F337704

General Info

Members Datasets Scaffolds Average Seq Length
225 148 450 196

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10272216|Ga0111539_102722162
Length 213
Sequence MDSIQTKVGKVGATCFSPKFVAMIRMLFLPLIIFFVCCSTTDKNTHVEIRTSIGSIEVELYPDKAPNSVAAFLSYVDSGFYENTSFYRVLTDQNQPSDAFKSNLIQGGLWRTGRRKNLTGIPHEPTNQTGIQHKNGVISLARLEPGTATTEFFICIGDQPGYDYGGENNPDKQGYAAFGRVVKGMDIVNRIYQLNESDQYFDPPVPIYNITRK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
140 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
146 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 0
Rhizoplane 0
Rhizosphere 79.11
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10272216 3300009094 Bacteria 1971
2 rootH1_10091706 3300003316 Bacteria 2788
3 rootL2_10056000 3300003322 Bacteria 1945
4 rootL2_10361385 3300003322 Bacteria 1942
5 rootH1_10011869 3300003323 Bacteria 39408
6 rootH1_10093894 3300003323 Unclassified 3113
7 rootH1_10195167 3300003323 Bacteria 2318
8 rootH1_10200213 3300003323 Bacteria 1725
9 Ga0070658_10177171 3300005327 Bacteria 1793
10 Ga0070670_100695525 3300005331 Bacteria 914
11 Ga0070666_10000101 3300005335 Bacteria 58900
12 Ga0068868_100346591 3300005338 Bacteria 1271
13 Ga0070689_100121754 3300005340 Bacteria 2084
14 Ga0070661_100123293 3300005344 Bacteria 1942
15 Ga0070671_100349341 3300005355 Bacteria 1262
16 Ga0070674_100060304 3300005356 Bacteria 2644
17 Ga0070659_100268854 3300005366 Bacteria 1416
18 Ga0070667_100122113 3300005367 Bacteria 2266
19 Ga0068867_100552716 3300005459 Bacteria 997
20 Ga0070684_101026180 3300005535 Bacteria 774
21 Ga0070672_100650045 3300005543 Bacteria 921
22 Ga0070665_100000002 3300005548 Bacteria 849037
23 Ga0068855_100028799 3300005563 Bacteria 6645
24 Ga0068855_100066611 3300005563 Bacteria 4199
25 Ga0068855_100105097 3300005563 Bacteria 3247
26 Ga0068857_100006960 3300005577 Bacteria 9734
27 Ga0068857_100234873 3300005577 Bacteria 1677
28 Ga0068854_100017672 3300005578 Unclassified 4776
29 Ga0068856_100022494 3300005614 Bacteria 6130
30 Ga0068852_100002505 3300005616 Bacteria 12646
31 Ga0068852_100125840 3300005616 Bacteria 2353
32 Ga0068852_101232647 3300005616 Bacteria 769
33 Ga0068859_100000007 3300005617 Bacteria 390070
34 Ga0068859_100951632 3300005617 Bacteria 942
35 Ga0068864_100033096 3300005618 Bacteria 4394
36 Ga0068861_100082686 3300005719 Bacteria 2517
37 Ga0068863_100042265 3300005841 Bacteria 4331
38 Ga0068858_100014543 3300005842 Bacteria 7415
39 Ga0068860_100000003 3300005843 Bacteria 575741
40 Ga0068860_100141794 3300005843 Unclassified 2310
41 Ga0068862_100157335 3300005844 Bacteria 2026
42 Ga0068862_100555474 3300005844 Bacteria 1097
43 Ga0081455_10424504 3300005937 Bacteria 916
44 Ga0075366_10155297 3300006195 Bacteria 1386
45 Ga0097621_100015725 3300006237 Bacteria 5702
46 Ga0097621_100068359 3300006237 Bacteria 2930
47 Ga0097621_100519762 3300006237 Bacteria 1080
48 Ga0068871_100041939 3300006358 Bacteria 3671
49 Ga0068871_100449625 3300006358 Bacteria 1154
50 Ga0068865_100577425 3300006881 Bacteria 947
