F337483

General Info

Members Datasets Scaffolds Average Seq Length
225 158 451 301

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100016729|Ga0070659_1000167295
Length 317
Sequence MTVETGGVTATFSTREGDGGRPVRMALAAALXXXAAGCSGRSIFDSVGPVGRDDSRILIDATLIMLAIVVPTILLAFWMAWRYRASNTKAEYLPYWSYSGRIEAVVWSIPILTIMFIGGVIWIGSYRLDPFRPLSKTPPLEVQVVSLDWKWLFIYPQQGVATVNQLVVPAGRPVHFSITSASVFNTFFVPRLGSMIYAMPGMVSQLHLQADRPATMWGTSAMFSGDGFSDMQFQVRSVADADFAAWAAGARGGGPVLDSAAYAQLAKQSHNVPPISFRAVDPKLFDAVATQKIPPAPGPEPENASHAGREVTPAGRH

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
144 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
157 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
158 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 4.44
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.33
Nodule 1.33
Rhizoplane 2.22
Rhizosphere 78.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100016729 3300005366 Bacteria 5510
2 JGI25159J45721_1001046 3300002987 Bacteria 11822
3 JGI25153J46596_10000135 3300003215 Bacteria 79035
4 rootH1_10023539 3300003316 Bacteria 2801
5 rootH1_10023539 3300003323 Bacteria 2479
6 rootH1_10048351 3300003316 Bacteria 2663
7 rootH2_10180170 3300003320 Bacteria 3980
8 rootH2_10215989 3300003320 Bacteria 2175
9 rootL2_10055523 3300003322 Bacteria 6212
10 rootH1_10045659 3300003323 Bacteria 10729
11 rootH1_10077879 3300003323 Bacteria 4928
12 JGI25161J50226_1000029 3300003374 Bacteria 144998
13 Ga0055536_1000023 3300003781 Bacteria 191663
14 Ga0055528_1021747 3300003790 Bacteria 2021
15 Ga0055530_10001605 3300003791 Bacteria 16215
16 Ga0055531_10000057 3300003794 Bacteria 122232
17 Ga0055543_1000016 3300004625 Bacteria 176117
18 Ga0070658_10000003 3300005327 Bacteria 465963
19 Ga0070658_10242998 3300005327 Bacteria 1526
20 Ga0070670_100000039 3300005331 Bacteria 152618
21 Ga0070666_10013752 3300005335 Bacteria 5139
22 Ga0070680_100120905 3300005336 Bacteria 2186
23 Ga0070680_100497355 3300005336 Bacteria 1043
24 Ga0070660_100002579 3300005339 Bacteria 12431
25 Ga0070660_100219952 3300005339 Bacteria 1543
26 Ga0070692_10031506 3300005345 Bacteria 2658
27 Ga0070668_100071923 3300005347 Bacteria 2694
28 Ga0070671_100088385 3300005355 Bacteria 2593
29 Ga0070671_100110643 3300005355 Bacteria 2307
30 Ga0070659_100000111 3300005366 Bacteria 60284
31 Ga0070659_100002577 3300005366 Bacteria 12877
32 Ga0070667_100008540 3300005367 Bacteria 8490
33 Ga0070678_100199920 3300005456 Bacteria 1649
34 Ga0070681_10250355 3300005458 Bacteria 1684
35 Ga0070679_100209502 3300005530 Bacteria 1913
36 Ga0070679_100355455 3300005530 Bacteria 1412
37 Ga0070684_100027691 3300005535 Bacteria 4786
38 Ga0070686_100000143 3300005544 Bacteria 49208
39 Ga0070665_100012715 3300005548 Bacteria 8478
40 Ga0068855_100031358 3300005563 Bacteria 6347
41 Ga0068855_100040613 3300005563 Bacteria 5521
42 Ga0068855_100041204 3300005563 Bacteria 5474
43 Ga0068855_100205348 3300005563 Bacteria 2217
44 Ga0068854_100112441 3300005578 Bacteria 2056
45 Ga0068859_100033735 3300005617 Bacteria 5139
