F337406

General Info

Members Datasets Scaffolds Average Seq Length
225 159 450 209

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10037041|Ga0070658_100370412
Length 242
Sequence VSDKISERIPSSERREQILDAASRVFGERGYFGATTDQIAKAAGISQPYVVRMFGGKENLFLGVLSRCLDRLLVAFTETLEQWKAEGSPNEPLAGYATAAGAPAGTPGDLAAPTSAGGHGEIGRRLGLAYVSLVEDRGLLLVLMQAFSMGHDPTIGAQARAGFLTIYRLLRAEAGFTPEQTRAFLAEGMLLNTLLGLRLPDSYDEDEAARELLECTFRTKLDLVLHLAAEADHGRAAGAQRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
63 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
124 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
125 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
126 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
127 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2643221549 Agromyces sp. Root1464 Isolate Unclassified
134 2643221566 Microbacterium sp. Root166 Isolate Unclassified
135 2643221572 Leifsonia sp. Root60 Isolate Unclassified
136 2643221575 Microbacterium sp. Root61 Isolate Unclassified
137 2643221613 Oerskovia sp. Root22 Isolate Unclassified
138 2643221616 Leifsonia sp. Root227 Isolate Unclassified
139 2643221619 Agromyces sp. Root81 Isolate Unclassified
140 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
141 2643221721 Oerskovia sp. Root918 Isolate Unclassified
142 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
143 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
144 2808606372 Agromyces sp. 23-23 Isolate Unclassified
145 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
146 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
147 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
148 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
149 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
150 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
151 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
152 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
153 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
154 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
155 2928153084 Leifsonia sp. 563 Isolate Unclassified
156 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
157 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
158 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
159 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.67
Metatranscriptomes 1.33
Isolates 12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.89
Nodule 0
Rhizoplane 11.11
Rhizosphere 54.22
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10037041 3300005327 Bacteria 3931
2 JGI24740J21852_10004355 3300001979 Bacteria 6095
3 JGI24735J21928_10002540 3300002067 Bacteria 6308
4 rootH2_10100994 3300003320 Bacteria 1527
5 rootL2_10257705 3300003322 Bacteria 1077
6 rootH1_10201175 3300003323 Bacteria 1007
7 Ga0006562J51391_1093522 3300003578 Bacteria 12369
8 Ga0006562J51391_1093523 3300003578 Bacteria 3850
9 Ga0055539_1000035 3300003752 Bacteria 217588
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000531 3300003759 Bacteria 18376
12 Ga0055527_1000005 3300003760 Bacteria 504776
13 Ga0055542_1000006 3300003762 Bacteria 504776
14 Ga0055529_1000334 3300003763 Bacteria 52660
