F337479

General Info

Members Datasets Scaffolds Average Seq Length
225 145 450 445

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100046170|Ga0070671_1000461702
Length 455
Sequence MESKGARVLPHSETAEKSVLGSILIDGEALIKVADKLSPHDFYDERHGHIYEAILKLYEKSSPIDVLTLADQLKKDGWLERVGGDDYLSELTNYVPTAVHVESYAEIVADRAVRRNMIRSANETAELAYADNDETIKSLIEEAETRLFSISERHVQQNVASLEGILSDAFERLDDLHKHKGKIRGVPTGLKDLDKMTAGLQRSDLFVLAARPSMGKTALMLNIALNVATKAKQGGVLLFSLEMSKEQLVDRMLSSEAGVDAWKLRTGEGLVDADFEKLSEAMGVLAEAPIYIDDTPGITVSDMRTKARRLAHQNPLALIVVDYMQLMSGGSRFAGSANRVQEISEISRGLKIMARELNVPLIALSQLSRSVESRTPQIPQLSDLRESGSIEQDADIVAFIYREEYYNPETEKKNITEILVKKHRNGPVGNIDLFFDIQKQRFRSLAKQKKQPFEG

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
124 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
128 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
129 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
132 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
133 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
134 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
135 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
142 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
143 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
144 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
145 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.67
Nodule 0
Rhizoplane 0.89
Rhizosphere 67.56
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100046170 3300005355 Bacteria 3622
2 JGI24741J21665_1000389 3300001915 Bacteria 13204
3 JGI24741J21665_1003473 3300001915 Bacteria 3747
4 JGI24740J21852_10017408 3300001979 Bacteria 2572
5 JGI24737J22298_10000036 3300001990 Bacteria 39083
6 JGI24735J21928_10000058 3300002067 Bacteria 46343
7 JGI24742J22300_10000008 3300002244 Bacteria 35034
8 rootL2_10238238 3300003322 Bacteria 7839
9 Ga0065704_10145698 3300005289 Unclassified 1474
10 Ga0070658_10000012 3300005327 Bacteria 277871
11 Ga0070658_10000783 3300005327 Bacteria 27328
12 Ga0070658_10009754 3300005327 Bacteria 7711
13 Ga0070658_10146214 3300005327 Bacteria 1977
14 Ga0070676_10000213 3300005328 Bacteria 24788
15 Ga0070676_10022946 3300005328 Bacteria 3504
16 Ga0070683_100000077 3300005329 Bacteria 67473
17 Ga0070683_100000166 3300005329 Bacteria 43098
18 Ga0070690_100011687 3300005330 Bacteria 5143
19 Ga0070677_10020942 3300005333 Bacteria 2391
20 Ga0070680_100000260 3300005336 Bacteria 34804
21 Ga0070682_100012313 3300005337 Bacteria 4902
22 Ga0070660_100001027 3300005339 Bacteria 18741
23 Ga0070660_100002164 3300005339 Bacteria 13537
24 Ga0070668_100111644 3300005347 Bacteria 2176
25 Ga0070674_100010201 3300005356 Bacteria 5665
26 Ga0070674_100017423 3300005356 Bacteria 4519
27 Ga0070688_100067707 3300005365 Bacteria 2275
28 Ga0070659_100072532 3300005366 Bacteria 2740
29 Ga0070667_100000001 3300005367 Bacteria 1108638
30 Ga0070667_100002227 3300005367 Bacteria 17058
31 Ga0070678_100000678 3300005456 Bacteria 16767
32 Ga0070681_10018971 3300005458 Bacteria 6884
33 Ga0070681_10026152 3300005458 Bacteria 5869
34 Ga0070685_10000179 3300005466 Bacteria 42215
35 Ga0070685_10003585 3300005466 Bacteria 7882
36 Ga0070679_100000670 3300005530 Bacteria 29193
37 Ga0070679_100001147 3300005530 Bacteria 23192
38 Ga0070684_100004321 3300005535 Bacteria 10797
39 Ga0070684_100037446 3300005535 Bacteria 4161
40 Ga0068853_100053200 3300005539 Bacteria 3487
41 Ga0070665_100029701 3300005548 Bacteria 5500
42 Ga0068855_100000003 3300005563 Bacteria 589862
43 Ga0068855_100034546 3300005563 Bacteria 6028
