIGRVFSFEKQVFPNQSALYSKLVADGQSPKALMISCADSRVVPEHIMQAAPGDLFVCRNAGNIVPTYATANGGVTSTVEYAVMALGIRDIIVCGHSDCGAMKGLAGDPAKLESMPNVAAWLRHGAAARQVVDQSYPEMDEAARVRAISLENVVAQLAHLRTHPSVAAGIARGEIALHGWFVDISAGVMLGLDGTTGRFVTIREDRPLPVALPAAQRLATDFELAEAAE

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
27 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
28 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
29 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
60 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
63 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
64 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
65 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
70 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
71 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
72 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
73 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
125 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
136 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
142 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
145 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
146 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
149 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
150 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
151 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
152 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
153 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
154 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
155 2818991436 Collimonas arenae 515 Isolate Unclassified
156 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
157 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
158 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
159 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
160 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
161 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 1.78
Isolates 5.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.56
Nodule 0
Rhizoplane 1.33
Rhizosphere 60.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1024744 3300005262 Bacteria 2011
2 JGI24735J21928_10006624 3300002067 Bacteria 3805
3 Ga0055537_1000888 3300003773 Bacteria 14255
4 Ga0055524_1000656 3300003775 Bacteria 24453
5 Ga0055536_1000173 3300003781 Bacteria 53972
6 Ga0055536_1002332 3300003781 Bacteria 10738
7 Ga0055536_1016468 3300003781 Bacteria 2471
8 Ga0055530_10000093 3300003791 Bacteria 77624
9 Ga0055530_10000104 3300003791 Bacteria 72163
10 Ga0055530_10000196 3300003791 Bacteria 54353
11 Ga0055530_10000843 3300003791 Bacteria 25283
12 Ga0055540_1000218 3300003792 Bacteria 54199
13 Ga0055531_10000846 3300003794 Bacteria 25256
14 Ga0055531_10002304 3300003794 Bacteria 12895
15 Ga0055531_10006031 3300003794 Bacteria 6952
16 Ga0055531_10020685 3300003794 Bacteria 2590
17 Ga0055543_1008724 3300004625 Bacteria 2226
18 Ga0055543_1012501 3300004625 Bacteria 1705
19 Ga0065165_1000490 3300005262 Bacteria 61094
20 Ga0065165_1001018 3300005262 Bacteria 34062
21 Ga0065165_1001926 3300005262 Bacteria 19811
22 Ga0065165_1013306 3300005262 Bacteria 3281
23 Ga0070659_100012453 3300005366 Bacteria 6306