15 Ga0055529_1019877 3300003763 Bacteria 838
16 Ga0070675_100862549 3300005354 Bacteria 829
17 Ga0070667_100975780 3300005367 Bacteria 790
18 Ga0070663_100105886 3300005455 Bacteria 2106
19 Ga0070672_100276058 3300005543 Bacteria 1420
20 Ga0068857_100393492 3300005577 Bacteria 1289
21 Ga0068864_100908503 3300005618 Bacteria 870
22 Ga0068870_10148559 3300005840 Bacteria 1378
23 Ga0075365_10009563 3300006038 Bacteria 5585
24 Ga0075365_10021025 3300006038 Bacteria 4062
25 Ga0075367_10168570 3300006178 Bacteria 1363
26 Ga0075369_10021665 3300006186 Bacteria 2644
27 Ga0111539_10559565 3300009094 Bacteria 1332
28 Ga0105243_10087181 3300009148 Bacteria 2562
29 Ga0105246_10684368 3300011119 Bacteria 897
30 Ga0157370_10208381 3300013104 Bacteria 1812
31 Ga0157370_10380653 3300013104 Bacteria 1300
32 Ga0157369_10182306 3300013105 Bacteria 2209
33 Ga0163162_10265356 3300013306 Bacteria 1849
34 Ga0157375_10934728 3300013308 Bacteria 1010
35 Ga0157375_11626159 3300013308 Bacteria 764
36 Ga0163163_11410689 3300014325 Bacteria 758
37 Ga0206353_10505610 3300020082 Bacteria 5497
38 Ga0209566_100055 3300025225 Bacteria 210307
39 Ga0209674_100001 3300025226 Bacteria 4013750
40 Ga0209672_100003 3300025228 Bacteria 1560476
41 Ga0209147_103577 3300025229 Bacteria 2946
42 Ga0209563_100001 3300025230 Bacteria 4013775
43 Ga0209563_100923 3300025230 Bacteria 8661
44 Ga0209677_100001 3300025253 Bacteria 4013787
45 Ga0209677_100720 3300025253 Bacteria 16852
46 Ga0209148_1000004 3300025254 Bacteria 1844481
47 Ga0209455_1000022 3300025272 Bacteria 688910
48 Ga0209455_1019403 3300025272 Bacteria 1375
49 Ga0207688_10025333 3300025901 Bacteria 3257
50 Ga0207647_10029466 3300025904 Bacteria 3553
51 Ga0207643_10027041 3300025908 Bacteria 3180
52 Ga0207705_10030344 3300025909 Bacteria 3858
53 Ga0207659_10246485 3300025926 Bacteria 1448
54 Ga0207709_10245818 3300025935 Bacteria 1304
55 Ga0207712_10636673 3300025961 Unclassified 925
56 Ga0207658_10718378 3300025986 Bacteria 904
57 Ga0207678_10282112 3300026067 Bacteria 1426
58 Ga0207676_10563214 3300026095 Bacteria 1090
59 Ga0207674_10150291 3300026116 Bacteria 2286
60 Ga0207683_10147724 3300026121 Bacteria 2121
61 Ga0307513_10427071 3300031456 Bacteria 1054
62 Ga0307407_10618388 3300031903 Bacteria 808
63 Ga0307416_100294071 3300032002 Bacteria 1610
64 Ga0307416_100458468 3300032002 Bacteria 1329
65 Ga0307414_10239686 3300032004 Bacteria 1501
66 Ga0307414_10292567 3300032004 Bacteria 1374
67 Ga0307414_10511893 3300032004 Bacteria 1064
68 Ga0307414_10771500 3300032004 Bacteria 875
69 Ga0307414_11268876 3300032004 Bacteria 683
70 Ga0307415_101009973 3300032126 Bacteria 774
71 Ga0395900_0045020 3300037418 Bacteria 4545
72 Ga0395900_0080023 3300037418 Bacteria 3358
73 Ga0395900_0248813 3300037418 Bacteria 1780
74 Ga0395900_0388150 3300037418 Bacteria 1363
75 Ga0395898_0000246 3300037466 Bacteria 135487
76 Ga0395901_0564909 3300038443 Bacteria 1151
77 Ga0439465_0108667 3300041413 Bacteria 963
78 Ga0451797_0206934 3300041453 Bacteria 900
79 Ga0451802_1036890 3300041460 Bacteria 1857
80 Ga0451853_4052207 3300041512 Bacteria 1018
81 Ga0466972_0028710 3300044658 Bacteria 2742
82 Ga0466972_0034728 3300044658 Bacteria 2469
83 Ga0466972_0206846 3300044658 Bacteria 919