44 Ga0068857_100041777 3300005577 Unclassified 4066
45 Ga0068857_100207084 3300005577 Bacteria 1789
46 Ga0068856_100000001 3300005614 Bacteria 565602
47 Ga0068856_100001965 3300005614 Bacteria 21423
48 Ga0068856_100005525 3300005614 Bacteria 12452
49 Ga0068860_100044626 3300005843 Bacteria 4225
50 Ga0075365_10000751 3300006038 Bacteria 13154
51 Ga0075368_10000526 3300006042 Bacteria 11462
52 Ga0075368_10032104 3300006042 Bacteria 2038
53 Ga0075363_100000132 3300006048 Bacteria 18090
54 Ga0075364_10007120 3300006051 Bacteria 6615
55 Ga0075364_10046237 3300006051 Bacteria 2834
56 Ga0075367_10001038 3300006178 Bacteria 11462
57 Ga0075367_10023970 3300006178 Bacteria 3439
58 Ga0075369_10000003 3300006186 Bacteria 205269
59 Ga0075369_10000020 3300006186 Bacteria 45510
60 Ga0075366_10000001 3300006195 Bacteria 569172
61 Ga0075366_10000005 3300006195 Bacteria 107438
62 Ga0075366_10000229 3300006195 Bacteria 24965
63 Ga0075366_10003116 3300006195 Bacteria 8671
64 Ga0075370_10001429 3300006353 Bacteria 10349
65 Ga0105240_10000003 3300009093 Bacteria 1183681
66 Ga0105240_10009618 3300009093 Bacteria 13675
67 Ga0105240_10068807 3300009093 Bacteria 4384
68 Ga0105245_10000050 3300009098 Bacteria 128014
69 Ga0105245_10217055 3300009098 Bacteria 1843
70 Ga0105243_10000001 3300009148 Bacteria 1156578
71 Ga0105243_10015479 3300009148 Bacteria 5765
72 Ga0105241_10000003 3300009174 Bacteria 839043
73 Ga0105241_10140884 3300009174 Bacteria 1963
74 Ga0105242_10000011 3300009176 Bacteria 149791
75 Ga0105242_10001716 3300009176 Bacteria 17301
76 Ga0105242_10135804 3300009176 Bacteria 2128
77 Ga0105248_10088858 3300009177 Unclassified 3478
78 Ga0105237_10033183 3300009545 Bacteria 5230
79 Ga0105239_10049804 3300010375 Bacteria 4594
80 Ga0105239_10187935 3300010375 Bacteria 2312
81 Ga0157373_10007152 3300013100 Bacteria 8324
82 Ga0157371_10001551 3300013102 Bacteria 23621
83 Ga0157369_10000072 3300013105 Bacteria 140097
84 Ga0157369_10007941 3300013105 Bacteria 12199
85 Ga0157374_10000064 3300013296 Bacteria 108743
86 Ga0157374_10001867 3300013296 Bacteria 17735
87 Ga0157374_10006074 3300013296 Bacteria 10223
88 Ga0157374_10245054 3300013296 Bacteria 1763
89 Ga0157378_10101862 3300013297 Bacteria 2623
90 Ga0157372_10051654 3300013307 Unclassified 4575
91 Ga0157377_10033227 3300014745 Bacteria 2815
92 Ga0157379_10069645 3300014968 Bacteria 3147
93 Ga0157376_10000007 3300014969 Bacteria 368004
94 Ga0207647_10071113 3300025904 Bacteria 2099
95 Ga0207645_10000706 3300025907 Bacteria 27831
96 Ga0207645_10094408 3300025907 Bacteria 1925
97 Ga0207705_10000011 3300025909 Bacteria 517768
98 Ga0207705_10000038 3300025909 Bacteria 193812
99 Ga0207705_10003842 3300025909 Bacteria 11430
100 Ga0207705_10025270 3300025909 Bacteria 4240
101 Ga0207705_10040419 3300025909 Bacteria 3345
102 Ga0207654_10000002 3300025911 Bacteria 1460142
103 Ga0207654_10076233 3300025911 Bacteria 2006
104 Ga0207707_10017123 3300025912 Bacteria 6315
105 Ga0207707_10029236 3300025912 Bacteria 4818
106 Ga0207695_10000005 3300025913 Bacteria 1196715
107 Ga0207695_10037962 3300025913 Bacteria 5192
108 Ga0207660_10001902 3300025917 Bacteria 13905
109 Ga0207657_10001264 3300025919 Bacteria 26993
110 Ga0207657_10001852 3300025919 Bacteria 22847
111 Ga0207652_10000657 3300025921 Bacteria 34000
112 Ga0207687_10000030 3300025927 Bacteria 155548
113 Ga0207687_10000117 3300025927 Bacteria 56652
114 Ga0207644_10000001 3300025931 Bacteria 1243214
115 Ga0207644_10007079 3300025931 Bacteria 7312
116 Ga0207686_10000001 3300025934 Bacteria 1169580
