F337393

General Info

Members Datasets Scaffolds Average Seq Length
225 181 450 111

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10326401|Ga0065704_103264011
Length 114
Sequence VTSSKPARYGVLLSAGAEQDLEAIHDYIAEFDCVANANYVLDQLMEVVESLSQFPERGSYPKELVALGIKEYRQTSFKPYRVIYRVAGSQVIIYLIADGRRDMQSVLARRLLGA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
87 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
99 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
100 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
173 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
175 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
176 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
177 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
178 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
179 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
180 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
181 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0
Rhizoplane 1.78
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10326401 3300005289 Bacteria 844
2 SwRhRL3b_contig_1665328 2162886006 Bacteria 2413
3 MRS1b_contig_9332685 2162886011 Bacteria 1474
4 JGI24740J21852_10000035 3300001979 Bacteria 44922
5 rootH2_10172490 3300003320 Bacteria 3428
6 Ga0065707_10081730 3300005295 Bacteria 59162
7 Ga0068869_101698352 3300005334 Unclassified 563
8 Ga0070660_100402607 3300005339 Bacteria 1132
9 Ga0070660_101596843 3300005339 Bacteria 555
10 Ga0070668_100481187 3300005347 Bacteria 1072
11 Ga0070675_101638145 3300005354 Unclassified 594
12 Ga0070674_100091401 3300005356 Bacteria 2198
13 Ga0070674_101584497 3300005356 Bacteria 590
14 Ga0070688_100113931 3300005365 Bacteria 1802
15 Ga0070701_10819041 3300005438 Bacteria 636
16 Ga0070705_101436490 3300005440 Unclassified 576
17 Ga0070663_100170907 3300005455 Bacteria 1680
18 Ga0068867_100334268 3300005459 Bacteria 1259
19 Ga0070698_100485315 3300005471 Bacteria 1173
20 Ga0068853_100663063 3300005539 Bacteria 993
21 Ga0070672_101260314 3300005543 Bacteria 659
22 Ga0070686_100768038 3300005544 Unclassified 774
23 Ga0070665_100003659 3300005548 Bacteria 16287
24 Ga0070665_100046337 3300005548 Bacteria 4368
25 Ga0068855_100179773 3300005563 Bacteria 2392
26 Ga0068855_100799355 3300005563 Bacteria 1003
27 Ga0070664_101094750 3300005564 Unclassified 750
28 Ga0068856_100023031 3300005614 Bacteria 6056
29 Ga0070702_100504721 3300005615 Bacteria 889
30 Ga0068861_101098666 3300005719 Bacteria 764
31 Ga0068862_102397415 3300005844 Unclassified 539
32 Ga0075365_10338363 3300006038 Bacteria 1060
33 Ga0075362_10006402 3300006177 Bacteria 4389
34 Ga0075370_10002770 3300006353 Bacteria 8211
35 Ga0068865_100434169 3300006881 Bacteria 1082
36 Ga0105247_10028485 3300009101 Bacteria 3380
37 Ga0105243_10126299 3300009148 Bacteria 2164
38 Ga0105237_10371775 3300009545 Bacteria 1434
39 Ga0105249_10718821 3300009553 Bacteria 1060
40 Ga0157370_10030592 3300013104 Bacteria 5275
41 Ga0157378_11232352 3300013297 Bacteria 788