84 Ga0466965_0000007 3300044683 Bacteria 131940
85 Ga0466965_0009352 3300044683 Plasmid 4554
86 Ga0466965_0016275 3300044683 Bacteria 3537
87 Ga0466965_0051075 3300044683 Bacteria 2051
88 Ga0466965_0074310 3300044683 Bacteria 1712
89 Ga0466966_0030561 3300044684 Bacteria 3496
90 Ga0466966_0171926 3300044684 Bacteria 1316
91 Ga0466966_0201059 3300044684 Bacteria 1206
92 Ga0466961_0063155 3300044693 Bacteria 2353
93 Ga0466961_0320886 3300044693 Bacteria 944
94 Ga0466964_0169038 3300044706 Bacteria 1028
95 Ga0466971_0298931 3300044719 Bacteria 773
96 Ga0466968_0005408 3300044735 Bacteria 4784
97 Ga0466968_0030768 3300044735 Bacteria 2225
98 Ga0466968_0034452 3300044735 Bacteria 2113
99 Ga0466970_0000322 3300044765 Bacteria 23272
100 Ga0466970_0018882 3300044765 Bacteria 3571
101 Ga0466970_0024474 3300044765 Bacteria 3157
102 Ga0466970_0048373 3300044765 Bacteria 2267
103 Ga0466970_0268717 3300044765 Bacteria 958
104 Ga0466957_0028694 3300044842 Bacteria 3314
105 Ga0466957_0029115 3300044842 Bacteria 3292
106 Ga0466960_0345609 3300044901 Bacteria 847
107 Ga0466958_0091920 3300045836 Bacteria 1878
108 Ga0466967_0483351 3300045976 Bacteria 1214
109 Ga0466967_0527000 3300045976 Bacteria 1161
110 Ga0466967_0966654 3300045976 Bacteria 848
111 Ga0495627_000852 3300046453 Bacteria 21820
112 Ga0495590_0000122 3300046457 Bacteria 46108
113 Ga0495632_0284484 3300046519 Bacteria 736
114 Ga0495625_0126482 3300046660 Bacteria 1735
115 Ga0495661_0399963 3300046665 Bacteria 668
116 Ga0495670_0474341 3300046691 Bacteria 679
117 Ga0495672_0185505 3300047320 Bacteria 1050
118 Ga0495686_0097919 3300047472 Bacteria 1773
119 Ga0495686_0104853 3300047472 Bacteria 1701
120 Ga0495686_0110178 3300047472 Bacteria 1652
121 Ga0496100_0612397 3300048903 Bacteria 846
122 Ga0496101_0010845 3300048904 Bacteria 6028
123 Ga0496102_0075009 3300048905 Bacteria 3109
124 Ga0496102_0468715 3300048905 Bacteria 1180
125 Ga0496102_0661225 3300048905 Bacteria 968
126 Ga0496104_0093298 3300048907 Bacteria 2879
127 Ga0496104_0933777 3300048907 Bacteria 772
128 Ga0496105_0135664 3300048908 Bacteria 2027
129 Ga0496105_0171011 3300048908 Bacteria 1781
130 Ga0496105_0389073 3300048908 Bacteria 1109
131 Ga0496105_0501064 3300048908 Bacteria 953
132 Ga0496106_0499838 3300048909 Bacteria 977
133 Ga0496107_0147896 3300048910 Bacteria 1737
134 Ga0496108_0257542 3300048911 Bacteria 1518
135 Ga0496109_0116822 3300048912 Bacteria 2483
136 Ga0496110_0368926 3300048913 Bacteria 1308
137 Ga0496112_0455035 3300048915 Bacteria 1218
138 Ga0496113_0067107 3300048916 Bacteria 2719
139 Ga0496114_0142199 3300048917 Bacteria 2078
140 Ga0496114_0179422 3300048917 Bacteria 1849
141 Ga0496114_0449330 3300048917 Bacteria 1141
142 Ga0496115_0283965 3300048918 Bacteria 1358
143 Ga0496115_0925130 3300048918 Bacteria 671
144 Ga0496116_0068905 3300048919 Bacteria 2252
145 Ga0496117_0001079 3300048920 Bacteria 41309
146 Ga0496117_0001576 3300048920 Bacteria 32370
147 Ga0496117_0031326 3300048920 Bacteria 4062
148 Ga0496117_0035590 3300048920 Bacteria 3735
149 Ga0496118_0000398 3300048921 Bacteria 73344
150 Ga0496118_0013856 3300048921 Bacteria 7589
151 Ga0496119_0038566 3300048922 Bacteria 3085