51 Ga0097620_100000007 3300006931 Bacteria 390070
52 Ga0097620_100951705 3300006931 Bacteria 942
53 Ga0105240_10020206 3300009093 Bacteria 8890
54 Ga0105240_10110096 3300009093 Bacteria 3334
55 Ga0105240_11157108 3300009093 Unclassified 821
56 Ga0111539_10528227 3300009094 Unclassified 1375
57 Ga0105245_10162185 3300009098 Bacteria 2122
58 Ga0105247_10017643 3300009101 Bacteria 4281
59 Ga0114129_10008068 3300009147 Bacteria 15001
60 Ga0105243_10255724 3300009148 Bacteria 1566
61 Ga0105241_10000622 3300009174 Bacteria 26623
62 Ga0105241_10000649 3300009174 Bacteria 26087
63 Ga0105241_10031204 3300009174 Bacteria 3989
64 Ga0105241_10091242 3300009174 Bacteria 2403
65 Ga0105242_11239621 3300009176 Bacteria 767
66 Ga0105237_10000553 3300009545 Bacteria 52367
67 Ga0105237_10001595 3300009545 Bacteria 29470
68 Ga0105237_10013341 3300009545 Bacteria 8620
69 Ga0105237_11421859 3300009545 Bacteria 700
70 Ga0105238_10023246 3300009551 Bacteria 6318
71 Ga0105238_10079136 3300009551 Unclassified 3277
72 Ga0105249_10583411 3300009553 Bacteria 1171
73 Ga0105249_11331627 3300009553 Bacteria 790
74 Ga0105239_10000746 3300010375 Bacteria 46202
75 Ga0105239_10089080 3300010375 Bacteria 3403
76 Ga0105239_10101724 3300010375 Unclassified 3179
77 Ga0105239_10166627 3300010375 Bacteria 2464
78 Ga0105246_10050969 3300011119 Bacteria 2841
79 Ga0105246_10182103 3300011119 Bacteria 1618
80 Ga0157373_10262052 3300013100 Unclassified 1223
81 Ga0157371_10002722 3300013102 Bacteria 16650
82 Ga0157371_10039731 3300013102 Bacteria 3364
83 Ga0157370_10015629 3300013104 Bacteria 7710
84 Ga0157370_10042686 3300013104 Bacteria 4369
85 Ga0157369_10110480 3300013105 Bacteria 2922
86 Ga0157374_10217658 3300013296 Unclassified 1874
87 Ga0157378_10019593 3300013297 Bacteria 5947
88 Ga0157378_10983364 3300013297 Bacteria 877
89 Ga0163162_10000712 3300013306 Bacteria 30828
90 Ga0163162_10695427 3300013306 Bacteria 1139
91 Ga0157372_10006426 3300013307 Bacteria 12511
92 Ga0157372_10078561 3300013307 Bacteria 3729
93 Ga0157372_10308178 3300013307 Bacteria 1843
94 Ga0157372_10512377 3300013307 Unclassified 1399
95 Ga0157375_10011496 3300013308 Bacteria 7820
96 Ga0163163_10794861 3300014325 Bacteria 1009
97 Ga0157376_10000780 3300014969 Bacteria 20811
98 Ga0157376_10550496 3300014969 Bacteria 1142
99 Ga0209646_1005857 3300025246 Bacteria 2110
100 Ga0207656_10313695 3300025321 Bacteria 778
101 Ga0207710_10013895 3300025900 Bacteria 3390
102 Ga0207680_10000015 3300025903 Bacteria 138253
103 Ga0207647_10007605 3300025904 Bacteria 7808
104 Ga0207647_10025812 3300025904 Bacteria 3852
105 Ga0207654_10003278 3300025911 Bacteria 8185
106 Ga0207654_10052252 3300025911 Bacteria 2355
107 Ga0207654_10347943 3300025911 Bacteria 1020
108 Ga0207707_10426084 3300025912 Unclassified 1137
109 Ga0207695_10003629 3300025913 Bacteria 21576
110 Ga0207695_10483794 3300025913 Unclassified 1120
111 Ga0207695_10774417 3300025913 Bacteria 840
112 Ga0207671_10001648 3300025914 Bacteria 25416
113 Ga0207671_10003155 3300025914 Bacteria 16685
114 Ga0207671_10004517 3300025914 Bacteria 13236