46 Ga0068864_100000068 3300005618 Bacteria 115507
47 Ga0068864_100026246 3300005618 Bacteria 4912
48 Ga0068864_100424869 3300005618 Bacteria 1267
49 Ga0068863_100000758 3300005841 Bacteria 32348
50 Ga0068863_100123733 3300005841 Bacteria 2467
51 Ga0068858_100005289 3300005842 Bacteria 12653
52 Ga0068858_100213378 3300005842 Bacteria 1827
53 Ga0068860_100000303 3300005843 Bacteria 68443
54 Ga0068862_100004089 3300005844 Bacteria 12372
55 Ga0097620_100033735 3300006931 Bacteria 5139
56 Ga0105240_10134404 3300009093 Bacteria 2963
57 Ga0105248_10216586 3300009177 Bacteria 2157
58 Ga0105237_10092203 3300009545 Bacteria 3019
59 Ga0105238_10047582 3300009551 Bacteria 4323
60 Ga0105238_10403796 3300009551 Bacteria 1360
61 Ga0105249_10001473 3300009553 Bacteria 20639
62 Ga0105239_10610884 3300010375 Bacteria 1244
63 Ga0157370_10020954 3300013104 Bacteria 6520
64 Ga0157370_10078257 3300013104 Bacteria 3114
65 Ga0157370_10102040 3300013104 Bacteria 2687
66 Ga0157369_10173276 3300013105 Bacteria 2272
67 Ga0157374_10177052 3300013296 Bacteria 2082
68 Ga0163162_10160884 3300013306 Bacteria 2367
69 Ga0163162_10244278 3300013306 Bacteria 1927
70 Ga0157372_10184317 3300013307 Bacteria 2417
71 Ga0157372_10246605 3300013307 Bacteria 2073
72 Ga0157375_10069556 3300013308 Bacteria 3527
73 Ga0213872_10050947 3300021361 Bacteria 1879
74 Ga0213876_10000933 3300021384 Bacteria 19342
75 Ga0213876_10001617 3300021384 Bacteria 13795
76 Ga0213876_10017756 3300021384 Bacteria 3754
77 Ga0209436_100015 3300025208 Bacteria 126026
78 Ga0207425_1002373 3300025245 Bacteria 6702
79 Ga0209129_1001214 3300025258 Bacteria 14807
80 Ga0209130_1000051 3300025284 Bacteria 220482
81 Ga0209676_1000072 3300025292 Bacteria 307347
82 Ga0209025_1011106 3300025294 Bacteria 5995
83 Ga0209758_1000154 3300025297 Bacteria 161260
84 Ga0209050_1000077 3300025298 Bacteria 278985
85 Ga0207426_1000043 3300025302 Bacteria 432827
86 Ga0207426_1015117 3300025302 Bacteria 2808
87 Ga0209257_1000088 3300025304 Bacteria 279014
88 Ga0209257_1030194 3300025304 Bacteria 1753
89 Ga0207680_10078498 3300025903 Bacteria 2068
90 Ga0207705_10000005 3300025909 Bacteria 673478
91 Ga0207705_10040696 3300025909 Bacteria 3334
92 Ga0207705_10149643 3300025909 Bacteria 1749
93 Ga0207695_10102813 3300025913 Bacteria 2850
94 Ga0207660_10011983 3300025917 Bacteria 5661
95 Ga0207657_10000477 3300025919 Bacteria 42286
96 Ga0207657_10032016 3300025919 Bacteria 4756
97 Ga0207652_10004499 3300025921 Bacteria 11325
98 Ga0207694_10017345 3300025924 Bacteria 5444
99 Ga0207694_10301243 3300025924 Bacteria 1320
100 Ga0207650_10000161 3300025925 Bacteria 81097
101 Ga0207644_10073991 3300025931 Bacteria 2499
102 Ga0207690_10002589 3300025932 Bacteria 10920
103 Ga0207690_10002843 3300025932 Bacteria 10446
104 Ga0207690_10072314 3300025932 Bacteria 2381
105 Ga0207706_10130521 3300025933 Bacteria 2210
106 Ga0207711_10080580 3300025941 Bacteria 2844
107 Ga0207711_10150187 3300025941 Bacteria 2102
108 Ga0207667_10005260 3300025949 Bacteria 15788
109 Ga0207667_10027279 3300025949 Bacteria 6220
