F337805

General Info

Members Datasets Scaffolds Average Seq Length
225 134 451 250

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10389875|Ga0163163_103898752
Length 286
Sequence MKIFLVRLLSGANNGRLPHRNSRFGKTGFYRFVQNQMEQMSLAVSIRDLSFGYKGQIKKNFSHLNLEINKGERFGIFGPNGAGKTTLMNLMTGLLDYETGSIKILNKEIKTNKKSINRVSGFVPQDFSFYHELSPSENLEFFGAWSGLNKQIIQTKIKELLDILGLWDVRHKPVQKFSGGMKRRVNLAIAVMNEPAILFLDEPTVGVDVQTRHAMINYLKELNAKGTTLIYTSHQLSEAEDLCNTIALIDDGKIIANDPLEKLLNEHQQEGLEGLFLNLTGKEFRD

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10389875 3300014325 Bacteria 1451
2 JGI24735J21928_10003843 3300002067 Bacteria 5085
3 JGI25165J46597_1000957 3300003214 Bacteria 19672
4 rootH2_10061387 3300003320 Bacteria 4991
5 rootH2_10094371 3300003320 Bacteria 4030
6 rootH2_10116599 3300003320 Bacteria 1569
7 rootH1_10000566 3300003316 Bacteria 33162
8 rootH1_10000566 3300003323 Bacteria 205679
9 rootH1_10247096 3300003323 Unclassified 1460
10 rootH1_10328624 3300003323 Bacteria 3567
11 Ga0070658_10000075 3300005327 Bacteria 95412
12 Ga0070658_10066481 3300005327 Bacteria 2945
13 Ga0070677_10084733 3300005333 Bacteria 1365
14 Ga0068869_100187785 3300005334 Bacteria 1623
15 Ga0068869_100283641 3300005334 Bacteria 1332
16 Ga0070680_100011377 3300005336 Bacteria 6882
17 Ga0070682_100000106 3300005337 Bacteria 74029
18 Ga0068868_100015137 3300005338 Bacteria 5699
19 Ga0070660_100008755 3300005339 Bacteria 7088
20 Ga0070660_100032947 3300005339 Bacteria 3903
21 Ga0070660_100056591 3300005339 Bacteria 3034
22 Ga0070668_100166981 3300005347 Bacteria 1789
23 Ga0070669_100039820 3300005353 Bacteria 3415
24 Ga0070675_100086939 3300005354 Bacteria 2614
25 Ga0070671_100155003 3300005355 Bacteria 1935
26 Ga0070674_100066776 3300005356 Bacteria 2528
27 Ga0070659_100001045 3300005366 Bacteria 20218
28 Ga0070659_100016831 3300005366 Bacteria 5493
29 Ga0070667_100015079 3300005367 Bacteria 6384
30 Ga0070667_100094702 3300005367 Bacteria 2573
31 Ga0070667_100358789 3300005367 Bacteria 1321
32 Ga0070667_100712460 3300005367 Unclassified 929
33 Ga0070663_100013428 3300005455 Bacteria 5223
34 Ga0070662_100000167 3300005457 Bacteria 38204
35 Ga0070681_10035380 3300005458 Bacteria 5017
36 Ga0068867_100017794 3300005459 Bacteria 5047
37 Ga0068867_100021893 3300005459 Bacteria 4565
38 Ga0068867_100071773 3300005459 Bacteria 2590
39 Ga0070679_100097257 3300005530 Bacteria 2931
40 Ga0070679_100348747 3300005530 Bacteria 1428
41 Ga0068853_100096833 3300005539 Bacteria 2604
42 Ga0068853_100241188 3300005539 Bacteria 1657
43 Ga0070672_100042980 3300005543 Bacteria 3481
44 Ga0070672_100370951 3300005543 Bacteria 1223
45 Ga0070665_100328567 3300005548 Bacteria 1533
46 Ga0068855_100132046 3300005563 Bacteria 2851
47 Ga0068855_100423367 3300005563 Bacteria 1456
48 Ga0068855_100446774 3300005563 Bacteria 1411
49 Ga0068857_100013369 3300005577 Bacteria 7149
