F337483
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 158 | 451 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100016729|Ga0070659_1000167295 |
| Length | 317 |
| Sequence | MTVETGGVTATFSTREGDGGRPVRMALAAALXXXAAGCSGRSIFDSVGPVGRDDSRILIDATLIMLAIVVPTILLAFWMAWRYRASNTKAEYLPYWSYSGRIEAVVWSIPILTIMFIGGVIWIGSYRLDPFRPLSKTPPLEVQVVSLDWKWLFIYPQQGVATVNQLVVPAGRPVHFSITSASVFNTFFVPRLGSMIYAMPGMVSQLHLQADRPATMWGTSAMFSGDGFSDMQFQVRSVADADFAAWAAGARGGGPVLDSAAYAQLAKQSHNVPPISFRAVDPKLFDAVATQKIPPAPGPEPENASHAGREVTPAGRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 51 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 52 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 89 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 90 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 91 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 92 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 95 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 96 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 99 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 100 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 101 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 102 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 103 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 104 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 105 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 106 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 107 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 108 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 109 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 120 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 121 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 125 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 126 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 144 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 156 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 157 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 158 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.22 |
| Metatranscriptomes | 4.44 |
| Isolates | 1.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.33 |
| Nodule | 1.33 |
| Rhizoplane | 2.22 |
| Rhizosphere | 78.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070659_100016729 | 3300005366 | Bacteria | 5510 |
| 2 | JGI25159J45721_1001046 | 3300002987 | Bacteria | 11822 |
| 3 | JGI25153J46596_10000135 | 3300003215 | Bacteria | 79035 |
| 4 | rootH1_10023539 | 3300003316 | Bacteria | 2801 |
| 5 | rootH1_10023539 | 3300003323 | Bacteria | 2479 |
| 6 | rootH1_10048351 | 3300003316 | Bacteria | 2663 |
| 7 | rootH2_10180170 | 3300003320 | Bacteria | 3980 |
| 8 | rootH2_10215989 | 3300003320 | Bacteria | 2175 |
| 9 | rootL2_10055523 | 3300003322 | Bacteria | 6212 |
| 10 | rootH1_10045659 | 3300003323 | Bacteria | 10729 |
| 11 | rootH1_10077879 | 3300003323 | Bacteria | 4928 |
| 12 | JGI25161J50226_1000029 | 3300003374 | Bacteria | 144998 |
| 13 | Ga0055536_1000023 | 3300003781 | Bacteria | 191663 |