117 Ga0207709_10000002 3300025935 Bacteria 1171536
118 Ga0207711_10072351 3300025941 Bacteria 2995
119 Ga0207661_10000455 3300025944 Bacteria 26361
120 Ga0207661_10003382 3300025944 Bacteria 11085
121 Ga0207667_10000008 3300025949 Bacteria 625138
122 Ga0207658_10000003 3300025986 Bacteria 1151934
123 Ga0207658_10006753 3300025986 Bacteria 7813
124 Ga0207639_10023379 3300026041 Bacteria 4463
125 Ga0207702_10000001 3300026078 Bacteria 895738
126 Ga0207702_10001886 3300026078 Bacteria 20518
127 Ga0207702_10014802 3300026078 Bacteria 6470
128 Ga0207674_10123582 3300026116 Unclassified 2554
129 Ga0207674_10217069 3300026116 Bacteria 1861
130 Ga0207683_10040962 3300026121 Bacteria 4043
131 Ga0209813_10000006 3300027866 Bacteria 113121
132 Ga0209813_10016042 3300027866 Bacteria 2038
133 Ga0268266_10002329 3300028379 Bacteria 20572
134 Ga0268264_10012705 3300028381 Bacteria 6929
135 Ga0265338_10000366 3300028800 Bacteria 81024
136 Ga0265338_10000841 3300028800 Bacteria 51708
137 Ga0373925_0144865 3300037068 Bacteria 1862
138 Ga0395900_0048937 3300037418 Bacteria 4354
139 Ga0395898_0001404 3300037466 Bacteria 34348
140 Ga0395905_0007126 3300037471 Bacteria 11176
141 Ga0395905_0016991 3300037471 Bacteria 6909
142 Ga0395901_0015247 3300038443 Bacteria 7820
143 Ga0395901_0021847 3300038443 Bacteria 6558
144 Ga0395901_0070643 3300038443 Bacteria 3638
145 Ga0495629_0008584 3300046459 Bacteria 7523
146 Ga0495622_0000035 3300046557 Bacteria 122963
147 Ga0495588_0000124 3300046674 Bacteria 130833
148 Ga0495649_0000379 3300046694 Bacteria 38623
149 Ga0495600_0003357 3300046809 Bacteria 9415
150 Ga0495676_0112410 3300047321 Bacteria 1996
151 Ga0496109_0053026 3300048912 Bacteria 3698
152 Ga0496112_0008716 3300048915 Bacteria 9095
153 Ga0496126_0019815 3300048929 Bacteria 6617
154 Ga0501031_0002607 3300049568 Bacteria 11481
155 Ga0501032_0002352 3300049569 Bacteria 14820
156 Ga0501034_0012899 3300049571 Bacteria 8620
157 Ga0501034_0030917 3300049571 Bacteria 5442
158 Ga0501036_0007363 3300049572 Bacteria 8969
159 Ga0501037_0000113 3300049573 Bacteria 75610
160 Ga0501037_0120131 3300049573 Bacteria 1890
161 Ga0501038_0020191 3300049574 Bacteria 5994
162 Ga0501042_0059973 3300049578 Bacteria 2717
163 Ga0501043_0000205 3300049579 Bacteria 54247
164 Ga0501046_0000038 3300049580 Bacteria 159193
165 Ga0501046_0042344 3300049580 Bacteria 3631
166 Ga0501047_0000355 3300049581 Bacteria 51922
167 Ga0501048_0000379 3300049582 Bacteria 30846
168 Ga0501070_0018881 3300049586 Bacteria 5783
169 Ga0501071_0148096 3300049587 Bacteria 1750
170 Ga0501073_0011810 3300049589 Bacteria 6375
171 Ga0501080_0010862 3300049742 Bacteria 8333
172 Ga0501083_0007322 3300049744 Bacteria 7825
173 Ga0501035_0000768 3300049822 Bacteria 34474
174 nmdc:mga03683_96_c1 3300050489 Bacteria 31621
175 nmdc:mga03n38_116_c1 3300050490 Bacteria 17411
176 nmdc:mga00v17_37846_c1 3300050491 Bacteria 2883
177 nmdc:mga00v17_57842_c1 3300050491 Bacteria 2373
178 nmdc:mga0yw44_203_c1 3300050492 Bacteria 21033
179 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
180 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
181 nmdc:mga0k408_32754_c1 3300050493 Bacteria 1846
182 nmdc:mga0k408_34_c2 3300050493 Bacteria 12796
183 nmdc:mga0k408_36_c1 3300050493 Bacteria 72881
184 nmdc:mga0k408_42_c2 3300050493 Bacteria 47551
185 nmdc:mga0k408_4714_c1 3300050493 Bacteria 7223
186 nmdc:mga06z11_1753_c1 3300050494 Bacteria 8154
187 nmdc:mga06z11_1_c1 3300050494 Bacteria 196297
188 nmdc:mga04h51_18849_c1 3300050495 Bacteria 2038