24 Ga0070659_100125089 3300005366 Bacteria 2086
25 Ga0070662_100127859 3300005457 Bacteria 1955
26 Ga0068857_100006907 3300005577 Bacteria 9773
27 Ga0068857_100073234 3300005577 Bacteria 3052
28 Ga0068859_100090534 3300005617 Bacteria 3110
29 Ga0068863_100007873 3300005841 Bacteria 10421
30 Ga0068860_100019256 3300005843 Bacteria 6625
31 Ga0068862_100000099 3300005844 Bacteria 103870
32 Ga0068862_100065791 3300005844 Bacteria 3122
33 Ga0075366_10119051 3300006195 Bacteria 1591
34 Ga0075429_100187152 3300006880 Bacteria 1814
35 Ga0097620_100090532 3300006931 Bacteria 3110
36 Ga0105240_10006523 3300009093 Bacteria 17133
37 Ga0105247_10001929 3300009101 Bacteria 14453
38 Ga0105248_10072090 3300009177 Bacteria 3882
39 Ga0105237_10030171 3300009545 Bacteria 5509
40 Ga0105249_10000053 3300009553 Bacteria 168010
41 Ga0157369_10051850 3300013105 Bacteria 4440
42 Ga0183363_1002 3300015690 Bacteria 425040
43 Ga0183361_10004 3300016635 Bacteria 484183
44 Ga0183361_10127 3300016635 Bacteria 2494
45 Ga0209646_1017237 3300025246 Bacteria 1067
46 Ga0209565_1000030 3300025263 Bacteria 325058
47 Ga0209673_1002155 3300025273 Bacteria 14588
48 Ga0209675_1000132 3300025291 Bacteria 102062
49 Ga0209676_1000021 3300025292 Bacteria 609534
50 Ga0209676_1000085 3300025292 Bacteria 273425
51 Ga0209676_1000118 3300025292 Bacteria 201939
52 Ga0209676_1000281 3300025292 Bacteria 105894
53 Ga0209564_1000283 3300025295 Bacteria 102740
54 Ga0209758_1000331 3300025297 Bacteria 88922
55 Ga0209050_1000010 3300025298 Bacteria 980454
56 Ga0209050_1000107 3300025298 Bacteria 223303
57 Ga0209050_1000115 3300025298 Bacteria 204622
58 Ga0209050_1000130 3300025298 Bacteria 186070
59 Ga0209050_1017894 3300025298 Bacteria 2792
60 Ga0209256_1000046 3300025299 Bacteria 325040
61 Ga0209051_1000090 3300025303 Bacteria 173748
62 Ga0209257_1000009 3300025304 Bacteria 1205047
63 Ga0209257_1000059 3300025304 Bacteria 378097
64 Ga0209257_1000113 3300025304 Bacteria 233523
65 Ga0209257_1000160 3300025304 Bacteria 177175
66 Ga0207710_10001722 3300025900 Bacteria 10581
67 Ga0207647_10020133 3300025904 Bacteria 4478
68 Ga0207647_10076993 3300025904 Bacteria 2006
69 Ga0207671_10036693 3300025914 Bacteria 3636
70 Ga0207690_10008411 3300025932 Bacteria 6128
71 Ga0207690_10013349 3300025932 Bacteria 4936
72 Ga0207706_10004547 3300025933 Bacteria 13019
73 Ga0207706_10035850 3300025933 Bacteria 4408
74 Ga0207711_10508130 3300025941 Bacteria 1123
75 Ga0207712_10000045 3300025961 Bacteria 168093
76 Ga0207668_10001676 3300025972 Bacteria 12954
77 Ga0207641_10001495 3300026088 Bacteria 22870
78 Ga0207674_10011677 3300026116 Bacteria 9861
79 Ga0207675_100000238 3300026118 Bacteria 52185
80 Ga0268265_10000084 3300028380 Bacteria 119522
81 Ga0268265_10007701 3300028380 Bacteria 7267
82 Ga0265338_10000790 3300028800 Bacteria 53601
83 Ga0265327_10145823 3300031251 Bacteria 1103
84 Ga0307513_10087742 3300031456 Bacteria 3182
85 Ga0307408_100049875 3300031548 Bacteria 3008
86 Ga0307406_10145783 3300031901 Bacteria 1682
87 Ga0307406_10277370 3300031901 Bacteria 1277
88 Ga0307412_10012236 3300031911 Bacteria 4993
89 Ga0307412_10034326 3300031911 Bacteria 3233
90 Ga0307412_10070904 3300031911 Bacteria 2377