42 Ga0157375_13012217 3300013308 Bacteria 562
43 Ga0157380_10000227 3300014326 Bacteria 33644
44 Ga0157380_11434567 3300014326 Bacteria 742
45 Ga0157377_10213947 3300014745 Bacteria 1230
46 Ga0157376_11948549 3300014969 Bacteria 625
47 Ga0213872_10006423 3300021361 Bacteria 5905
48 Ga0213872_10008692 3300021361 Bacteria 4905
49 Ga0207710_10014993 3300025900 Bacteria 3273
50 Ga0207657_10276928 3300025919 Bacteria 1333
51 Ga0207690_10056273 3300025932 Bacteria 2652
52 Ga0207706_10735280 3300025933 Bacteria 841
53 Ga0207709_10152939 3300025935 Bacteria 1600
54 Ga0207669_10029328 3300025937 Bacteria 3042
55 Ga0207704_10158090 3300025938 Bacteria 1609
56 Ga0207691_10490849 3300025940 Bacteria 1043
57 Ga0207691_10616904 3300025940 Bacteria 918
58 Ga0207689_10824534 3300025942 Bacteria 783
59 Ga0207679_11948834 3300025945 Unclassified 535
60 Ga0207667_10067061 3300025949 Bacteria 3739
61 Ga0207668_10479744 3300025972 Bacteria 1066
62 Ga0207639_11334125 3300026041 Bacteria 673
63 Ga0207678_10816065 3300026067 Bacteria 824
64 Ga0207702_10186619 3300026078 Bacteria 1913
65 Ga0207674_12103987 3300026116 Unclassified 528
66 Ga0209970_1031545 3300027614 Bacteria 922
67 Ga0209983_1033556 3300027665 Bacteria 1098
68 Ga0209974_10178610 3300027876 Bacteria 777
69 Ga0268266_10025609 3300028379 Bacteria 5018
70 Ga0268266_10050419 3300028379 Bacteria 3571
71 Ga0265327_10001173 3300031251 Bacteria 35562
72 Ga0265327_10088174 3300031251 Bacteria 1518
73 Ga0307509_10508595 3300031507 Bacteria 888
74 Ga0307408_100550995 3300031548 Bacteria 1017
75 Ga0307408_100652257 3300031548 Bacteria 941
76 Ga0316575_10006896 3300031665 Bacteria 4111
77 Ga0316579_10020094 3300031691 Bacteria 2956
78 Ga0316576_10002403 3300031727 Bacteria 10628
79 Ga0316578_10018853 3300031728 Bacteria 3789
80 Ga0316577_10001141 3300031733 Bacteria 12150
81 Ga0307412_10577160 3300031911 Bacteria 948
82 Ga0307412_10614003 3300031911 Bacteria 923
83 Ga0307416_100065111 3300032002 Bacteria 2993
84 Ga0316585_10000060 3300032137 Bacteria 17679
85 Ga0316580_10005606 3300032139 Bacteria 3672
86 Ga0373934_0080752 3300035086 Bacteria 1306
87 Ga0373923_0126164 3300035111 Bacteria 1147
88 Ga0373954_0002548 3300035118 Bacteria 7648
89 Ga0373955_0150158 3300035172 Bacteria 1371
90 Ga0316574_0000004 3300035398 Bacteria 49638
91 Ga0373933_0017313 3300035724 Bacteria 4042
92 Ga0373933_0326262 3300035724 Bacteria 996
93 Ga0373937_0000786 3300036401 Bacteria 27181
94 Ga0316582_0000432 3300036647 Bacteria 15379
95 Ga0316584_0000070 3300036712 Bacteria 40891
96 Ga0436361_0019489 3300039447 Bacteria 5249
97 Ga0436361_0418957 3300039447 Bacteria 1708
98 Ga0436361_0735830 3300039447 Bacteria 5931
99 Ga0439436_0007558 3300041404 Bacteria 3344
100 Ga0439436_0044635 3300041404 Bacteria 1262
101 Ga0439439_0039237 3300041406 Bacteria 1223
102 Ga0439439_0095456 3300041406 Bacteria 815
103 Ga0439461_0061393 3300041410 Bacteria 854
104 Ga0439466_0022340 3300041411 Bacteria 2234
105 Ga0439466_0081421 3300041411 Bacteria 1021