115 Ga0207671_10004537 3300025914 Bacteria 13192
116 Ga0207671_10020007 3300025914 Bacteria 5106
117 Ga0207671_10029591 3300025914 Bacteria 4089
118 Ga0207649_10604362 3300025920 Unclassified 844
119 Ga0207694_10007871 3300025924 Bacteria 8069
120 Ga0207694_10031411 3300025924 Bacteria 4057
121 Ga0207650_10058030 3300025925 Bacteria 2881
122 Ga0207650_10265212 3300025925 Bacteria 1394
123 Ga0207650_10939198 3300025925 Bacteria 735
124 Ga0207687_10297019 3300025927 Unclassified 1300
125 Ga0207644_10169600 3300025931 Bacteria 1703
126 Ga0207690_10307355 3300025932 Bacteria 1243
127 Ga0207686_10518224 3300025934 Bacteria 927
128 Ga0207669_10522298 3300025937 Bacteria 953
129 Ga0207691_10188755 3300025940 Bacteria 1798
130 Ga0207689_10003450 3300025942 Bacteria 14436
131 Ga0207667_10001058 3300025949 Bacteria 34902
132 Ga0207667_10087937 3300025949 Bacteria 3214
133 Ga0207667_10129137 3300025949 Bacteria 2603
134 Ga0207651_10265866 3300025960 Bacteria 1410
135 Ga0207712_10568200 3300025961 Bacteria 977
136 Ga0207668_10563587 3300025972 Bacteria 988
137 Ga0207640_10009598 3300025981 Bacteria 5425
138 Ga0207703_10000798 3300026035 Bacteria 31051
139 Ga0207639_10197016 3300026041 Bacteria 1725
140 Ga0207702_10024287 3300026078 Bacteria 5029
141 Ga0207702_10188488 3300026078 Bacteria 1904
142 Ga0207641_10000056 3300026088 Bacteria 170719
143 Ga0207676_10035456 3300026095 Bacteria 3786
144 Ga0207674_10004281 3300026116 Bacteria 17213
145 Ga0207675_100156943 3300026118 Bacteria 2168
146 Ga0207675_100753117 3300026118 Bacteria 985
147 Ga0207698_10002611 3300026142 Bacteria 10713
148 Ga0207698_10043182 3300026142 Bacteria 3376
149 Ga0268266_10000073 3300028379 Bacteria 232074
150 Ga0268265_10305989 3300028380 Bacteria 1433
151 Ga0268264_10000063 3300028381 Bacteria 301702
152 Ga0268264_10123165 3300028381 Unclassified 2288
153 Ga0268264_10384547 3300028381 Bacteria 1345
154 Ga0307517_10176074 3300028786 Bacteria 1393
155 Ga0307515_10000078 3300028794 Bacteria 227988
156 Ga0307511_10000418 3300030521 Bacteria 45353
157 Ga0307513_10056303 3300031456 Bacteria 4199
158 Ga0307513_10701356 3300031456 Bacteria 718
159 Ga0307509_10090724 3300031507 Bacteria 3130
160 Ga0307509_10103560 3300031507 Bacteria 2874
161 Ga0307509_10153481 3300031507 Bacteria 2213
162 Ga0307508_10000763 3300031616 Bacteria 38032
163 Ga0307510_10002127 3300033180 Bacteria 22383
164 Ga0373927_0188447 3300035695 Bacteria 1353
165 Ga0395899_0109412 3300037312 Bacteria 1988
166 Ga0395900_0189264 3300037418 Bacteria 2088
167 Ga0395905_0237681 3300037471 Bacteria 1703
168 Ga0395901_0038229 3300038443 Bacteria 4964
169 Ga0436365_1837098 3300039437 Bacteria 29699
170 Ga0439436_0009333 3300041404 Bacteria 3007
171 Ga0439439_0007913 3300041406 Bacteria 2499
172 Ga0451841_0364258 3300041498 Bacteria 1381
173 Ga0439457_004560 3300042014 Bacteria 3594
174 Ga0439457_076904 3300042014 Bacteria 765
175 Ga0439462_0003813 3300042015 Bacteria 3637
176 Ga0466969_0000371 3300044656 Bacteria 24624
177 Ga0466972_0000069 3300044658 Bacteria 100746