91 Ga0307414_10012026 3300032004 Bacteria 5103
92 Ga0307414_10174290 3300032004 Bacteria 1723
93 Ga0307414_10390845 3300032004 Bacteria 1205
94 Ga0307414_10422326 3300032004 Bacteria 1163
95 Ga0307411_10200399 3300032005 Bacteria 1532
96 Ga0439439_0007341 3300041406 Bacteria 2576
97 Ga0439439_0045259 3300041406 Bacteria 1147
98 Ga0439461_0001797 3300041410 Bacteria 3368
99 Ga0439461_0003462 3300041410 Bacteria 2597
100 Ga0439465_0001898 3300041413 Bacteria 6848
101 Ga0439465_0003205 3300041413 Bacteria 5334
102 Ga0451807_0480870 3300041486 Bacteria 1418
103 Ga0451841_1053965 3300041498 Bacteria 902
104 Ga0439431_0000067 3300041997 Bacteria 16625
105 Ga0439431_0053084 3300041997 Bacteria 1054
106 Ga0439431_0085048 3300041997 Bacteria 856
107 Ga0439442_004135 3300042002 Bacteria 2879
108 Ga0439445_0016004 3300042004 Bacteria 1841
109 Ga0439445_0016081 3300042004 Bacteria 1837
110 Ga0439445_0036688 3300042004 Bacteria 1290
111 Ga0439448_0002503 3300042005 Bacteria 5003
112 Ga0439448_0046975 3300042005 Bacteria 1407
113 Ga0439432_003488 3300042006 Bacteria 5830
114 Ga0439432_021815 3300042006 Bacteria 2119
115 Ga0439455_0000426 3300042012 Bacteria 5662
116 Ga0439455_0007275 3300042012 Bacteria 2336
117 Ga0439457_014271 3300042014 Bacteria 1779
118 Ga0439462_0013818 3300042015 Bacteria 2072
119 Ga0450919_010379 3300042121 Bacteria 1065
120 Ga0450920_050825 3300042122 Bacteria 831
121 Ga0439446_0009215 3300042156 Bacteria 2637
122 Ga0439446_0018639 3300042156 Bacteria 1946
123 Ga0439458_0000980 3300042157 Bacteria 7301
124 Ga0439434_0000016 3300042435 Bacteria 43780
125 Ga0439434_0008043 3300042435 Bacteria 3091
126 Ga0495592_0019976 3300046454 Bacteria 5093
127 Ga0495638_0000011 3300046460 Bacteria 442453
128 Ga0495638_0000338 3300046460 Bacteria 59064
129 Ga0495638_0005738 3300046460 Bacteria 9140
130 Ga0495651_0058937 3300046462 Bacteria 2945
131 Ga0495653_0043082 3300046463 Bacteria 3511
132 Ga0495662_0367818 3300046476 Bacteria 706
133 Ga0495583_0000251 3300046506 Bacteria 88803
134 Ga0495610_0015675 3300046512 Bacteria 4395
135 Ga0495616_0000010 3300046513 Bacteria 224378
136 Ga0495618_0125688 3300046514 Bacteria 1642
137 Ga0495628_0432680 3300046516 Bacteria 957
138 Ga0495631_0255734 3300046518 Bacteria 746
139 Ga0495637_0014289 3300046520 Bacteria 3747
140 Ga0495637_0061894 3300046520 Bacteria 1533
141 Ga0495643_0032224 3300046522 Bacteria 2911
142 Ga0495648_0000036 3300046524 Bacteria 195997
143 Ga0495648_0020997 3300046524 Bacteria 4536
144 Ga0495663_0014283 3300046525 Bacteria 2225
145 Ga0495652_0087198 3300046529 Bacteria 2560
146 Ga0495654_0012761 3300046530 Bacteria 4510
147 Ga0495633_0017472 3300046558 Bacteria 3667
148 Ga0495668_0000002 3300046616 Bacteria 763179
149 Ga0495668_0011246 3300046616 Bacteria 5370
150 Ga0495625_0001439 3300046660 Bacteria 28948
151 Ga0495625_0120006 3300046660 Bacteria 1790
152 Ga0495599_0018584 3300046678 Bacteria 4330
153 Ga0495670_0000002 3300046691 Bacteria 601814
154 Ga0495671_0000054 3300046692 Bacteria 115885
155 Ga0495600_0039941 3300046809 Bacteria 3055
156 Ga0495660_0032790 3300046810 Bacteria 2916
157 Ga0495672_0149845 3300047320 Bacteria 1210