106 Ga0451807_0077485 3300041486 Bacteria 1382
107 Ga0439431_0011768 3300041997 Bacteria 2003
108 Ga0439431_0084555 3300041997 Bacteria 859
109 Ga0439431_0192950 3300041997 Bacteria 591
110 Ga0439433_0001584 3300041999 Bacteria 4725
111 Ga0439445_0016302 3300042004 Bacteria 1826
112 Ga0439432_006764 3300042006 Bacteria 4083
113 Ga0439432_029432 3300042006 Bacteria 1785
114 Ga0439449_0004040 3300042007 Bacteria 5681
115 Ga0439449_0005417 3300042007 Bacteria 4889
116 Ga0439452_006518 3300042010 Bacteria 3654
117 Ga0439452_054284 3300042010 Bacteria 910
118 Ga0439457_029774 3300042014 Bacteria 1210
119 Ga0439457_143161 3300042014 Bacteria 572
120 Ga0439462_0007168 3300042015 Bacteria 2789
121 Ga0439462_0012763 3300042015 Bacteria 2149
122 Ga0450920_044817 3300042122 Bacteria 884
123 Ga0450921_033998 3300042123 Bacteria 528
124 Ga0450898_010192 3300042134 Bacteria 1518
125 Ga0439446_0023137 3300042156 Bacteria 1766
126 Ga0439434_0006713 3300042435 Bacteria 3363
127 Ga0450918_038621 3300042531 Bacteria 854
128 Ga0466969_0106040 3300044656 Bacteria 1319
129 Ga0453683_0495574 3300044673 Bacteria 792
130 Ga0453683_0528463 3300044673 Bacteria 767
131 Ga0466961_0582616 3300044693 Bacteria 673
132 Ga0466963_0028204 3300044694 Bacteria 3602
133 Ga0466968_0041444 3300044735 Bacteria 1943
134 Ga0466970_0015503 3300044765 Bacteria 3920
135 Ga0466957_0123411 3300044842 Bacteria 1653
136 Ga0466959_0215112 3300045049 Bacteria 1334
137 Ga0451576_0795005 3300045051 Bacteria 993
138 Ga0466967_0209286 3300045976 Bacteria 1849
139 Ga0466967_0256017 3300045976 Bacteria 1673
140 Ga0495638_0012887 3300046460 Bacteria 5712
141 Ga0495605_0073484 3300046474 Bacteria 1610
142 Ga0495584_0016342 3300046491 Bacteria 3784
143 Ga0495584_0130953 3300046491 Bacteria 1272
144 Ga0495584_0356876 3300046491 Bacteria 742
145 Ga0495585_0156837 3300046492 Bacteria 1183
146 Ga0495583_0000441 3300046506 Bacteria 62379
147 Ga0495606_0195581 3300046507 Bacteria 1156
148 Ga0495587_0536742 3300046536 Unclassified 646
149 Ga0495609_0002156 3300046538 Bacteria 12370
150 Ga0495597_0151396 3300046542 Bacteria 951
151 Ga0495645_0549277 3300046543 Bacteria 716
152 Ga0495667_0300655 3300046559 Bacteria 1017
153 Ga0495611_0077495 3300046648 Bacteria 1524
154 Ga0495611_0198378 3300046648 Bacteria 936
155 Ga0495625_0004867 3300046660 Bacteria 12520
156 Ga0495661_0078312 3300046665 Bacteria 1912
157 Ga0495661_0235341 3300046665 Bacteria 942
158 Ga0495588_0332515 3300046674 Bacteria 799
159 Ga0495657_0120723 3300046675 Bacteria 1651
160 Ga0495670_0023419 3300046691 Bacteria 3047
161 Ga0495604_0054687 3300047317 Bacteria 3079
162 Ga0495672_0157246 3300047320 Bacteria 1172
163 Ga0495676_0119807 3300047321 Unclassified 1916
164 Ga0495602_0893902 3300048088 Unclassified 591
165 Ga0496100_0062357 3300048903 Bacteria 2460
166 Ga0496108_1611360 3300048911 Bacteria 537
167 Ga0496114_0323486 3300048917 Bacteria 1363
168 Ga0496118_0014630 3300048921 Bacteria 7334
169 Ga0496118_0051942 3300048921 Bacteria 3132
170 Ga0496121_0019198 3300048924 Bacteria 6847