110 Ga0207667_10063950 3300025949 Bacteria 3843
111 Ga0207712_10002142 3300025961 Bacteria 12906
112 Ga0207668_10000323 3300025972 Bacteria 31013
113 Ga0207658_10000988 3300025986 Bacteria 23373
114 Ga0207703_10000968 3300026035 Bacteria 27762
115 Ga0207703_10396059 3300026035 Bacteria 1280
116 Ga0207641_10006602 3300026088 Bacteria 9747
117 Ga0207676_10000685 3300026095 Bacteria 26828
118 Ga0207676_10000987 3300026095 Bacteria 21898
119 Ga0207674_10153526 3300026116 Bacteria 2259
120 Ga0207674_10217582 3300026116 Bacteria 1858
121 Ga0207683_10086506 3300026121 Bacteria 2787
122 Ga0207698_10438823 3300026142 Bacteria 1257
123 Ga0268266_10010699 3300028379 Bacteria 7994
124 Ga0268265_10002542 3300028380 Bacteria 13655
125 Ga0268264_10000059 3300028381 Bacteria 306927
126 Ga0265338_10143574 3300028800 Bacteria 1866
127 Ga0307410_10195354 3300031852 Bacteria 1541
128 Ga0307409_100311997 3300031995 Bacteria 1468
129 Ga0307414_10109727 3300032004 Bacteria 2097
130 Ga0307411_10047478 3300032005 Bacteria 2776
131 Ga0395899_0000486 3300037312 Bacteria 44413
132 Ga0395900_0000008 3300037418 Bacteria 480459
133 Ga0395900_0176672 3300037418 Bacteria 2172
134 Ga0395898_0020955 3300037466 Bacteria 6632
135 Ga0395905_0001224 3300037471 Bacteria 31977
136 Ga0395905_0011963 3300037471 Bacteria 8366
137 Ga0395905_0018448 3300037471 Bacteria 6623
138 Ga0395905_0025829 3300037471 Bacteria 5537
139 Ga0395901_0000008 3300038443 Bacteria 495962
140 Ga0395901_0035141 3300038443 Bacteria 5179
141 Ga0395901_0077221 3300038443 Bacteria 3476
142 Ga0436365_0029381 3300039437 Bacteria 85595
143 Ga0436365_0498837 3300039437 Bacteria 16854
144 Ga0436365_0732709 3300039437 Bacteria 4074
145 Ga0436365_1557449 3300039437 Bacteria 15725
146 Ga0436365_1639497 3300039437 Bacteria 2532
147 Ga0436365_1675136 3300039437 Bacteria 18309
148 Ga0436361_0977157 3300039447 Bacteria 1835
149 Ga0436361_1183726 3300039447 Bacteria 4655
150 Ga0436363_0409721 3300039450 Bacteria 991
151 Ga0439448_0015632 3300042005 Bacteria 2301
152 Ga0466969_0003262 3300044656 Bacteria 8624
153 Ga0466966_0004348 3300044684 Bacteria 9343
154 Ga0466963_0019241 3300044694 Bacteria 4279
155 Ga0466963_0157091 3300044694 Bacteria 1582
156 Ga0466964_0055663 3300044706 Bacteria 1634
157 Ga0466971_0001280 3300044719 Bacteria 10492
158 Ga0466971_0190877 3300044719 Bacteria 965
159 Ga0466970_0000129 3300044765 Bacteria 34329
160 Ga0466970_0006429 3300044765 Bacteria 5876
161 Ga0466957_0005957 3300044842 Bacteria 6874
162 Ga0466959_0009958 3300045049 Bacteria 6775
163 Ga0466959_0022849 3300045049 Bacteria 4623
164 Ga0466959_0138343 3300045049 Bacteria 1722
165 Ga0466959_0214584 3300045049 Bacteria 1336
166 Ga0466958_0002312 3300045836 Bacteria 9506
167 Ga0466958_0025844 3300045836 Bacteria 3465
168 Ga0466967_0182438 3300045976 Bacteria 1980
169 Ga0495592_0063408 3300046454 Bacteria 2711
170 Ga0495630_0111206 3300046517 Bacteria 2075
171 Ga0495642_0022811 3300046528 Bacteria 2468
172 Ga0495645_0043665 3300046543 Bacteria 3270