158 Ga0495687_000064 3300047443 Bacteria 163468
159 Ga0495673_0000158 3300047469 Bacteria 116122
160 Ga0495673_0010024 3300047469 Bacteria 5190
161 Ga0495686_0000971 3300047472 Bacteria 35272
162 Ga0495686_0005888 3300047472 Bacteria 9557
163 Ga0495686_0022522 3300047472 Bacteria 4169
164 Ga0495686_0026704 3300047472 Bacteria 3777
165 Ga0495602_0052512 3300048088 Bacteria 3619
166 Ga0496111_0312481 3300048914 Bacteria 1164
167 Ga0496117_0017336 3300048920 Bacteria 6018
168 Ga0496118_0001279 3300048921 Bacteria 38491
169 Ga0496121_0029416 3300048924 Bacteria 5079
170 Ga0496121_0413437 3300048924 Bacteria 880
171 Ga0496122_0001301 3300048925 Bacteria 41201
172 Ga0496123_0002730 3300048926 Bacteria 21167
173 Ga0496123_0077428 3300048926 Bacteria 2042
174 Ga0496123_0093015 3300048926 Bacteria 1782
175 Ga0496124_0016701 3300048927 Bacteria 6963
176 Ga0496124_0022716 3300048927 Bacteria 5744
177 Ga0496125_0265398 3300048928 Bacteria 1073
178 Ga0496126_0087245 3300048929 Bacteria 2749
179 Ga0501306_011500 3300049127 Bacteria 1130
180 Ga0501305_018955 3300049161 Bacteria 1000
181 Ga0501307_020332 3300049162 Bacteria 858
182 Ga0501312_006443 3300049528 Bacteria 1465
183 Ga0501032_0013045 3300049569 Bacteria 5918
184 Ga0501043_0005469 3300049579 Bacteria 10267
185 Ga0501046_0166965 3300049580 Bacteria 1653
186 Ga0501047_0000307 3300049581 Bacteria 56284
187 Ga0501224_010564 3300049664 Bacteria 1354
188 Ga0501249_000146 3300049679 Bacteria 22102
189 Ga0501035_0075789 3300049822 Bacteria 2975
190 Ga0501044_0091122 3300049823 Bacteria 3075
191 nmdc:mga0k408_208178_c1 3300050493 Bacteria 1168
192 nmdc:mga09592_236717_c1 3300050508 Bacteria 1582
193 Ga0495601_0020209 3300053077 Bacteria 4066
194 Ga0500643_000099 3300053087 Bacteria 91714
195 Ga0500651_0017727 3300053093 Bacteria 4400
196 Ga0500566_0001447 3300053094 Bacteria 13913
197 Ga0500562_021626 3300053108 Bacteria 1675
198 Ga0500597_005024 3300053120 Bacteria 4200
199 Ga0500618_000066 3300053125 Bacteria 89937
200 Ga0500658_0005644 3300053134 Bacteria 4655
201 Ga0500559_0001750 3300053136 Bacteria 11908
202 Ga0500568_0000530 3300053139 Bacteria 28219
203 Ga0500573_0011314 3300053140 Bacteria 4992
204 Ga0500574_006610 3300053141 Bacteria 2347
205 Ga0500604_0000699 3300053151 Bacteria 9200
206 Ga0500616_0003506 3300053153 Bacteria 11926
207 Ga0500616_0171888 3300053153 Bacteria 983
208 Ga0500624_000016 3300053157 Bacteria 134804
209 Ga0500627_0000398 3300053158 Bacteria 11691
210 Ga0500634_0072698 3300053161 Bacteria 1795
211 Ga0500637_0000007 3300053178 Bacteria 93788
212 Ga0500661_000218 3300055283 Bacteria 10311
213 2600203318 2599185354 Bacteria 4398675
214 2643727781 2643221541 Bacteria 5498788
215 2644043269 2643221606 Bacteria 5588032
216 2644128324 2643221622 Bacteria 4212502
217 2644395300 2643221671 Bacteria 5496681
218 2753765951 2751185897 Bacteria 5322941
219 2819544060 2818991436 Bacteria 5376622
220 2819712595 2818991466 Bacteria 4748179
221 2852655050 2852653556 Bacteria 4050083
222 2852683761 2852680915 Bacteria 4100189
223 2879166779 2879163058 Bacteria 4223965
224 2928969324 2928968154 Bacteria 4633371
225 2984290967 2984286254 Bacteria 6702062
226 Ga0065165_1024744