152 Ga0496120_0084053 3300048923 Bacteria 1717
153 Ga0496120_0247259 3300048923 Bacteria 839
154 Ga0496121_0038853 3300048924 Bacteria 4206
155 Ga0496121_0108069 3300048924 Bacteria 2129
156 Ga0496124_0000198 3300048927 Bacteria 119277
157 Ga0496126_0028098 3300048929 Bacteria 5363
158 Ga0496126_0092705 3300048929 Bacteria 2653
159 Ga0496126_0096336 3300048929 Bacteria 2594
160 Ga0496126_0126584 3300048929 Bacteria 2211
161 Ga0501033_0032321 3300049570 Bacteria 3930
162 Ga0501034_0002868 3300049571 Bacteria 20058
163 Ga0501034_0074356 3300049571 Bacteria 3406
164 Ga0501034_0265212 3300049571 Bacteria 1659
165 Ga0501034_0375861 3300049571 Bacteria 1346
166 Ga0501036_0054818 3300049572 Bacteria 3378
167 Ga0501037_0037409 3300049573 Bacteria 3578
168 Ga0501043_0007291 3300049579 Bacteria 8779
169 Ga0501043_0383162 3300049579 Bacteria 1064
170 Ga0501047_0092416 3300049581 Bacteria 2904
171 Ga0501047_0137083 3300049581 Bacteria 2327
172 Ga0501070_0000350 3300049586 Bacteria 41828
173 Ga0501070_0000980 3300049586 Bacteria 25623
174 Ga0501071_0376610 3300049587 Bacteria 1082
175 Ga0501072_0424267 3300049588 Bacteria 1054
176 Ga0501073_0140368 3300049589 Bacteria 1674
177 Ga0501080_0006757 3300049742 Bacteria 10335
178 Ga0501081_0987289 3300049743 Bacteria 636
179 Ga0501083_0024986 3300049744 Bacteria 4137
180 nmdc:mga00v17_3469_c1 3300050491 Bacteria 8164
181 nmdc:mga0yw44_15251_c2 3300050492 Bacteria 2673
182 nmdc:mga08y16_548594_c1 3300050511 Bacteria 1170
183 Ga0500643_001374 3300053087 Bacteria 14103
184 Ga0500556_0000007 3300053104 Bacteria 331400
185 Ga0500556_0000775 3300053104 Bacteria 18888
186 Ga0500562_000370 3300053108 Bacteria 10851
187 Ga0500593_001805 3300053117 Bacteria 7690
188 Ga0500655_001211 3300053133 Bacteria 4901
189 Ga0500559_0000926 3300053136 Bacteria 18567
190 Ga0500568_0000021 3300053139 Bacteria 185406
191 Ga0500568_0000098 3300053139 Bacteria 80393
192 Ga0500568_0002866 3300053139 Bacteria 9921
193 Ga0500568_0057726 3300053139 Bacteria 1509
194 Ga0500616_0000078 3300053153 Bacteria 202009
195 Ga0500616_0000302 3300053153 Bacteria 71543
196 Ga0500616_0001272 3300053153 Bacteria 25197
197 Ga0501084_0194024 3300054114 Bacteria 1713
198 Ga0466962_0039563 3300061719 Bacteria 2258
199 2643769231 2643221549 Bacteria 4042819
200 2643847845 2643221566 Bacteria 3460379
201 2643874796 2643221572 Bacteria 3614809
202 2643888217 2643221575 Bacteria 4022601
203 2644081803 2643221613 Bacteria 4622396
204 2644095413 2643221616 Bacteria 4066575
205 2644112677 2643221619 Bacteria 4158469
206 2644381852 2643221669 Bacteria 3611286
207 2644665154 2643221721 Bacteria 4486924
208 2723643822 2721755702 Bacteria 4373124
209 2753303442 2751185788 Bacteria 4541048
210 2808900300 2808606372 Bacteria 4649509
211 2812322195 2811994872 Bacteria 4121241
212 2833710008 2833709550 Bacteria 4008291
213 2844841803 2844841374 Bacteria 3917147
214 2852632768 2852632344 Bacteria 3463163
215 2857739429 2857737099 Bacteria 3104305
216 2895662826 2895660088 Bacteria 3782833
217 2919058992 2919055335 Bacteria 3875751
218 2919444882 2919443155 Bacteria 4072969
219 2919523856 2919523602 Bacteria 3788128
220 2928107004 2928104781 Bacteria 3877447