| 14 | Ga0055528_1021747 | 3300003790 | Bacteria | 2021 |
| 15 | Ga0055530_10001605 | 3300003791 | Bacteria | 16215 |
| 16 | Ga0055531_10000057 | 3300003794 | Bacteria | 122232 |
| 17 | Ga0055543_1000016 | 3300004625 | Bacteria | 176117 |
| 18 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 19 | Ga0070658_10242998 | 3300005327 | Bacteria | 1526 |
| 20 | Ga0070670_100000039 | 3300005331 | Bacteria | 152618 |
| 21 | Ga0070666_10013752 | 3300005335 | Bacteria | 5139 |
| 22 | Ga0070680_100120905 | 3300005336 | Bacteria | 2186 |
| 23 | Ga0070680_100497355 | 3300005336 | Bacteria | 1043 |
| 24 | Ga0070660_100002579 | 3300005339 | Bacteria | 12431 |
| 25 | Ga0070660_100219952 | 3300005339 | Bacteria | 1543 |
| 26 | Ga0070692_10031506 | 3300005345 | Bacteria | 2658 |
| 27 | Ga0070668_100071923 | 3300005347 | Bacteria | 2694 |
| 28 | Ga0070671_100088385 | 3300005355 | Bacteria | 2593 |
| 29 | Ga0070671_100110643 | 3300005355 | Bacteria | 2307 |
| 30 | Ga0070659_100000111 | 3300005366 | Bacteria | 60284 |
| 31 | Ga0070659_100002577 | 3300005366 | Bacteria | 12877 |
| 32 | Ga0070667_100008540 | 3300005367 | Bacteria | 8490 |
| 33 | Ga0070678_100199920 | 3300005456 | Bacteria | 1649 |
| 34 | Ga0070681_10250355 | 3300005458 | Bacteria | 1684 |
| 35 | Ga0070679_100209502 | 3300005530 | Bacteria | 1913 |
| 36 | Ga0070679_100355455 | 3300005530 | Bacteria | 1412 |
| 37 | Ga0070684_100027691 | 3300005535 | Bacteria | 4786 |
| 38 | Ga0070686_100000143 | 3300005544 | Bacteria | 49208 |
| 39 | Ga0070665_100012715 | 3300005548 | Bacteria | 8478 |
| 40 | Ga0068855_100031358 | 3300005563 | Bacteria | 6347 |
| 41 | Ga0068855_100040613 | 3300005563 | Bacteria | 5521 |
| 42 | Ga0068855_100041204 | 3300005563 | Bacteria | 5474 |
| 43 | Ga0068855_100205348 | 3300005563 | Bacteria | 2217 |
| 44 | Ga0068854_100112441 | 3300005578 | Bacteria | 2056 |
| 45 | Ga0068859_100033735 | 3300005617 | Bacteria | 5139 |
| 46 | Ga0068864_100000068 | 3300005618 | Bacteria | 115507 |
| 47 | Ga0068864_100026246 | 3300005618 | Bacteria | 4912 |
| 48 | Ga0068864_100424869 | 3300005618 | Bacteria | 1267 |
| 49 | Ga0068863_100000758 | 3300005841 | Bacteria | 32348 |
| 50 | Ga0068863_100123733 | 3300005841 | Bacteria | 2467 |
| 51 | Ga0068858_100005289 | 3300005842 | Bacteria | 12653 |
| 52 | Ga0068858_100213378 | 3300005842 | Bacteria | 1827 |
| 53 | Ga0068860_100000303 | 3300005843 | Bacteria | 68443 |
| 54 | Ga0068862_100004089 | 3300005844 | Bacteria | 12372 |
| 55 | Ga0097620_100033735 | 3300006931 | Bacteria | 5139 |
| 56 | Ga0105240_10134404 | 3300009093 | Bacteria | 2963 |
| 57 | Ga0105248_10216586 | 3300009177 | Bacteria | 2157 |
| 58 | Ga0105237_10092203 | 3300009545 | Bacteria | 3019 |
| 59 | Ga0105238_10047582 | 3300009551 | Bacteria | 4323 |
| 60 | Ga0105238_10403796 | 3300009551 | Bacteria | 1360 |
| 61 | Ga0105249_10001473 | 3300009553 | Bacteria | 20639 |
| 62 | Ga0105239_10610884 | 3300010375 | Bacteria | 1244 |
| 63 | Ga0157370_10020954 | 3300013104 | Bacteria | 6520 |
| 64 | Ga0157370_10078257 | 3300013104 | Bacteria | 3114 |
| 65 | Ga0157370_10102040 | 3300013104 | Bacteria | 2687 |