178 Ga0466972_0000075 3300044658 Bacteria 94290
179 Ga0466972_0012429 3300044658 Bacteria 4279
180 Ga0466966_0000131 3300044684 Bacteria 48304
181 Ga0466964_0196014 3300044706 Bacteria 967
182 Ga0466971_0043056 3300044719 Bacteria 2029
183 Ga0466968_0254426 3300044735 Bacteria 835
184 Ga0466970_0001235 3300044765 Bacteria 12398
185 Ga0466957_0001583 3300044842 Bacteria 11952
186 Ga0466959_0000003 3300045049 Bacteria 285164
187 Ga0495638_0032215 3300046460 Bacteria 3363
188 Ga0495648_0004428 3300046524 Bacteria 12000
189 Ga0495668_0000354 3300046616 Bacteria 60932
190 Ga0495668_0446281 3300046616 Bacteria 712
191 Ga0495611_0000037 3300046648 Bacteria 101602
192 Ga0495611_0050364 3300046648 Bacteria 1876
193 Ga0495625_0061030 3300046660 Bacteria 2669
194 Ga0495687_000040 3300047443 Bacteria 230786
195 Ga0495686_0000010 3300047472 Bacteria 573229
196 Ga0501225_0003596 3300049705 Bacteria 4672
197 nmdc:mga0k408_326670_c1 3300050493 Bacteria 915
198 nmdc:mga05p37_10194_c2 3300050507 Bacteria 9428
199 nmdc:mga08y16_134062_c1 3300050511 Bacteria 2574
200 nmdc:mga08y16_579890_c1 3300050511 Unclassified 1132
201 Ga0500578_0000091 3300053086 Bacteria 102427
202 Ga0500578_0047180 3300053086 Bacteria 2764
203 Ga0500646_0032581 3300053090 Unclassified 1439
204 Ga0500646_0088981 3300053090 Bacteria 953
205 Ga0500646_0228814 3300053090 Unclassified 647
206 Ga0500583_0000011 3300053092 Bacteria 160380
207 Ga0500583_0000236 3300053092 Bacteria 19755
208 Ga0500583_0189563 3300053092 Bacteria 1023
209 Ga0500642_0028130 3300053130 Bacteria 2315
210 Ga0500658_0278215 3300053134 Bacteria 769
211 Ga0500559_0034514 3300053136 Bacteria 2182
212 Ga0500573_0319397 3300053140 Bacteria 768
213 Ga0500589_046126 3300053147 Bacteria 2030
214 Ga0500604_0001758 3300053151 Bacteria 6061
215 Ga0500616_0000445 3300053153 Bacteria 54193
216 Ga0500619_079057 3300053154 Bacteria 1103
217 Ga0500622_0001414 3300053156 Bacteria 19338
218 Ga0500622_0009918 3300053156 Bacteria 5255
219 Ga0500622_0038868 3300053156 Bacteria 2482
220 Ga0500622_0098188 3300053156 Bacteria 1446
221 Ga0500636_0099613 3300053177 Bacteria 1654
222 Ga0500637_0316504 3300053178 Bacteria 845
223 Ga0500645_002604 3300053730 Bacteria 7923
224 Ga0500645_034826 3300053730 Bacteria 1503
225 2819585585 2818991444 Bacteria 6968812
226 Ga0111539_10272216
227 rootH1_10091706
228 rootL2_10056000
229 rootL2_10361385
230 rootH1_10011869
231 rootH1_10093894
232 rootH1_10195167
233 rootH1_10200213
234 Ga0070658_10177171
235 Ga0070670_100695525
236 Ga0070666_10000101
237 Ga0068868_100346591
238 Ga0070689_100121754
239 Ga0070661_100123293
240 Ga0070671_100349341
241 Ga0070674_100060304
242 Ga0070659_100268854
243 Ga0070667_100122113
244 Ga0068867_100552716
245 Ga0070684_101026180
246 Ga0070672_100650045
247 Ga0070665_100000002
248 Ga0068855_100028799
249 Ga0068855_100066611
250 Ga0068855_100105097
251 Ga0068857_100006960
252 Ga0068857_100234873
253 Ga0068854_100017672
254 Ga0068856_100022494
255 Ga0068852_100002505
256 Ga0068852_100125840