221 2928153160 2928153084 Bacteria 4020257
222 2935413479 2935409751 Bacteria 4179611
223 2935891320 2935890801 Bacteria 4593001
224 8045832302 8045830549 Bacteria 4444727
225 8057347859 8057345674 Bacteria 4160394
226 Ga0070658_10037041
227 JGI24740J21852_10004355
228 JGI24735J21928_10002540
229 rootH2_10100994
230 rootL2_10257705
231 rootH1_10201175
232 Ga0006562J51391_1093522
233 Ga0006562J51391_1093523
234 Ga0055539_1000035
235 Ga0055533_1000001
236 Ga0055525_1000531
237 Ga0055527_1000005
238 Ga0055542_1000006
239 Ga0055529_1000334
240 Ga0055529_1019877
241 Ga0070675_100862549
242 Ga0070667_100975780
243 Ga0070663_100105886
244 Ga0070672_100276058
245 Ga0068857_100393492
246 Ga0068864_100908503
247 Ga0068870_10148559
248 Ga0075365_10009563
249 Ga0075365_10021025
250 Ga0075367_10168570
251 Ga0075369_10021665
252 Ga0111539_10559565
253 Ga0105243_10087181
254 Ga0105246_10684368
255 Ga0157370_10208381
256 Ga0157370_10380653
257 Ga0157369_10182306
258 Ga0163162_10265356
259 Ga0157375_10934728
260 Ga0157375_11626159
261 Ga0163163_11410689
262 Ga0206353_10505610
263 Ga0209566_100055
264 Ga0209674_100001
265 Ga0209672_100003
266 Ga0209147_103577
267 Ga0209563_100001
268 Ga0209563_100923
269 Ga0209677_100001
270 Ga0209677_100720
271 Ga0209148_1000004
272 Ga0209455_1000022
273 Ga0209455_1019403
274 Ga0207688_10025333
275 Ga0207647_10029466
276 Ga0207643_10027041
277 Ga0207705_10030344
278 Ga0207659_10246485
279 Ga0207709_10245818
280 Ga0207712_10636673
281 Ga0207658_10718378
282 Ga0207678_10282112
283 Ga0207676_10563214
284 Ga0207674_10150291
285 Ga0207683_10147724
286 Ga0307513_10427071
287 Ga0307407_10618388
288 Ga0307416_100294071
289 Ga0307416_100458468
290 Ga0307414_10239686
291 Ga0307414_10292567
292 Ga0307414_10511893
293 Ga0307414_10771500
294 Ga0307414_11268876
295 Ga0307415_101009973
296 Ga0395900_0045020
297 Ga0395900_0080023
298 Ga0395900_0248813
299 Ga0395900_0388150
300 Ga0395898_0000246
301 Ga0395901_0564909
302 Ga0439465_0108667
303 Ga0451797_0206934
304 Ga0451802_1036890
305 Ga0451853_4052207
306 Ga0466972_0028710
307 Ga0466972_0034728
308 Ga0466972_0206846
309 Ga0466965_0000007
310 Ga0466965_0009352
311 Ga0466965_0016275
312 Ga0466965_0051075
313 Ga0466965_0074310
314 Ga0466966_0030561
315 Ga0466966_0171926
316 Ga0466966_0201059
317 Ga0466961_0063155
318 Ga0466961_0320886
319 Ga0466964_0169038
320 Ga0466971_0298931
321 Ga0466968_0005408
322 Ga0466968_0030768
323 Ga0466968_0034452
324 Ga0466970_0000322
325 Ga0466970_0018882
326 Ga0466970_0024474
327 Ga0466970_0048373
328 Ga0466970_0268717
329 Ga0466957_0028694
330 Ga0466957_0029115
331 Ga0466960_0345609
332 Ga0466958_0091920
333 Ga0466967_0483351
334 Ga0466967_0527000
335 Ga0466967_0966654
336 Ga0495627_000852
337 Ga0495590_0000122
338 Ga0495632_0284484
339 Ga0495625_0126482
340 Ga0495661_0399963
341 Ga0495670_0474341
342 Ga0495672_0185505
343 Ga0495686_0097919
344 Ga0495686_0104853
345 Ga0495686_0110178
346 Ga0496100_0612397
347 Ga0496101_0010845
348 Ga0496102_0075009
349 Ga0496102_0468715
350 Ga0496102_0661225
351 Ga0496104_0093298
352 Ga0496104_0933777
353 Ga0496105_0135664
354 Ga0496105_0171011
355 Ga0496105_0389073
356 Ga0496105_0501064
357 Ga0496106_0499838
358 Ga0496107_0147896