| 66 | Ga0157369_10173276 | 3300013105 | Bacteria | 2272 |
| 67 | Ga0157374_10177052 | 3300013296 | Bacteria | 2082 |
| 68 | Ga0163162_10160884 | 3300013306 | Bacteria | 2367 |
| 69 | Ga0163162_10244278 | 3300013306 | Bacteria | 1927 |
| 70 | Ga0157372_10184317 | 3300013307 | Bacteria | 2417 |
| 71 | Ga0157372_10246605 | 3300013307 | Bacteria | 2073 |
| 72 | Ga0157375_10069556 | 3300013308 | Bacteria | 3527 |
| 73 | Ga0213872_10050947 | 3300021361 | Bacteria | 1879 |
| 74 | Ga0213876_10000933 | 3300021384 | Bacteria | 19342 |
| 75 | Ga0213876_10001617 | 3300021384 | Bacteria | 13795 |
| 76 | Ga0213876_10017756 | 3300021384 | Bacteria | 3754 |
| 77 | Ga0209436_100015 | 3300025208 | Bacteria | 126026 |
| 78 | Ga0207425_1002373 | 3300025245 | Bacteria | 6702 |
| 79 | Ga0209129_1001214 | 3300025258 | Bacteria | 14807 |
| 80 | Ga0209130_1000051 | 3300025284 | Bacteria | 220482 |
| 81 | Ga0209676_1000072 | 3300025292 | Bacteria | 307347 |
| 82 | Ga0209025_1011106 | 3300025294 | Bacteria | 5995 |
| 83 | Ga0209758_1000154 | 3300025297 | Bacteria | 161260 |
| 84 | Ga0209050_1000077 | 3300025298 | Bacteria | 278985 |
| 85 | Ga0207426_1000043 | 3300025302 | Bacteria | 432827 |
| 86 | Ga0207426_1015117 | 3300025302 | Bacteria | 2808 |
| 87 | Ga0209257_1000088 | 3300025304 | Bacteria | 279014 |
| 88 | Ga0209257_1030194 | 3300025304 | Bacteria | 1753 |
| 89 | Ga0207680_10078498 | 3300025903 | Bacteria | 2068 |
| 90 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 91 | Ga0207705_10040696 | 3300025909 | Bacteria | 3334 |
| 92 | Ga0207705_10149643 | 3300025909 | Bacteria | 1749 |
| 93 | Ga0207695_10102813 | 3300025913 | Bacteria | 2850 |
| 94 | Ga0207660_10011983 | 3300025917 | Bacteria | 5661 |
| 95 | Ga0207657_10000477 | 3300025919 | Bacteria | 42286 |
| 96 | Ga0207657_10032016 | 3300025919 | Bacteria | 4756 |
| 97 | Ga0207652_10004499 | 3300025921 | Bacteria | 11325 |
| 98 | Ga0207694_10017345 | 3300025924 | Bacteria | 5444 |
| 99 | Ga0207694_10301243 | 3300025924 | Bacteria | 1320 |
| 100 | Ga0207650_10000161 | 3300025925 | Bacteria | 81097 |
| 101 | Ga0207644_10073991 | 3300025931 | Bacteria | 2499 |
| 102 | Ga0207690_10002589 | 3300025932 | Bacteria | 10920 |
| 103 | Ga0207690_10002843 | 3300025932 | Bacteria | 10446 |
| 104 | Ga0207690_10072314 | 3300025932 | Bacteria | 2381 |
| 105 | Ga0207706_10130521 | 3300025933 | Bacteria | 2210 |
| 106 | Ga0207711_10080580 | 3300025941 | Bacteria | 2844 |
| 107 | Ga0207711_10150187 | 3300025941 | Bacteria | 2102 |
| 108 | Ga0207667_10005260 | 3300025949 | Bacteria | 15788 |
| 109 | Ga0207667_10027279 | 3300025949 | Bacteria | 6220 |
| 110 | Ga0207667_10063950 | 3300025949 | Bacteria | 3843 |
| 111 | Ga0207712_10002142 | 3300025961 | Bacteria | 12906 |
| 112 | Ga0207668_10000323 | 3300025972 | Bacteria | 31013 |
| 113 | Ga0207658_10000988 | 3300025986 | Bacteria | 23373 |
| 114 | Ga0207703_10000968 | 3300026035 | Bacteria | 27762 |
| 115 | Ga0207703_10396059 | 3300026035 | Bacteria | 1280 |
| 116 | Ga0207641_10006602 | 3300026088 | Bacteria | 9747 |
| 117 | Ga0207676_10000685 | 3300026095 | Bacteria | 26828 |