257 Ga0068852_101232647
258 Ga0068859_100000007
259 Ga0068859_100951632
260 Ga0068864_100033096
261 Ga0068861_100082686
262 Ga0068863_100042265
263 Ga0068858_100014543
264 Ga0068860_100000003
265 Ga0068860_100141794
266 Ga0068862_100157335
267 Ga0068862_100555474
268 Ga0081455_10424504
269 Ga0075366_10155297
270 Ga0097621_100015725
271 Ga0097621_100068359
272 Ga0097621_100519762
273 Ga0068871_100041939
274 Ga0068871_100449625
275 Ga0068865_100577425
276 Ga0097620_100000007
277 Ga0097620_100951705
278 Ga0105240_10020206
279 Ga0105240_10110096
280 Ga0105240_11157108
281 Ga0111539_10528227
282 Ga0105245_10162185
283 Ga0105247_10017643
284 Ga0114129_10008068
285 Ga0105243_10255724
286 Ga0105241_10000622
287 Ga0105241_10000649
288 Ga0105241_10031204
289 Ga0105241_10091242
290 Ga0105242_11239621
291 Ga0105237_10000553
292 Ga0105237_10001595
293 Ga0105237_10013341
294 Ga0105237_11421859
295 Ga0105238_10023246
296 Ga0105238_10079136
297 Ga0105249_10583411
298 Ga0105249_11331627
299 Ga0105239_10000746
300 Ga0105239_10089080
301 Ga0105239_10101724
302 Ga0105239_10166627
303 Ga0105246_10050969
304 Ga0105246_10182103
305 Ga0157373_10262052
306 Ga0157371_10002722
307 Ga0157371_10039731
308 Ga0157370_10015629
309 Ga0157370_10042686
310 Ga0157369_10110480
311 Ga0157374_10217658
312 Ga0157378_10019593
313 Ga0157378_10983364
314 Ga0163162_10000712
315 Ga0163162_10695427
316 Ga0157372_10006426
317 Ga0157372_10078561
318 Ga0157372_10308178
319 Ga0157372_10512377
320 Ga0157375_10011496
321 Ga0163163_10794861
322 Ga0157376_10000780
323 Ga0157376_10550496
324 Ga0209646_1005857
325 Ga0207656_10313695
326 Ga0207710_10013895
327 Ga0207680_10000015
328 Ga0207647_10007605
329 Ga0207647_10025812
330 Ga0207654_10003278
331 Ga0207654_10052252
332 Ga0207654_10347943
333 Ga0207707_10426084
334 Ga0207695_10003629
335 Ga0207695_10483794
336 Ga0207695_10774417
337 Ga0207671_10001648
338 Ga0207671_10003155
339 Ga0207671_10004517
340 Ga0207671_10004537
341 Ga0207671_10020007
342 Ga0207671_10029591
343 Ga0207649_10604362
344 Ga0207694_10007871
345 Ga0207694_10031411
346 Ga0207650_10058030
347 Ga0207650_10265212
348 Ga0207650_10939198
349 Ga0207687_10297019
350 Ga0207644_10169600
351 Ga0207690_10307355
352 Ga0207686_10518224
353 Ga0207669_10522298
354 Ga0207691_10188755
355 Ga0207689_10003450
356 Ga0207667_10001058
357 Ga0207667_10087937
358 Ga0207667_10129137
359 Ga0207651_10265866
360 Ga0207712_10568200
361 Ga0207668_10563587
362 Ga0207640_10009598
363 Ga0207703_10000798
364 Ga0207639_10197016
365 Ga0207702_10024287
366 Ga0207702_10188488
367 Ga0207641_10000056
368 Ga0207676_10035456
369 Ga0207674_10004281
370 Ga0207675_100156943
371 Ga0207675_100753117
372 Ga0207698_10002611
373 Ga0207698_10043182
374 Ga0268266_10000073
375 Ga0268265_10305989
376 Ga0268264_10000063
377 Ga0268264_10123165
378 Ga0268264_10384547
379 Ga0307517_10176074
380 Ga0307515_10000078
381 Ga0307511_10000418
382 Ga0307513_10056303
383 Ga0307513_10701356
384 Ga0307509_10090724
385 Ga0307509_10103560
386 Ga0307509_10153481
387 Ga0307508_10000763