50 Ga0068856_100000044 3300005614 Bacteria 111437
51 Ga0068856_100003367 3300005614 Bacteria 16201
52 Ga0068856_100020596 3300005614 Bacteria 6408
53 Ga0068856_100240828 3300005614 Bacteria 1824
54 Ga0068856_100581331 3300005614 Bacteria 1141
55 Ga0068852_100091369 3300005616 Bacteria 2724
56 Ga0068852_100443888 3300005616 Unclassified 1283
57 Ga0068864_100255213 3300005618 Bacteria 1629
58 Ga0068861_100107273 3300005719 Bacteria 2233
59 Ga0068861_100192773 3300005719 Bacteria 1705
60 Ga0068870_10102879 3300005840 Bacteria 1618
61 Ga0068860_100048712 3300005843 Bacteria 4038
62 Ga0068860_100228327 3300005843 Bacteria 1809
63 Ga0068862_100698182 3300005844 Bacteria 983
64 Ga0068871_100387774 3300006358 Bacteria 1242
65 Ga0068865_100088082 3300006881 Bacteria 2245
66 Ga0105240_10004296 3300009093 Bacteria 21764
67 Ga0105240_10009293 3300009093 Bacteria 13938
68 Ga0105240_10012464 3300009093 Bacteria 11730
69 Ga0105240_10054067 3300009093 Bacteria 5034
70 Ga0105240_10588742 3300009093 Unclassified 1226
71 Ga0105243_10437701 3300009148 Bacteria 1223
72 Ga0105241_10003945 3300009174 Bacteria 10980
73 Ga0105241_10141537 3300009174 Bacteria 1959
74 Ga0105241_10198700 3300009174 Bacteria 1673
75 Ga0105242_10067742 3300009176 Bacteria 2952
76 Ga0105237_10002306 3300009545 Bacteria 23725
77 Ga0105237_10070166 3300009545 Unclassified 3499
78 Ga0105238_10242144 3300009551 Bacteria 1781
79 Ga0105249_10045567 3300009553 Bacteria 3989
80 Ga0105249_10176537 3300009553 Bacteria 2075
81 Ga0105239_10000002 3300010375 Bacteria 610298
82 Ga0105239_10005880 3300010375 Bacteria 14296
83 Ga0105239_10022848 3300010375 Bacteria 6895
84 Ga0105239_10144729 3300010375 Bacteria 2650
85 Ga0105246_10009185 3300011119 Bacteria 6088
86 Ga0105246_10018868 3300011119 Bacteria 4398
87 Ga0105246_10316076 3300011119 Bacteria 1267
88 Ga0157373_10024983 3300013100 Bacteria 4325
89 Ga0157373_10227069 3300013100 Unclassified 1318
90 Ga0157371_10000269 3300013102 Bacteria 70787
91 Ga0157371_10001621 3300013102 Bacteria 23010
92 Ga0157370_10204815 3300013104 Bacteria 1830
93 Ga0157370_10213693 3300013104 Bacteria 1787
94 Ga0157370_10652467 3300013104 Bacteria 962
95 Ga0157369_10012411 3300013105 Bacteria 9671
96 Ga0157374_10004549 3300013296 Bacteria 11638
97 Ga0157374_10017006 3300013296 Bacteria 6403
98 Ga0157374_10117302 3300013296 Bacteria 2565
99 Ga0157378_10299187 3300013297 Bacteria 1557
100 Ga0157378_10419204 3300013297 Bacteria 1323
101 Ga0157378_10587912 3300013297 Bacteria 1123
102 Ga0157372_10000009 3300013307 Bacteria 302051
103 Ga0157372_10001087 3300013307 Bacteria 29605
104 Ga0157372_10010312 3300013307 Bacteria 9928
105 Ga0157372_10121427 3300013307 Bacteria 3001
106 Ga0157375_10092151 3300013308 Bacteria 3093
107 Ga0157375_10164053 3300013308 Bacteria 2365
108 Ga0157375_10235058 3300013308 Bacteria 1992