| 118 | Ga0207676_10000987 | 3300026095 | Bacteria | 21898 |
| 119 | Ga0207674_10153526 | 3300026116 | Bacteria | 2259 |
| 120 | Ga0207674_10217582 | 3300026116 | Bacteria | 1858 |
| 121 | Ga0207683_10086506 | 3300026121 | Bacteria | 2787 |
| 122 | Ga0207698_10438823 | 3300026142 | Bacteria | 1257 |
| 123 | Ga0268266_10010699 | 3300028379 | Bacteria | 7994 |
| 124 | Ga0268265_10002542 | 3300028380 | Bacteria | 13655 |
| 125 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 126 | Ga0265338_10143574 | 3300028800 | Bacteria | 1866 |
| 127 | Ga0307410_10195354 | 3300031852 | Bacteria | 1541 |
| 128 | Ga0307409_100311997 | 3300031995 | Bacteria | 1468 |
| 129 | Ga0307414_10109727 | 3300032004 | Bacteria | 2097 |
| 130 | Ga0307411_10047478 | 3300032005 | Bacteria | 2776 |
| 131 | Ga0395899_0000486 | 3300037312 | Bacteria | 44413 |
| 132 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 133 | Ga0395900_0176672 | 3300037418 | Bacteria | 2172 |
| 134 | Ga0395898_0020955 | 3300037466 | Bacteria | 6632 |
| 135 | Ga0395905_0001224 | 3300037471 | Bacteria | 31977 |
| 136 | Ga0395905_0011963 | 3300037471 | Bacteria | 8366 |
| 137 | Ga0395905_0018448 | 3300037471 | Bacteria | 6623 |
| 138 | Ga0395905_0025829 | 3300037471 | Bacteria | 5537 |
| 139 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 140 | Ga0395901_0035141 | 3300038443 | Bacteria | 5179 |
| 141 | Ga0395901_0077221 | 3300038443 | Bacteria | 3476 |
| 142 | Ga0436365_0029381 | 3300039437 | Bacteria | 85595 |
| 143 | Ga0436365_0498837 | 3300039437 | Bacteria | 16854 |
| 144 | Ga0436365_0732709 | 3300039437 | Bacteria | 4074 |
| 145 | Ga0436365_1557449 | 3300039437 | Bacteria | 15725 |
| 146 | Ga0436365_1639497 | 3300039437 | Bacteria | 2532 |
| 147 | Ga0436365_1675136 | 3300039437 | Bacteria | 18309 |
| 148 | Ga0436361_0977157 | 3300039447 | Bacteria | 1835 |
| 149 | Ga0436361_1183726 | 3300039447 | Bacteria | 4655 |
| 150 | Ga0436363_0409721 | 3300039450 | Bacteria | 991 |
| 151 | Ga0439448_0015632 | 3300042005 | Bacteria | 2301 |
| 152 | Ga0466969_0003262 | 3300044656 | Bacteria | 8624 |
| 153 | Ga0466966_0004348 | 3300044684 | Bacteria | 9343 |
| 154 | Ga0466963_0019241 | 3300044694 | Bacteria | 4279 |
| 155 | Ga0466963_0157091 | 3300044694 | Bacteria | 1582 |
| 156 | Ga0466964_0055663 | 3300044706 | Bacteria | 1634 |
| 157 | Ga0466971_0001280 | 3300044719 | Bacteria | 10492 |
| 158 | Ga0466971_0190877 | 3300044719 | Bacteria | 965 |
| 159 | Ga0466970_0000129 | 3300044765 | Bacteria | 34329 |
| 160 | Ga0466970_0006429 | 3300044765 | Bacteria | 5876 |
| 161 | Ga0466957_0005957 | 3300044842 | Bacteria | 6874 |
| 162 | Ga0466959_0009958 | 3300045049 | Bacteria | 6775 |
| 163 | Ga0466959_0022849 | 3300045049 | Bacteria | 4623 |
| 164 | Ga0466959_0138343 | 3300045049 | Bacteria | 1722 |
| 165 | Ga0466959_0214584 | 3300045049 | Bacteria | 1336 |
| 166 | Ga0466958_0002312 | 3300045836 | Bacteria | 9506 |
| 167 | Ga0466958_0025844 | 3300045836 | Bacteria | 3465 |
| 168 | Ga0466967_0182438 | 3300045976 | Bacteria | 1980 |
| 169 | Ga0495592_0063408 | 3300046454 | Bacteria | 2711 |
| 170 | Ga0495630_0111206 | 3300046517 | Bacteria | 2075 |