173 Ga0495611_0006190 3300046648 Bacteria 5106
174 Ga0495669_0027469 3300046684 Bacteria 2490
175 Ga0495581_0126722 3300047315 Bacteria 1487
176 Ga0495674_0046582 3300047319 Bacteria 3848
177 Ga0496102_0011792 3300048905 Bacteria 7543
178 Ga0496107_0054436 3300048910 Bacteria 2888
179 Ga0496108_0020239 3300048911 Bacteria 5469
180 Ga0496109_0056841 3300048912 Bacteria 3570
181 Ga0496115_0225539 3300048918 Bacteria 1546
182 Ga0496124_0405367 3300048927 Bacteria 945
183 Ga0496125_0077544 3300048928 Bacteria 2561
184 Ga0501032_0001426 3300049569 Bacteria 18982
185 Ga0501033_0000690 3300049570 Bacteria 31241
186 Ga0501033_0267568 3300049570 Bacteria 1209
187 Ga0501033_0322591 3300049570 Bacteria 1085
188 Ga0501034_0031150 3300049571 Bacteria 5420
189 Ga0501038_0000623 3300049574 Bacteria 31603
190 Ga0501043_0038568 3300049579 Bacteria 3756
191 Ga0501046_0008636 3300049580 Bacteria 8857
192 Ga0501046_0410039 3300049580 Bacteria 978
193 Ga0501047_0029010 3300049581 Bacteria 5337
194 Ga0501047_0100693 3300049581 Bacteria 2769
195 Ga0501048_0111562 3300049582 Bacteria 1931
196 Ga0501068_0004827 3300049584 Bacteria 7339
197 Ga0501069_0002436 3300049585 Bacteria 9478
198 Ga0501070_0083478 3300049586 Bacteria 2644
199 Ga0501070_0389767 3300049586 Bacteria 1128
200 Ga0501073_0011746 3300049589 Bacteria 6395
201 Ga0501074_0084024 3300049590 Bacteria 2282
202 Ga0501080_0008977 3300049742 Bacteria 9095
203 Ga0501080_0019691 3300049742 Bacteria 6250
204 Ga0501080_0694361 3300049742 Bacteria 898
205 Ga0501083_0013644 3300049744 Bacteria 5681
206 Ga0501035_0023461 3300049822 Bacteria 5659
207 Ga0501035_0047990 3300049822 Bacteria 3830
208 Ga0501044_0130185 3300049823 Bacteria 2511
209 Ga0501044_0205733 3300049823 Bacteria 1925
210 Ga0500647_0020942 3300053091 Bacteria 3048
211 Ga0587073_0003559 3300059492 Bacteria 2148
212 Ga0587080_008446 3300059503 Bacteria 1476
213 Ga0587083_0003573 3300059505 Bacteria 2077
214 Ga0587088_001541 3300059508 Bacteria 2414
215 Ga0587091_002927 3300059511 Bacteria 2092
216 Ga0587106_001203 3300059605 Bacteria 2210
217 Ga0587069_001382 3300059642 Bacteria 2212
218 Ga0587072_011655 3300059643 Bacteria 1441
219 Ga0587079_011252 3300059647 Bacteria 1436
220 Ga0587107_001025 3300059652 Bacteria 2126
221 Ga0501082_0004475 3300060353 Bacteria 12205
222 Ga0466962_0002154 3300061719 Bacteria 9309
223 Ga0466962_0099629 3300061719 Bacteria 1395
224 2524461604 2524023209 Bacteria 6679728
225 2842303184 2842298080 Bacteria 6123127
226 2842361474 2842357229 Bacteria 6485165
227 Ga0070659_100016729
228 JGI25159J45721_1001046
229 JGI25153J46596_10000135
230 rootH1_10023539
231 rootH1_10048351
232 rootH2_10180170
233 rootH2_10215989
234 rootL2_10055523
235 rootH1_10045659
236 rootH1_10077879
237 JGI25161J50226_1000029
238 Ga0055536_1000023
239 Ga0055528_1021747
240 Ga0055530_10001605
241 Ga0055531_10000057
242 Ga0055543_1000016
243 Ga0070658_10000003
244 Ga0070658_10242998
245 Ga0070670_100000039
246 Ga0070666_10013752
247 Ga0070680_100120905
248 Ga0070680_100497355
249 Ga0070660_100002579