359 Ga0496108_0257542
360 Ga0496109_0116822
361 Ga0496110_0368926
362 Ga0496112_0455035
363 Ga0496113_0067107
364 Ga0496114_0142199
365 Ga0496114_0179422
366 Ga0496114_0449330
367 Ga0496115_0283965
368 Ga0496115_0925130
369 Ga0496116_0068905
370 Ga0496117_0001079
371 Ga0496117_0001576
372 Ga0496117_0031326
373 Ga0496117_0035590
374 Ga0496118_0000398
375 Ga0496118_0013856
376 Ga0496119_0038566
377 Ga0496120_0084053
378 Ga0496120_0247259
379 Ga0496121_0038853
380 Ga0496121_0108069
381 Ga0496124_0000198
382 Ga0496126_0028098
383 Ga0496126_0092705
384 Ga0496126_0096336
385 Ga0496126_0126584
386 Ga0501033_0032321
387 Ga0501034_0002868
388 Ga0501034_0074356
389 Ga0501034_0265212
390 Ga0501034_0375861
391 Ga0501036_0054818
392 Ga0501037_0037409
393 Ga0501043_0007291
394 Ga0501043_0383162
395 Ga0501047_0092416
396 Ga0501047_0137083
397 Ga0501070_0000350
398 Ga0501070_0000980
399 Ga0501071_0376610
400 Ga0501072_0424267
401 Ga0501073_0140368
402 Ga0501080_0006757
403 Ga0501081_0987289
404 Ga0501083_0024986
405 nmdc:mga00v17_3469_c1
406 nmdc:mga0yw44_15251_c2
407 nmdc:mga08y16_548594_c1
408 Ga0500643_001374
409 Ga0500556_0000007
410 Ga0500556_0000775
411 Ga0500562_000370
412 Ga0500593_001805
413 Ga0500655_001211
414 Ga0500559_0000926
415 Ga0500568_0000021
416 Ga0500568_0000098
417 Ga0500568_0002866
418 Ga0500568_0057726
419 Ga0500616_0000078
420 Ga0500616_0000302
421 Ga0500616_0001272
422 Ga0501084_0194024
423 Ga0466962_0039563
424 2643769231
425 2643847845
426 2643874796
427 2643888217
428 2644081803
429 2644095413
430 2644112677
431 2644381852
432 2644665154
433 2723643822
434 2753303442
435 2808900300
436 2812322195
437 2833710008
438 2844841803
439 2852632768
440 2857739429
441 2895662826
442 2919058992
443 2919444882
444 2919523856
445 2928107004
446 2928153160
447 2935413479
448 2935891320
449 8045832302
450 8057347859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

18

64

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8761 24 104
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.7304 24 174
6el2-assembly1.cif.gz_B safadr_lauroyl_coa complex 0.6647 23 177
3ljl-assembly1.cif.gz_A the crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633. 0.655 26 177
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.6435 24 174
ID Description Score Start End Superfamily
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9967 20 73 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9924 27 73 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9829 24 73 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9824 24 73 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9815 24 73 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7S8MYM6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9454 19 129 GO:0000976
GO:0003700
AF-A0A4Q4CS65-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9201 17 146 GO:0000976
GO:0003700
AF-A0A1I3TCW4-F1-model_v4 Transcriptional regulator, TetR family 0.9187 21 139 GO:0000976
GO:0003700
AF-A0A4Q4CS65-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9003 17 146 GO:0000976
GO:0003700
AF-T1A6S9-F1-model_v4 TetR family transcriptional regulator 0.8651 4 165 GO:0000976
GO:0003700

Map