| 171 | Ga0495642_0022811 | 3300046528 | Bacteria | 2468 |
| 172 | Ga0495645_0043665 | 3300046543 | Bacteria | 3270 |
| 173 | Ga0495611_0006190 | 3300046648 | Bacteria | 5106 |
| 174 | Ga0495669_0027469 | 3300046684 | Bacteria | 2490 |
| 175 | Ga0495581_0126722 | 3300047315 | Bacteria | 1487 |
| 176 | Ga0495674_0046582 | 3300047319 | Bacteria | 3848 |
| 177 | Ga0496102_0011792 | 3300048905 | Bacteria | 7543 |
| 178 | Ga0496107_0054436 | 3300048910 | Bacteria | 2888 |
| 179 | Ga0496108_0020239 | 3300048911 | Bacteria | 5469 |
| 180 | Ga0496109_0056841 | 3300048912 | Bacteria | 3570 |
| 181 | Ga0496115_0225539 | 3300048918 | Bacteria | 1546 |
| 182 | Ga0496124_0405367 | 3300048927 | Bacteria | 945 |
| 183 | Ga0496125_0077544 | 3300048928 | Bacteria | 2561 |
| 184 | Ga0501032_0001426 | 3300049569 | Bacteria | 18982 |
| 185 | Ga0501033_0000690 | 3300049570 | Bacteria | 31241 |
| 186 | Ga0501033_0267568 | 3300049570 | Bacteria | 1209 |
| 187 | Ga0501033_0322591 | 3300049570 | Bacteria | 1085 |
| 188 | Ga0501034_0031150 | 3300049571 | Bacteria | 5420 |
| 189 | Ga0501038_0000623 | 3300049574 | Bacteria | 31603 |
| 190 | Ga0501043_0038568 | 3300049579 | Bacteria | 3756 |
| 191 | Ga0501046_0008636 | 3300049580 | Bacteria | 8857 |
| 192 | Ga0501046_0410039 | 3300049580 | Bacteria | 978 |
| 193 | Ga0501047_0029010 | 3300049581 | Bacteria | 5337 |
| 194 | Ga0501047_0100693 | 3300049581 | Bacteria | 2769 |
| 195 | Ga0501048_0111562 | 3300049582 | Bacteria | 1931 |
| 196 | Ga0501068_0004827 | 3300049584 | Bacteria | 7339 |
| 197 | Ga0501069_0002436 | 3300049585 | Bacteria | 9478 |
| 198 | Ga0501070_0083478 | 3300049586 | Bacteria | 2644 |
| 199 | Ga0501070_0389767 | 3300049586 | Bacteria | 1128 |
| 200 | Ga0501073_0011746 | 3300049589 | Bacteria | 6395 |
| 201 | Ga0501074_0084024 | 3300049590 | Bacteria | 2282 |
| 202 | Ga0501080_0008977 | 3300049742 | Bacteria | 9095 |
| 203 | Ga0501080_0019691 | 3300049742 | Bacteria | 6250 |
| 204 | Ga0501080_0694361 | 3300049742 | Bacteria | 898 |
| 205 | Ga0501083_0013644 | 3300049744 | Bacteria | 5681 |
| 206 | Ga0501035_0023461 | 3300049822 | Bacteria | 5659 |
| 207 | Ga0501035_0047990 | 3300049822 | Bacteria | 3830 |
| 208 | Ga0501044_0130185 | 3300049823 | Bacteria | 2511 |
| 209 | Ga0501044_0205733 | 3300049823 | Bacteria | 1925 |
| 210 | Ga0500647_0020942 | 3300053091 | Bacteria | 3048 |
| 211 | Ga0587073_0003559 | 3300059492 | Bacteria | 2148 |
| 212 | Ga0587080_008446 | 3300059503 | Bacteria | 1476 |
| 213 | Ga0587083_0003573 | 3300059505 | Bacteria | 2077 |
| 214 | Ga0587088_001541 | 3300059508 | Bacteria | 2414 |
| 215 | Ga0587091_002927 | 3300059511 | Bacteria | 2092 |
| 216 | Ga0587106_001203 | 3300059605 | Bacteria | 2210 |
| 217 | Ga0587069_001382 | 3300059642 | Bacteria | 2212 |
| 218 | Ga0587072_011655 | 3300059643 | Bacteria | 1441 |
| 219 | Ga0587079_011252 | 3300059647 | Bacteria | 1436 |
| 220 | Ga0587107_001025 | 3300059652 | Bacteria | 2126 |
| 221 | Ga0501082_0004475 | 3300060353 | Bacteria | 12205 |
| 222 | Ga0466962_0002154 | 3300061719 | Bacteria | 9309 |