171 Ga0496125_0377928 3300048928 Bacteria 836
172 Ga0496126_0019765 3300048929 Bacteria 6627
173 Ga0501031_0645229 3300049568 Bacteria 680
174 Ga0501032_0034310 3300049569 Bacteria 3474
175 Ga0501032_0153330 3300049569 Bacteria 1514
176 Ga0501033_0004533 3300049570 Bacteria 11122
177 Ga0501034_0000826 3300049571 Bacteria 46024
178 Ga0501036_0157488 3300049572 Bacteria 1915
179 Ga0501036_0198661 3300049572 Bacteria 1687
180 Ga0501037_0163014 3300049573 Unclassified 1589
181 Ga0501037_0282131 3300049573 Bacteria 1157
182 Ga0501037_0373175 3300049573 Bacteria 981
183 Ga0501037_0412428 3300049573 Bacteria 925
184 Ga0501038_0080146 3300049574 Bacteria 2752
185 Ga0501038_0131064 3300049574 Bacteria 2058
186 Ga0501039_0039681 3300049575 Bacteria 3636
187 Ga0501046_0058361 3300049580 Bacteria 3026
188 Ga0501046_0058890 3300049580 Bacteria 3010
189 Ga0501068_0008166 3300049584 Bacteria 5816
190 Ga0501069_0608577 3300049585 Bacteria 656
191 Ga0501070_0023706 3300049586 Bacteria 5142
192 Ga0501070_0094030 3300049586 Bacteria 2480
193 Ga0501073_0621171 3300049589 Bacteria 746
194 Ga0501074_0081194 3300049590 Bacteria 2325
195 Ga0501075_1467388 3300049591 Bacteria 516
196 Ga0501249_185195 3300049679 Unclassified 540
197 Ga0501225_0059418 3300049705 Bacteria 1074
198 Ga0501080_0318665 3300049742 Bacteria 1408
199 Ga0501081_1205088 3300049743 Unclassified 574
200 Ga0501035_0044277 3300049822 Bacteria 4008
201 Ga0501035_0115783 3300049822 Bacteria 2346
202 Ga0501044_0015489 3300049823 Bacteria 8212
203 Ga0501044_0156514 3300049823 Bacteria 2258
204 Ga0501045_0321923 3300049824 Bacteria 1151
205 Ga0501045_0770728 3300049824 Bacteria 709
206 nmdc:mga03683_2893_c1 3300050489 Bacteria 5415
207 nmdc:mga03n38_177542_c1 3300050490 Bacteria 1089
208 nmdc:mga03n38_305647_c1 3300050490 Bacteria 855
209 nmdc:mga0yw44_732145_c1 3300050492 Bacteria 672
210 nmdc:mga0k408_188115_c1 3300050493 Bacteria 1232
211 nmdc:mga0k408_917237_c1 3300050493 Bacteria 508
212 nmdc:mga07m45_38573_c1 3300050496 Bacteria 2666
213 Ga0500595_058353 3300053119 Bacteria 1173
214 Ga0500559_0117512 3300053136 Bacteria 1235
215 Ga0500634_0075836 3300053161 Bacteria 1747
216 Ga0500609_007483 3300053731 Bacteria 1476
217 Ga0590071_002412 3300059421 Bacteria 4698
218 2526211984 2526164512 Bacteria 4025691
219 2574430287 2574179768 Bacteria 4907129
220 2739289074 2738543020 Bacteria 5718238
221 2739294386 2738543021 Bacteria 5718241
222 2891634107 2891633521 Bacteria 4602265
223 2900581903 2900577576 Bacteria 5438534
224 2901305861 2901300506 Bacteria 8463898
225 2989393729 2989392574 Bacteria 4554005
226 Ga0065704_10326401
227 SwRhRL3b_contig_1665328
228 MRS1b_contig_9332685
229 JGI24740J21852_10000035
230 rootH2_10172490
231 Ga0065707_10081730
232 Ga0068869_101698352
233 Ga0070660_100402607
234 Ga0070660_101596843
235 Ga0070668_100481187
236 Ga0070675_101638145
237 Ga0070674_100091401
238 Ga0070674_101584497
239 Ga0070688_100113931
240 Ga0070701_10819041
241 Ga0070705_101436490
242 Ga0070663_100170907