189 nmdc:mga04h51_6_c1 3300050495 Bacteria 126812
190 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
191 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
192 Ga0500610_0000010 3300053079 Bacteria 101459
193 Ga0500610_0005094 3300053079 Bacteria 5340
194 Ga0500643_000010 3300053087 Bacteria 408084
195 Ga0500643_001714 3300053087 Bacteria 12174
196 Ga0500644_0000355 3300053088 Bacteria 22579
197 Ga0500644_0001476 3300053088 Bacteria 6189
198 Ga0500644_0002172 3300053088 Bacteria 4963
199 Ga0500583_0000152 3300053092 Bacteria 28818
200 Ga0500583_0007181 3300053092 Bacteria 3896
201 Ga0500651_0000047 3300053093 Bacteria 83743
202 Ga0500651_0005674 3300053093 Bacteria 7144
203 Ga0500566_0000001 3300053094 Bacteria 1101031
204 Ga0500650_0000001 3300053098 Bacteria 818797
205 Ga0500555_000001 3300053103 Bacteria 1353713
206 Ga0500555_000002 3300053103 Bacteria 1314346
207 Ga0500562_000009 3300053108 Bacteria 187538
208 Ga0500562_001470 3300053108 Bacteria 5814
209 Ga0500593_000001 3300053117 Bacteria 784404
210 Ga0500594_0000001 3300053118 Bacteria 1178472
211 Ga0500594_0000880 3300053118 Bacteria 6430
212 Ga0500614_000001 3300053123 Bacteria 1274484
213 Ga0500614_012502 3300053123 Bacteria 1854
214 Ga0500628_000006 3300053129 Bacteria 154858
215 Ga0500652_000031 3300053131 Bacteria 89798
216 Ga0500655_000448 3300053133 Bacteria 8448
217 Ga0500559_0027743 3300053136 Bacteria 2417
218 Ga0500561_0000001 3300053137 Bacteria 957685
219 Ga0500568_0005431 3300053139 Bacteria 6585
220 Ga0500577_0001361 3300053142 Bacteria 6238
221 Ga0500579_001662 3300053143 Bacteria 13066
222 Ga0500589_000008 3300053147 Bacteria 137145
223 Ga0500633_0008238 3300053160 Bacteria 2676
224 Ga0500649_000022 3300053722 Bacteria 39643
225 Ga0500611_000261 3300053727 Bacteria 5686
226 Ga0070671_100046170
227 JGI24741J21665_1000389
228 JGI24741J21665_1003473
229 JGI24740J21852_10017408
230 JGI24737J22298_10000036
231 JGI24735J21928_10000058
232 JGI24742J22300_10000008
233 rootL2_10238238
234 Ga0065704_10145698
235 Ga0070658_10000012
236 Ga0070658_10000783
237 Ga0070658_10009754
238 Ga0070658_10146214
239 Ga0070676_10000213
240 Ga0070676_10022946
241 Ga0070683_100000077
242 Ga0070683_100000166
243 Ga0070690_100011687
244 Ga0070677_10020942
245 Ga0070680_100000260
246 Ga0070682_100012313
247 Ga0070660_100001027
248 Ga0070660_100002164
249 Ga0070668_100111644
250 Ga0070674_100010201
251 Ga0070674_100017423
252 Ga0070688_100067707
253 Ga0070659_100072532
254 Ga0070667_100000001
255 Ga0070667_100002227
256 Ga0070678_100000678
257 Ga0070681_10018971
258 Ga0070681_10026152
259 Ga0070685_10000179
260 Ga0070685_10003585
261 Ga0070679_100000670
262 Ga0070679_100001147
263 Ga0070684_100004321
264 Ga0070684_100037446
265 Ga0068853_100053200
266 Ga0070665_100029701
267 Ga0068855_100000003
268 Ga0068855_100034546
269 Ga0068857_100041777
270 Ga0068857_100207084
271 Ga0068856_100000001
272 Ga0068856_100001965
273 Ga0068856_100005525
274 Ga0068860_100044626
275 Ga0075365_10000751
276 Ga0075368_10000526
277 Ga0075368_10032104
278 Ga0075363_100000132
279 Ga0075364_10007120
280 Ga0075364_10046237
281 Ga0075367_10001038
282 Ga0075367_10023970
283 Ga0075369_10000003
284 Ga0075369_10000020
285 Ga0075366_10000001
286 Ga0075366_10000005
287 Ga0075366_10000229
288 Ga0075366_10003116
289 Ga0075370_10001429
290 Ga0105240_10000003
291 Ga0105240_10009618
292 Ga0105240_10068807
293 Ga0105245_10000050
294 Ga0105245_10217055
295 Ga0105243_10000001
296 Ga0105243_10015479
297 Ga0105241_10000003