| 223 | Ga0466962_0099629 | 3300061719 | Bacteria | 1395 |
| 224 | 2524461604 | 2524023209 | Bacteria | 6679728 |
| 225 | 2842303184 | 2842298080 | Bacteria | 6123127 |
| 226 | 2842361474 | 2842357229 | Bacteria | 6485165 |
| 227 | Ga0070659_100016729 | |||
| 228 | JGI25159J45721_1001046 | |||
| 229 | JGI25153J46596_10000135 | |||
| 230 | rootH1_10023539 | |||
| 231 | rootH1_10048351 | |||
| 232 | rootH2_10180170 | |||
| 233 | rootH2_10215989 | |||
| 234 | rootL2_10055523 | |||
| 235 | rootH1_10045659 | |||
| 236 | rootH1_10077879 | |||
| 237 | JGI25161J50226_1000029 | |||
| 238 | Ga0055536_1000023 | |||
| 239 | Ga0055528_1021747 | |||
| 240 | Ga0055530_10001605 | |||
| 241 | Ga0055531_10000057 | |||
| 242 | Ga0055543_1000016 | |||
| 243 | Ga0070658_10000003 | |||
| 244 | Ga0070658_10242998 | |||
| 245 | Ga0070670_100000039 | |||
| 246 | Ga0070666_10013752 | |||
| 247 | Ga0070680_100120905 | |||
| 248 | Ga0070680_100497355 | |||
| 249 | Ga0070660_100002579 | |||
| 250 | Ga0070660_100219952 | |||
| 251 | Ga0070692_10031506 | |||
| 252 | Ga0070668_100071923 | |||
| 253 | Ga0070671_100088385 | |||
| 254 | Ga0070671_100110643 | |||
| 255 | Ga0070659_100000111 | |||
| 256 | Ga0070659_100002577 | |||
| 257 | Ga0070667_100008540 | |||
| 258 | Ga0070678_100199920 | |||
| 259 | Ga0070681_10250355 | |||
| 260 | Ga0070679_100209502 | |||
| 261 | Ga0070679_100355455 | |||
| 262 | Ga0070684_100027691 | |||
| 263 | Ga0070686_100000143 | |||
| 264 | Ga0070665_100012715 | |||
| 265 | Ga0068855_100031358 | |||
| 266 | Ga0068855_100040613 | |||
| 267 | Ga0068855_100041204 | |||
| 268 | Ga0068855_100205348 | |||
| 269 | Ga0068854_100112441 | |||
| 270 | Ga0068859_100033735 | |||
| 271 | Ga0068864_100000068 | |||
| 272 | Ga0068864_100026246 | |||
| 273 | Ga0068864_100424869 | |||
| 274 | Ga0068863_100000758 | |||
| 275 | Ga0068863_100123733 | |||
| 276 | Ga0068858_100005289 | |||
| 277 | Ga0068858_100213378 | |||
| 278 | Ga0068860_100000303 | |||
| 279 | Ga0068862_100004089 | |||
| 280 | Ga0097620_100033735 | |||
| 281 | Ga0105240_10134404 | |||
| 282 | Ga0105248_10216586 | |||
| 283 | Ga0105237_10092203 | |||
| 284 | Ga0105238_10047582 | |||
| 285 | Ga0105238_10403796 | |||
| 286 | Ga0105249_10001473 | |||
| 287 | Ga0105239_10610884 | |||
| 288 | Ga0157370_10020954 | |||
| 289 | Ga0157370_10078257 | |||
| 290 | Ga0157370_10102040 | |||
| 291 | Ga0157369_10173276 | |||
| 292 | Ga0157374_10177052 | |||
| 293 | Ga0163162_10160884 | |||
| 294 | Ga0163162_10244278 | |||
| 295 | Ga0157372_10184317 | |||
| 296 | Ga0157372_10246605 | |||
| 297 | Ga0157375_10069556 | |||
| 298 | Ga0213872_10050947 | |||
| 299 | Ga0213876_10000933 | |||
| 300 | Ga0213876_10001617 | |||
| 301 | Ga0213876_10017756 | |||
| 302 | Ga0209436_100015 | |||
| 303 | Ga0207425_1002373 | |||
| 304 | Ga0209129_1001214 | |||
| 305 | Ga0209130_1000051 | |||
| 306 | Ga0209676_1000072 | |||
| 307 | Ga0209025_1011106 | |||
| 308 | Ga0209758_1000154 | |||
| 309 | Ga0209050_1000077 | |||
| 310 | Ga0207426_1000043 | |||
| 311 | Ga0207426_1015117 | |||
| 312 | Ga0209257_1000088 | |||
| 313 | Ga0209257_1030194 | |||
| 314 | Ga0207680_10078498 | |||