243 Ga0068867_100334268
244 Ga0070698_100485315
245 Ga0068853_100663063
246 Ga0070672_101260314
247 Ga0070686_100768038
248 Ga0070665_100003659
249 Ga0070665_100046337
250 Ga0068855_100179773
251 Ga0068855_100799355
252 Ga0070664_101094750
253 Ga0068856_100023031
254 Ga0070702_100504721
255 Ga0068861_101098666
256 Ga0068862_102397415
257 Ga0075365_10338363
258 Ga0075362_10006402
259 Ga0075370_10002770
260 Ga0068865_100434169
261 Ga0105247_10028485
262 Ga0105243_10126299
263 Ga0105237_10371775
264 Ga0105249_10718821
265 Ga0157370_10030592
266 Ga0157378_11232352
267 Ga0157375_13012217
268 Ga0157380_10000227
269 Ga0157380_11434567
270 Ga0157377_10213947
271 Ga0157376_11948549
272 Ga0213872_10006423
273 Ga0213872_10008692
274 Ga0207710_10014993
275 Ga0207657_10276928
276 Ga0207690_10056273
277 Ga0207706_10735280
278 Ga0207709_10152939
279 Ga0207669_10029328
280 Ga0207704_10158090
281 Ga0207691_10490849
282 Ga0207691_10616904
283 Ga0207689_10824534
284 Ga0207679_11948834
285 Ga0207667_10067061
286 Ga0207668_10479744
287 Ga0207639_11334125
288 Ga0207678_10816065
289 Ga0207702_10186619
290 Ga0207674_12103987
291 Ga0209970_1031545
292 Ga0209983_1033556
293 Ga0209974_10178610
294 Ga0268266_10025609
295 Ga0268266_10050419
296 Ga0265327_10001173
297 Ga0265327_10088174
298 Ga0307509_10508595
299 Ga0307408_100550995
300 Ga0307408_100652257
301 Ga0316575_10006896
302 Ga0316579_10020094
303 Ga0316576_10002403
304 Ga0316578_10018853
305 Ga0316577_10001141
306 Ga0307412_10577160
307 Ga0307412_10614003
308 Ga0307416_100065111
309 Ga0316585_10000060
310 Ga0316580_10005606
311 Ga0373934_0080752
312 Ga0373923_0126164
313 Ga0373954_0002548
314 Ga0373955_0150158
315 Ga0316574_0000004
316 Ga0373933_0017313
317 Ga0373933_0326262
318 Ga0373937_0000786
319 Ga0316582_0000432
320 Ga0316584_0000070
321 Ga0436361_0019489
322 Ga0436361_0418957
323 Ga0436361_0735830
324 Ga0439436_0007558
325 Ga0439436_0044635
326 Ga0439439_0039237
327 Ga0439439_0095456
328 Ga0439461_0061393
329 Ga0439466_0022340
330 Ga0439466_0081421
331 Ga0451807_0077485
332 Ga0439431_0011768
333 Ga0439431_0084555
334 Ga0439431_0192950
335 Ga0439433_0001584
336 Ga0439445_0016302
337 Ga0439432_006764
338 Ga0439432_029432
339 Ga0439449_0004040
340 Ga0439449_0005417
341 Ga0439452_006518
342 Ga0439452_054284
343 Ga0439457_029774
344 Ga0439457_143161
345 Ga0439462_0007168
346 Ga0439462_0012763
347 Ga0450920_044817
348 Ga0450921_033998
349 Ga0450898_010192
350 Ga0439446_0023137
351 Ga0439434_0006713
352 Ga0450918_038621
353 Ga0466969_0106040
354 Ga0453683_0495574
355 Ga0453683_0528463
356 Ga0466961_0582616
357 Ga0466963_0028204
358 Ga0466968_0041444
359 Ga0466970_0015503
360 Ga0466957_0123411
361 Ga0466959_0215112
362 Ga0451576_0795005
363 Ga0466967_0209286
364 Ga0466967_0256017
365 Ga0495638_0012887
366 Ga0495605_0073484
367 Ga0495584_0016342
368 Ga0495584_0130953
369 Ga0495584_0356876
370 Ga0495585_0156837
371 Ga0495583_0000441
372 Ga0495606_0195581
373 Ga0495587_0536742
374 Ga0495609_0002156
375 Ga0495597_0151396