298 Ga0105241_10140884
299 Ga0105242_10000011
300 Ga0105242_10001716
301 Ga0105242_10135804
302 Ga0105248_10088858
303 Ga0105237_10033183
304 Ga0105239_10049804
305 Ga0105239_10187935
306 Ga0157373_10007152
307 Ga0157371_10001551
308 Ga0157369_10000072
309 Ga0157369_10007941
310 Ga0157374_10000064
311 Ga0157374_10001867
312 Ga0157374_10006074
313 Ga0157374_10245054
314 Ga0157378_10101862
315 Ga0157372_10051654
316 Ga0157377_10033227
317 Ga0157379_10069645
318 Ga0157376_10000007
319 Ga0207647_10071113
320 Ga0207645_10000706
321 Ga0207645_10094408
322 Ga0207705_10000011
323 Ga0207705_10000038
324 Ga0207705_10003842
325 Ga0207705_10025270
326 Ga0207705_10040419
327 Ga0207654_10000002
328 Ga0207654_10076233
329 Ga0207707_10017123
330 Ga0207707_10029236
331 Ga0207695_10000005
332 Ga0207695_10037962
333 Ga0207660_10001902
334 Ga0207657_10001264
335 Ga0207657_10001852
336 Ga0207652_10000657
337 Ga0207687_10000030
338 Ga0207687_10000117
339 Ga0207644_10000001
340 Ga0207644_10007079
341 Ga0207686_10000001
342 Ga0207709_10000002
343 Ga0207711_10072351
344 Ga0207661_10000455
345 Ga0207661_10003382
346 Ga0207667_10000008
347 Ga0207658_10000003
348 Ga0207658_10006753
349 Ga0207639_10023379
350 Ga0207702_10000001
351 Ga0207702_10001886
352 Ga0207702_10014802
353 Ga0207674_10123582
354 Ga0207674_10217069
355 Ga0207683_10040962
356 Ga0209813_10000006
357 Ga0209813_10016042
358 Ga0268266_10002329
359 Ga0268264_10012705
360 Ga0265338_10000366
361 Ga0265338_10000841
362 Ga0373925_0144865
363 Ga0395900_0048937
364 Ga0395898_0001404
365 Ga0395905_0007126
366 Ga0395905_0016991
367 Ga0395901_0015247
368 Ga0395901_0021847
369 Ga0395901_0070643
370 Ga0495629_0008584
371 Ga0495622_0000035
372 Ga0495588_0000124
373 Ga0495649_0000379
374 Ga0495600_0003357
375 Ga0495676_0112410
376 Ga0496109_0053026
377 Ga0496112_0008716
378 Ga0496126_0019815
379 Ga0501031_0002607
380 Ga0501032_0002352
381 Ga0501034_0012899
382 Ga0501034_0030917
383 Ga0501036_0007363
384 Ga0501037_0000113
385 Ga0501037_0120131
386 Ga0501038_0020191
387 Ga0501042_0059973
388 Ga0501043_0000205
389 Ga0501046_0000038
390 Ga0501046_0042344
391 Ga0501047_0000355
392 Ga0501048_0000379
393 Ga0501070_0018881
394 Ga0501071_0148096
395 Ga0501073_0011810
396 Ga0501080_0010862
397 Ga0501083_0007322
398 Ga0501035_0000768
399 nmdc:mga03683_96_c1
400 nmdc:mga03n38_116_c1
401 nmdc:mga00v17_37846_c1
402 nmdc:mga00v17_57842_c1
403 nmdc:mga0yw44_203_c1
404 nmdc:mga0yw44_2_c1
405 nmdc:mga0k408_1_c1
406 nmdc:mga0k408_32754_c1
407 nmdc:mga0k408_34_c2
408 nmdc:mga0k408_36_c1
409 nmdc:mga0k408_42_c2
410 nmdc:mga0k408_4714_c1
411 nmdc:mga06z11_1753_c1
412 nmdc:mga06z11_1_c1
413 nmdc:mga04h51_18849_c1
414 nmdc:mga04h51_6_c1
415 nmdc:mga0sz30_1_c1
416 nmdc:mga0sz30_8_c1
417 Ga0500610_0000010
418 Ga0500610_0005094
419 Ga0500643_000010
420 Ga0500643_001714
421 Ga0500644_0000355
422 Ga0500644_0001476
423 Ga0500644_0002172
424 Ga0500583_0000152
425 Ga0500583_0007181
426 Ga0500651_0000047
427 Ga0500651_0005674
428 Ga0500566_0000001
429 Ga0500650_0000001
430 Ga0500555_000001
431 Ga0500555_000002
432 Ga0500562_000009
433 Ga0500562_001470
434 Ga0500593_000001
435 Ga0500594_0000001
436 Ga0500594_0000880
437 Ga0500614_000001
438 Ga0500614_012502
439 Ga0500628_000006
440 Ga0500652_000031
441 Ga0500655_000448
442 Ga0500559_0027743
443 Ga0500561_0000001
444 Ga0500568_0005431
445 Ga0500577_0001361
446 Ga0500579_001662
447 Ga0500589_000008
448 Ga0500633_0008238
449 Ga0500649_000022
450 Ga0500611_000261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00772