250 Ga0070660_100219952
251 Ga0070692_10031506
252 Ga0070668_100071923
253 Ga0070671_100088385
254 Ga0070671_100110643
255 Ga0070659_100000111
256 Ga0070659_100002577
257 Ga0070667_100008540
258 Ga0070678_100199920
259 Ga0070681_10250355
260 Ga0070679_100209502
261 Ga0070679_100355455
262 Ga0070684_100027691
263 Ga0070686_100000143
264 Ga0070665_100012715
265 Ga0068855_100031358
266 Ga0068855_100040613
267 Ga0068855_100041204
268 Ga0068855_100205348
269 Ga0068854_100112441
270 Ga0068859_100033735
271 Ga0068864_100000068
272 Ga0068864_100026246
273 Ga0068864_100424869
274 Ga0068863_100000758
275 Ga0068863_100123733
276 Ga0068858_100005289
277 Ga0068858_100213378
278 Ga0068860_100000303
279 Ga0068862_100004089
280 Ga0097620_100033735
281 Ga0105240_10134404
282 Ga0105248_10216586
283 Ga0105237_10092203
284 Ga0105238_10047582
285 Ga0105238_10403796
286 Ga0105249_10001473
287 Ga0105239_10610884
288 Ga0157370_10020954
289 Ga0157370_10078257
290 Ga0157370_10102040
291 Ga0157369_10173276
292 Ga0157374_10177052
293 Ga0163162_10160884
294 Ga0163162_10244278
295 Ga0157372_10184317
296 Ga0157372_10246605
297 Ga0157375_10069556
298 Ga0213872_10050947
299 Ga0213876_10000933
300 Ga0213876_10001617
301 Ga0213876_10017756
302 Ga0209436_100015
303 Ga0207425_1002373
304 Ga0209129_1001214
305 Ga0209130_1000051
306 Ga0209676_1000072
307 Ga0209025_1011106
308 Ga0209758_1000154
309 Ga0209050_1000077
310 Ga0207426_1000043
311 Ga0207426_1015117
312 Ga0209257_1000088
313 Ga0209257_1030194
314 Ga0207680_10078498
315 Ga0207705_10000005
316 Ga0207705_10040696
317 Ga0207705_10149643
318 Ga0207695_10102813
319 Ga0207660_10011983
320 Ga0207657_10000477
321 Ga0207657_10032016
322 Ga0207652_10004499
323 Ga0207694_10017345
324 Ga0207694_10301243
325 Ga0207650_10000161
326 Ga0207644_10073991
327 Ga0207690_10002589
328 Ga0207690_10002843
329 Ga0207690_10072314
330 Ga0207706_10130521
331 Ga0207711_10080580
332 Ga0207711_10150187
333 Ga0207667_10005260
334 Ga0207667_10027279
335 Ga0207667_10063950
336 Ga0207712_10002142
337 Ga0207668_10000323
338 Ga0207658_10000988
339 Ga0207703_10000968
340 Ga0207703_10396059
341 Ga0207641_10006602
342 Ga0207676_10000685
343 Ga0207676_10000987
344 Ga0207674_10153526
345 Ga0207674_10217582
346 Ga0207683_10086506
347 Ga0207698_10438823
348 Ga0268266_10010699
349 Ga0268265_10002542
350 Ga0268264_10000059
351 Ga0265338_10143574
352 Ga0307410_10195354
353 Ga0307409_100311997
354 Ga0307414_10109727
355 Ga0307411_10047478
356 Ga0395899_0000486
357 Ga0395900_0000008
358 Ga0395900_0176672
359 Ga0395898_0020955
360 Ga0395905_0001224
361 Ga0395905_0011963
362 Ga0395905_0018448
363 Ga0395905_0025829
364 Ga0395901_0000008
365 Ga0395901_0035141
366 Ga0395901_0077221
367 Ga0436365_0029381
368 Ga0436365_0498837
369 Ga0436365_0732709
370 Ga0436365_1557449
371 Ga0436365_1639497
372 Ga0436365_1675136
373 Ga0436361_0977157
374 Ga0436361_1183726
375 Ga0436363_0409721
376 Ga0439448_0015632
377 Ga0466969_0003262
378 Ga0466966_0004348
379 Ga0466963_0019241
380 Ga0466963_0157091
381 Ga0466964_0055663