| 315 | Ga0207705_10000005 | |||
| 316 | Ga0207705_10040696 | |||
| 317 | Ga0207705_10149643 | |||
| 318 | Ga0207695_10102813 | |||
| 319 | Ga0207660_10011983 | |||
| 320 | Ga0207657_10000477 | |||
| 321 | Ga0207657_10032016 | |||
| 322 | Ga0207652_10004499 | |||
| 323 | Ga0207694_10017345 | |||
| 324 | Ga0207694_10301243 | |||
| 325 | Ga0207650_10000161 | |||
| 326 | Ga0207644_10073991 | |||
| 327 | Ga0207690_10002589 | |||
| 328 | Ga0207690_10002843 | |||
| 329 | Ga0207690_10072314 | |||
| 330 | Ga0207706_10130521 | |||
| 331 | Ga0207711_10080580 | |||
| 332 | Ga0207711_10150187 | |||
| 333 | Ga0207667_10005260 | |||
| 334 | Ga0207667_10027279 | |||
| 335 | Ga0207667_10063950 | |||
| 336 | Ga0207712_10002142 | |||
| 337 | Ga0207668_10000323 | |||
| 338 | Ga0207658_10000988 | |||
| 339 | Ga0207703_10000968 | |||
| 340 | Ga0207703_10396059 | |||
| 341 | Ga0207641_10006602 | |||
| 342 | Ga0207676_10000685 | |||
| 343 | Ga0207676_10000987 | |||
| 344 | Ga0207674_10153526 | |||
| 345 | Ga0207674_10217582 | |||
| 346 | Ga0207683_10086506 | |||
| 347 | Ga0207698_10438823 | |||
| 348 | Ga0268266_10010699 | |||
| 349 | Ga0268265_10002542 | |||
| 350 | Ga0268264_10000059 | |||
| 351 | Ga0265338_10143574 | |||
| 352 | Ga0307410_10195354 | |||
| 353 | Ga0307409_100311997 | |||
| 354 | Ga0307414_10109727 | |||
| 355 | Ga0307411_10047478 | |||
| 356 | Ga0395899_0000486 | |||
| 357 | Ga0395900_0000008 | |||
| 358 | Ga0395900_0176672 | |||
| 359 | Ga0395898_0020955 | |||
| 360 | Ga0395905_0001224 | |||
| 361 | Ga0395905_0011963 | |||
| 362 | Ga0395905_0018448 | |||
| 363 | Ga0395905_0025829 | |||
| 364 | Ga0395901_0000008 | |||
| 365 | Ga0395901_0035141 | |||
| 366 | Ga0395901_0077221 | |||
| 367 | Ga0436365_0029381 | |||
| 368 | Ga0436365_0498837 | |||
| 369 | Ga0436365_0732709 | |||
| 370 | Ga0436365_1557449 | |||
| 371 | Ga0436365_1639497 | |||
| 372 | Ga0436365_1675136 | |||
| 373 | Ga0436361_0977157 | |||
| 374 | Ga0436361_1183726 | |||
| 375 | Ga0436363_0409721 | |||
| 376 | Ga0439448_0015632 | |||
| 377 | Ga0466969_0003262 | |||
| 378 | Ga0466966_0004348 | |||
| 379 | Ga0466963_0019241 | |||
| 380 | Ga0466963_0157091 | |||
| 381 | Ga0466964_0055663 | |||
| 382 | Ga0466971_0001280 | |||
| 383 | Ga0466971_0190877 | |||
| 384 | Ga0466970_0000129 | |||
| 385 | Ga0466970_0006429 | |||
| 386 | Ga0466957_0005957 | |||
| 387 | Ga0466959_0009958 | |||
| 388 | Ga0466959_0022849 | |||
| 389 | Ga0466959_0138343 | |||
| 390 | Ga0466959_0214584 | |||
| 391 | Ga0466958_0002312 | |||
| 392 | Ga0466958_0025844 | |||
| 393 | Ga0466967_0182438 | |||
| 394 | Ga0495592_0063408 | |||
| 395 | Ga0495630_0111206 | |||
| 396 | Ga0495642_0022811 | |||
| 397 | Ga0495645_0043665 | |||
| 398 | Ga0495611_0006190 | |||
| 399 | Ga0495669_0027469 | |||
| 400 | Ga0495581_0126722 | |||
| 401 | Ga0495674_0046582 | |||
| 402 | Ga0496102_0011792 | |||
| 403 | Ga0496107_0054436 | |||
| 404 | Ga0496108_0020239 | |||
| 405 | Ga0496109_0056841 | |||
| 406 | Ga0496115_0225539 | |||
| 407 | Ga0496124_0405367 | |||
| 408 | Ga0496125_0077544 | |||
| 409 | Ga0501032_0001426 | |||
| 410 | Ga0501033_0000690 | |||