227 JGI24735J21928_10006624
228 Ga0055537_1000888
229 Ga0055524_1000656
230 Ga0055536_1000173
231 Ga0055536_1002332
232 Ga0055536_1016468
233 Ga0055530_10000093
234 Ga0055530_10000104
235 Ga0055530_10000196
236 Ga0055530_10000843
237 Ga0055540_1000218
238 Ga0055531_10000846
239 Ga0055531_10002304
240 Ga0055531_10006031
241 Ga0055531_10020685
242 Ga0055543_1008724
243 Ga0055543_1012501
244 Ga0065165_1000490
245 Ga0065165_1001018
246 Ga0065165_1001926
247 Ga0065165_1013306
248 Ga0070659_100012453
249 Ga0070659_100125089
250 Ga0070662_100127859
251 Ga0068857_100006907
252 Ga0068857_100073234
253 Ga0068859_100090534
254 Ga0068863_100007873
255 Ga0068860_100019256
256 Ga0068862_100000099
257 Ga0068862_100065791
258 Ga0075366_10119051
259 Ga0075429_100187152
260 Ga0097620_100090532
261 Ga0105240_10006523
262 Ga0105247_10001929
263 Ga0105248_10072090
264 Ga0105237_10030171
265 Ga0105249_10000053
266 Ga0157369_10051850
267 Ga0183363_1002
268 Ga0183361_10004
269 Ga0183361_10127
270 Ga0209646_1017237
271 Ga0209565_1000030
272 Ga0209673_1002155
273 Ga0209675_1000132
274 Ga0209676_1000021
275 Ga0209676_1000085
276 Ga0209676_1000118
277 Ga0209676_1000281
278 Ga0209564_1000283
279 Ga0209758_1000331
280 Ga0209050_1000010
281 Ga0209050_1000107
282 Ga0209050_1000115
283 Ga0209050_1000130
284 Ga0209050_1017894
285 Ga0209256_1000046
286 Ga0209051_1000090
287 Ga0209257_1000009
288 Ga0209257_1000059
289 Ga0209257_1000113
290 Ga0209257_1000160
291 Ga0207710_10001722
292 Ga0207647_10020133
293 Ga0207647_10076993
294 Ga0207671_10036693
295 Ga0207690_10008411
296 Ga0207690_10013349
297 Ga0207706_10004547
298 Ga0207706_10035850
299 Ga0207711_10508130
300 Ga0207712_10000045
301 Ga0207668_10001676
302 Ga0207641_10001495
303 Ga0207674_10011677
304 Ga0207675_100000238
305 Ga0268265_10000084
306 Ga0268265_10007701
307 Ga0265338_10000790
308 Ga0265327_10145823
309 Ga0307513_10087742
310 Ga0307408_100049875
311 Ga0307406_10145783
312 Ga0307406_10277370
313 Ga0307412_10012236
314 Ga0307412_10034326
315 Ga0307412_10070904
316 Ga0307414_10012026
317 Ga0307414_10174290
318 Ga0307414_10390845
319 Ga0307414_10422326
320 Ga0307411_10200399
321 Ga0439439_0007341
322 Ga0439439_0045259
323 Ga0439461_0001797
324 Ga0439461_0003462
325 Ga0439465_0001898
326 Ga0439465_0003205
327 Ga0451807_0480870
328 Ga0451841_1053965
329 Ga0439431_0000067
330 Ga0439431_0053084
331 Ga0439431_0085048
332 Ga0439442_004135
333 Ga0439445_0016004
334 Ga0439445_0016081
335 Ga0439445_0036688
336 Ga0439448_0002503
337 Ga0439448_0046975
338 Ga0439432_003488
339 Ga0439432_021815
340 Ga0439455_0000426
341 Ga0439455_0007275
342 Ga0439457_014271
343 Ga0439462_0013818
344 Ga0450919_010379
345 Ga0450920_050825
346 Ga0439446_0009215
347 Ga0439446_0018639
348 Ga0439458_0000980
349 Ga0439434_0000016
350 Ga0439434_0008043
351 Ga0495592_0019976
352 Ga0495638_0000011
353 Ga0495638_0000338
354 Ga0495638_0005738
355 Ga0495651_0058937
356 Ga0495653_0043082
357 Ga0495662_0367818
358 Ga0495583_0000251
359 Ga0495610_0015675
360 Ga0495616_0000010
361 Ga0495618_0125688
362 Ga0495628_0432680
363 Ga0495631_0255734
364 Ga0495637_0014289
365 Ga0495637_0061894
366 Ga0495643_0032224
367 Ga0495648_0000036
368 Ga0495648_0020997