388 Ga0307510_10002127
389 Ga0373927_0188447
390 Ga0395899_0109412
391 Ga0395900_0189264
392 Ga0395905_0237681
393 Ga0395901_0038229
394 Ga0436365_1837098
395 Ga0439436_0009333
396 Ga0439439_0007913
397 Ga0451841_0364258
398 Ga0439457_004560
399 Ga0439457_076904
400 Ga0439462_0003813
401 Ga0466969_0000371
402 Ga0466972_0000069
403 Ga0466972_0000075
404 Ga0466972_0012429
405 Ga0466966_0000131
406 Ga0466964_0196014
407 Ga0466971_0043056
408 Ga0466968_0254426
409 Ga0466970_0001235
410 Ga0466957_0001583
411 Ga0466959_0000003
412 Ga0495638_0032215
413 Ga0495648_0004428
414 Ga0495668_0000354
415 Ga0495668_0446281
416 Ga0495611_0000037
417 Ga0495611_0050364
418 Ga0495625_0061030
419 Ga0495687_000040
420 Ga0495686_0000010
421 Ga0501225_0003596
422 nmdc:mga0k408_326670_c1
423 nmdc:mga05p37_10194_c2
424 nmdc:mga08y16_134062_c1
425 nmdc:mga08y16_579890_c1
426 Ga0500578_0000091
427 Ga0500578_0047180
428 Ga0500646_0032581
429 Ga0500646_0088981
430 Ga0500646_0228814
431 Ga0500583_0000011
432 Ga0500583_0000236
433 Ga0500583_0189563
434 Ga0500642_0028130
435 Ga0500658_0278215
436 Ga0500559_0034514
437 Ga0500573_0319397
438 Ga0500589_046126
439 Ga0500604_0001758
440 Ga0500616_0000445
441 Ga0500619_079057
442 Ga0500622_0001414
443 Ga0500622_0009918
444 Ga0500622_0038868
445 Ga0500622_0098188
446 Ga0500636_0099613
447 Ga0500637_0316504
448 Ga0500645_002604
449 Ga0500645_034826
450 2819585585

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

46

212

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jb9-assembly1.cif.gz_d cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.8834 25 195
2fu0-assembly1.cif.gz_A plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain 0.8776 26 192
5xjc-assembly1.cif.gz_S cryo-em structure of the human spliceosome just prior to exon ligation at 3.6 angstrom 0.8731 23 193
3jb9-assembly1.cif.gz_d cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.8726 25 195
3s6m-assembly1.cif.gz_A the structure of a peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei 0.8681 24 195
ID Description Score Start End Superfamily
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8604 26 193 2.40.100.10
af_Q9XXI7_1_179_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8464 24 194 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8422 18 195 2.40.100.10
af_Q9FJX0_326_510_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8404 18 195 2.40.100.10
2mvzA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8357 24 195 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A4Q0AU89-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9712 18 195 GO:0140839
GO:0140840
AF-A0A3D4T8Y9-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9682 17 195 GO:0140839
GO:0140840
AF-A0A7C2NHI9-F1-model_v4 Peptidylprolyl isomerase 0.9575 63 187 GO:0005737
GO:0006457
GO:0016018
GO:0140839
GO:0140840
AF-A0A7Y2ZEH7-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.948 24 194 GO:0003755
AF-A0A1F5CS97-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9477 21 195 GO:0140839
GO:0140840

Map