DnaB

DnaB-like helicase N terminal domain

8

110

0.98

PF03796

DnaB_C

DnaB-like helicase C terminal domain

185

444

0.94

PF13481

AAA_25

AAA domain

175

370

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r5u-assembly1.cif.gz_F crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9663 10 149
1jwe-assembly1.cif.gz_A nmr structure of the n-terminal domain of e. coli dnab helicase 0.9658 8 120
2r5u-assembly1.cif.gz_E crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9636 10 151
2r5u-assembly1.cif.gz_A crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9595 10 150
2r5u-assembly1.cif.gz_F crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9529 10 149
ID Description Score Start End Superfamily
4esvI01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9784 12 131 1.10.860.10
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9783 9 131 1.10.860.10
2r6dE01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9733 12 131 1.10.860.10
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9705 9 131 1.10.860.10
4esvA01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9694 7 151 1.10.860.10
ID Description Score Start End GO Terms
AF-A0A351IYA5-F1-model_v4 Replicative DNA helicase 0.9979 210 294 GO:0003678
GO:0005524
GO:0005829
GO:0006268
AF-A0A353QHR1-F1-model_v4 Replicative DNA helicase 0.986 9 115 GO:0003677
GO:0003678
GO:0005524
GO:0005829
GO:0006268
AF-R7N0Z2-F1-model_v4 Replicative DNA helicase (EC 5.6.2.3) 0.9777 202 445 GO:0003677
GO:0003689
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0009378
GO:0016887
GO:0036121
GO:0061749
GO:0061775
GO:0140584
GO:0140665
GO:0140849
GO:1990077
GO:1990518
AF-A0A2M8L3J2-F1-model_v4 Replicative DNA helicase 0.9767 200 384 GO:0003678
GO:0005524
GO:0005829
GO:0006268
AF-A0A6B0XSS2-F1-model_v4 DNA 5'-3' helicase (EC 5.6.2.3) 0.9765 172 396 GO:0003678
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0016887
GO:1990077

Map