382 Ga0466971_0001280
383 Ga0466971_0190877
384 Ga0466970_0000129
385 Ga0466970_0006429
386 Ga0466957_0005957
387 Ga0466959_0009958
388 Ga0466959_0022849
389 Ga0466959_0138343
390 Ga0466959_0214584
391 Ga0466958_0002312
392 Ga0466958_0025844
393 Ga0466967_0182438
394 Ga0495592_0063408
395 Ga0495630_0111206
396 Ga0495642_0022811
397 Ga0495645_0043665
398 Ga0495611_0006190
399 Ga0495669_0027469
400 Ga0495581_0126722
401 Ga0495674_0046582
402 Ga0496102_0011792
403 Ga0496107_0054436
404 Ga0496108_0020239
405 Ga0496109_0056841
406 Ga0496115_0225539
407 Ga0496124_0405367
408 Ga0496125_0077544
409 Ga0501032_0001426
410 Ga0501033_0000690
411 Ga0501033_0267568
412 Ga0501033_0322591
413 Ga0501034_0031150
414 Ga0501038_0000623
415 Ga0501043_0038568
416 Ga0501046_0008636
417 Ga0501046_0410039
418 Ga0501047_0029010
419 Ga0501047_0100693
420 Ga0501048_0111562
421 Ga0501068_0004827
422 Ga0501069_0002436
423 Ga0501070_0083478
424 Ga0501070_0389767
425 Ga0501073_0011746
426 Ga0501074_0084024
427 Ga0501080_0008977
428 Ga0501080_0019691
429 Ga0501080_0694361
430 Ga0501083_0013644
431 Ga0501035_0023461
432 Ga0501035_0047990
433 Ga0501044_0130185
434 Ga0501044_0205733
435 Ga0500647_0020942
436 Ga0587073_0003559
437 Ga0587080_008446
438 Ga0587083_0003573
439 Ga0587088_001541
440 Ga0587091_002927
441 Ga0587106_001203
442 Ga0587069_001382
443 Ga0587072_011655
444 Ga0587079_011252
445 Ga0587107_001025
446 Ga0501082_0004475
447 Ga0466962_0002154
448 Ga0466962_0099629
449 2524461604
450 2842303184
451 2842361474

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

113

238

0.91

PF06481

COX_ARM

COX Aromatic Rich Motif

251

295

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.8881 130 281
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.8774 130 283
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.8518 130 283
4txv-assembly2.cif.gz_D crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) 0.8512 125 243
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.8495 157 239
ID Description Score Start End Superfamily
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9264 123 268 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9088 120 283 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9019 132 239 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8883 157 237 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8769 157 236 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A434RHB5-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.9255 127 293 GO:0004129
GO:0005507
GO:0005886
GO:0009486
GO:0042773
AF-A0A352S8I1-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.9161 141 271 GO:0004129
GO:0005507
GO:0005886
GO:0009486
GO:0042597
GO:0042773
AF-N4WHP0-F1-model_v4 Cytochrome aa3 quinol oxidase subunit II 0.9116 114 268 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A4Q5QGS3-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.9078 127 279 GO:0004129
GO:0005507
GO:0005886
GO:0009486
GO:0042773
AF-A0A4P0YUJ1-F1-model_v4 deleted 0.906 109 257

Map