| 411 | Ga0501033_0267568 | |||
| 412 | Ga0501033_0322591 | |||
| 413 | Ga0501034_0031150 | |||
| 414 | Ga0501038_0000623 | |||
| 415 | Ga0501043_0038568 | |||
| 416 | Ga0501046_0008636 | |||
| 417 | Ga0501046_0410039 | |||
| 418 | Ga0501047_0029010 | |||
| 419 | Ga0501047_0100693 | |||
| 420 | Ga0501048_0111562 | |||
| 421 | Ga0501068_0004827 | |||
| 422 | Ga0501069_0002436 | |||
| 423 | Ga0501070_0083478 | |||
| 424 | Ga0501070_0389767 | |||
| 425 | Ga0501073_0011746 | |||
| 426 | Ga0501074_0084024 | |||
| 427 | Ga0501080_0008977 | |||
| 428 | Ga0501080_0019691 | |||
| 429 | Ga0501080_0694361 | |||
| 430 | Ga0501083_0013644 | |||
| 431 | Ga0501035_0023461 | |||
| 432 | Ga0501035_0047990 | |||
| 433 | Ga0501044_0130185 | |||
| 434 | Ga0501044_0205733 | |||
| 435 | Ga0500647_0020942 | |||
| 436 | Ga0587073_0003559 | |||
| 437 | Ga0587080_008446 | |||
| 438 | Ga0587083_0003573 | |||
| 439 | Ga0587088_001541 | |||
| 440 | Ga0587091_002927 | |||
| 441 | Ga0587106_001203 | |||
| 442 | Ga0587069_001382 | |||
| 443 | Ga0587072_011655 | |||
| 444 | Ga0587079_011252 | |||
| 445 | Ga0587107_001025 | |||
| 446 | Ga0501082_0004475 | |||
| 447 | Ga0466962_0002154 | |||
| 448 | Ga0466962_0099629 | |||
| 449 | 2524461604 | |||
| 450 | 2842303184 | |||
| 451 | 2842361474 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cyw-assembly1.cif.gz_A | quinol oxidase (periplasmic fragment of subunit ii) (cyoa) | 0.8881 | 130 | 281 |
| 1cyx-assembly1.cif.gz_A | quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) | 0.8774 | 130 | 283 |
| 1cyx-assembly1.cif.gz_A | quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) | 0.8518 | 130 | 283 |
| 4txv-assembly2.cif.gz_D | crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) | 0.8512 | 125 | 243 |
| 7w5z-assembly1.cif.gz_c2 | cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model | 0.8495 | 157 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZJ9_108_266_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9264 | 123 | 268 | 2.60.40.420 |
| af_P0ABJ1_113_282_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9088 | 120 | 283 | 2.60.40.420 |
| 5wehH02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9019 | 132 | 239 | 2.60.40.420 |
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8883 | 157 | 237 | 2.60.40.420 |
| af_Q8I6V2_60_165_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8769 | 157 | 236 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434RHB5-F1-model_v4 | Cytochrome ubiquinol oxidase subunit II | 0.9255 | 127 | 293 |
GO:0004129
GO:0005507 GO:0005886 GO:0009486 GO:0042773 |
| AF-A0A352S8I1-F1-model_v4 | Cytochrome ubiquinol oxidase subunit II | 0.9161 | 141 | 271 |
GO:0004129
GO:0005507 GO:0005886 GO:0009486 GO:0042597 GO:0042773 |
| AF-N4WHP0-F1-model_v4 | Cytochrome aa3 quinol oxidase subunit II | 0.9116 | 114 | 268 |
GO:0004129
GO:0005507 GO:0005886 GO:0042773 |
| AF-A0A4Q5QGS3-F1-model_v4 | Cytochrome ubiquinol oxidase subunit II | 0.9078 | 127 | 279 |
GO:0004129
GO:0005507 GO:0005886 GO:0009486 GO:0042773 |
| AF-A0A4P0YUJ1-F1-model_v4 | deleted | 0.906 | 109 | 257 |
|