376 Ga0495645_0549277
377 Ga0495667_0300655
378 Ga0495611_0077495
379 Ga0495611_0198378
380 Ga0495625_0004867
381 Ga0495661_0078312
382 Ga0495661_0235341
383 Ga0495588_0332515
384 Ga0495657_0120723
385 Ga0495670_0023419
386 Ga0495604_0054687
387 Ga0495672_0157246
388 Ga0495676_0119807
389 Ga0495602_0893902
390 Ga0496100_0062357
391 Ga0496108_1611360
392 Ga0496114_0323486
393 Ga0496118_0014630
394 Ga0496118_0051942
395 Ga0496121_0019198
396 Ga0496125_0377928
397 Ga0496126_0019765
398 Ga0501031_0645229
399 Ga0501032_0034310
400 Ga0501032_0153330
401 Ga0501033_0004533
402 Ga0501034_0000826
403 Ga0501036_0157488
404 Ga0501036_0198661
405 Ga0501037_0163014
406 Ga0501037_0282131
407 Ga0501037_0373175
408 Ga0501037_0412428
409 Ga0501038_0080146
410 Ga0501038_0131064
411 Ga0501039_0039681
412 Ga0501046_0058361
413 Ga0501046_0058890
414 Ga0501068_0008166
415 Ga0501069_0608577
416 Ga0501070_0023706
417 Ga0501070_0094030
418 Ga0501073_0621171
419 Ga0501074_0081194
420 Ga0501075_1467388
421 Ga0501249_185195
422 Ga0501225_0059418
423 Ga0501080_0318665
424 Ga0501081_1205088
425 Ga0501035_0044277
426 Ga0501035_0115783
427 Ga0501044_0015489
428 Ga0501044_0156514
429 Ga0501045_0321923
430 Ga0501045_0770728
431 nmdc:mga03683_2893_c1
432 nmdc:mga03n38_177542_c1
433 nmdc:mga03n38_305647_c1
434 nmdc:mga0yw44_732145_c1
435 nmdc:mga0k408_188115_c1
436 nmdc:mga0k408_917237_c1
437 nmdc:mga07m45_38573_c1
438 Ga0500595_058353
439 Ga0500559_0117512
440 Ga0500634_0075836
441 Ga0500609_007483
442 Ga0590071_002412
443 2526211984
444 2574430287
445 2739289074
446 2739294386
447 2891634107
448 2900581903
449 2901305861
450 2989393729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

11

103

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w2b-assembly1.cif.gz_A crystal structure of c-terminal domain of ebola (reston) nucleoprotein in complex with fab fragment 0.9392 12 40
5cze-assembly1.cif.gz_J crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9159 3 95
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9085 1 95
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.9082 3 96
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.9047 5 96
ID Description Score Start End Superfamily
af_Q5AAP8_56_244_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9159 12 46 1.20.1250.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9157 4 95 3.30.2310.20
af_O01735_368_566_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.913 15 48 1.20.1250.20
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9012 5 105 3.30.2310.20
2b5nD00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8898 65 92 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1F4ATE3-F1-model_v4 Plasmid stabilization protein 1.002 14 108
AF-A0A4Z1R5J2-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9981 1 106
AF-A0A7U6Y955-F1-model_v4 Plasmid stabilization system protein 0.9976 1 108
AF-A0A1G5QRW1-F1-model_v4 Toxin ParE1/3/4 0.9973 1 108
AF-M3A849-F1-model_v4 Plasmid stabilization system protein 0.997 25 106

Map