369 Ga0495663_0014283
370 Ga0495652_0087198
371 Ga0495654_0012761
372 Ga0495633_0017472
373 Ga0495668_0000002
374 Ga0495668_0011246
375 Ga0495625_0001439
376 Ga0495625_0120006
377 Ga0495599_0018584
378 Ga0495670_0000002
379 Ga0495671_0000054
380 Ga0495600_0039941
381 Ga0495660_0032790
382 Ga0495672_0149845
383 Ga0495687_000064
384 Ga0495673_0000158
385 Ga0495673_0010024
386 Ga0495686_0000971
387 Ga0495686_0005888
388 Ga0495686_0022522
389 Ga0495686_0026704
390 Ga0495602_0052512
391 Ga0496111_0312481
392 Ga0496117_0017336
393 Ga0496118_0001279
394 Ga0496121_0029416
395 Ga0496121_0413437
396 Ga0496122_0001301
397 Ga0496123_0002730
398 Ga0496123_0077428
399 Ga0496123_0093015
400 Ga0496124_0016701
401 Ga0496124_0022716
402 Ga0496125_0265398
403 Ga0496126_0087245
404 Ga0501306_011500
405 Ga0501305_018955
406 Ga0501307_020332
407 Ga0501312_006443
408 Ga0501032_0013045
409 Ga0501043_0005469
410 Ga0501046_0166965
411 Ga0501047_0000307
412 Ga0501224_010564
413 Ga0501249_000146
414 Ga0501035_0075789
415 Ga0501044_0091122
416 nmdc:mga0k408_208178_c1
417 nmdc:mga09592_236717_c1
418 Ga0495601_0020209
419 Ga0500643_000099
420 Ga0500651_0017727
421 Ga0500566_0001447
422 Ga0500562_021626
423 Ga0500597_005024
424 Ga0500618_000066
425 Ga0500658_0005644
426 Ga0500559_0001750
427 Ga0500568_0000530
428 Ga0500573_0011314
429 Ga0500574_006610
430 Ga0500604_0000699
431 Ga0500616_0003506
432 Ga0500616_0171888
433 Ga0500624_000016
434 Ga0500627_0000398
435 Ga0500634_0072698
436 Ga0500637_0000007
437 Ga0500661_000218
438 2600203318
439 2643727781
440 2644043269
441 2644128324
442 2644395300
443 2753765951
444 2819544060
445 2819712595
446 2852655050
447 2852683761
448 2879166779
449 2928969324
450 2984290967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

35

192

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5swc-assembly1.cif.gz_D the structure of the beta-carbonic anhydrase ccaa 0.9473 1 204
5swc-assembly1.cif.gz_E the structure of the beta-carbonic anhydrase ccaa 0.9393 1 207
5swc-assembly1.cif.gz_D the structure of the beta-carbonic anhydrase ccaa 0.934 1 204
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.9003 33 194
4wak-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a 0.8963 33 194
ID Description Score Start End Superfamily
5swcF00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.946 1 204 3.40.1050.10
af_P0ABE9_1_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9384 1 204 3.40.1050.10
af_P0ABE9_1_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.934 1 204 3.40.1050.10
af_A0A1D6NHQ1_7_236_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9093 4 193 3.40.1050.10
5swcF00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9033 1 204 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A7W9VIJ0-F1-model_v4 deleted 0.9711 1 223
AF-A0A258X7T3-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9684 37 219 GO:0004089
GO:0008270
GO:0015976
AF-A0A6I4TP84-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9673 1 223 GO:0004089
GO:0008270
GO:0015976
AF-A0A4Q6BRE6-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9673 1 222 GO:0004089
GO:0008270
GO:0015976
AF-A0A554UIC0-F1-model_v4 deleted 0.9641 1 222

Map