109 Ga0157375_10315431 3300013308 Bacteria 1728
110 Ga0163163_10332194 3300014325 Bacteria 1575
111 Ga0157376_10540307 3300014969 Bacteria 1152
112 Ga0213872_10013116 3300021361 Bacteria 3885
113 Ga0209563_109127 3300025230 Unclassified 1521
114 Ga0207427_100093 3300025231 Bacteria 125910
115 Ga0209437_100008 3300025233 Bacteria 921142
116 Ga0209026_1000930 3300025250 Bacteria 14845
117 Ga0209233_1000024 3300025261 Bacteria 695418
118 Ga0209233_1001440 3300025261 Bacteria 9392
119 Ga0209455_1010329 3300025272 Bacteria 2379
120 Ga0207688_10021799 3300025901 Bacteria 3503
121 Ga0207680_10258545 3300025903 Bacteria 1204
122 Ga0207647_10000209 3300025904 Bacteria 47604
123 Ga0207647_10000463 3300025904 Bacteria 32923
124 Ga0207645_10006683 3300025907 Bacteria 8237
125 Ga0207643_10010665 3300025908 Bacteria 4952
126 Ga0207705_10000102 3300025909 Bacteria 98105
127 Ga0207705_10092508 3300025909 Bacteria 2216
128 Ga0207654_10008073 3300025911 Bacteria 5305
129 Ga0207654_10075746 3300025911 Bacteria 2012
130 Ga0207654_10119153 3300025911 Bacteria 1654
131 Ga0207707_10340400 3300025912 Bacteria 1293
132 Ga0207695_10006768 3300025913 Bacteria 14780
133 Ga0207695_10008363 3300025913 Bacteria 12962
134 Ga0207695_10044680 3300025913 Bacteria 4709
135 Ga0207695_10224615 3300025913 Bacteria 1784
136 Ga0207671_10002483 3300025914 Bacteria 19710
137 Ga0207671_10076709 3300025914 Bacteria 2501
138 Ga0207671_10381967 3300025914 Bacteria 1119
139 Ga0207660_10053988 3300025917 Bacteria 2866
140 Ga0207660_10320987 3300025917 Bacteria 1237
141 Ga0207657_10036426 3300025919 Bacteria 4403
142 Ga0207657_10093174 3300025919 Bacteria 2509
143 Ga0207652_10075892 3300025921 Bacteria 2930
144 Ga0207652_10125046 3300025921 Bacteria 2290
145 Ga0207681_10105412 3300025923 Bacteria 2041
146 Ga0207694_10309872 3300025924 Bacteria 1301
147 Ga0207659_10320075 3300025926 Bacteria 1279
148 Ga0207644_10186790 3300025931 Unclassified 1628
149 Ga0207690_10000770 3300025932 Bacteria 20723
150 Ga0207690_10003147 3300025932 Bacteria 9907
151 Ga0207706_10000257 3300025933 Bacteria 57965
152 Ga0207669_10296045 3300025937 Bacteria 1228
153 Ga0207704_10407698 3300025938 Bacteria 1074
154 Ga0207691_10055552 3300025940 Bacteria 3608
155 Ga0207689_10000466 3300025942 Bacteria 37961
156 Ga0207689_10004188 3300025942 Bacteria 13113
157 Ga0207689_10132044 3300025942 Unclassified 2055
158 Ga0207667_10006040 3300025949 Bacteria 14732
159 Ga0207667_10053592 3300025949 Bacteria 4244
160 Ga0207667_10073635 3300025949 Bacteria 3549
161 Ga0207667_10768432 3300025949 Bacteria 962
162 Ga0207667_10829396 3300025949 Bacteria 920
163 Ga0207651_10173999 3300025960 Bacteria 1701
164 Ga0207668_10316898 3300025972 Unclassified 1293
165 Ga0207640_10301986 3300025981 Bacteria 1267
166 Ga0207677_10183032 3300026023 Unclassified 1650
167 Ga0207639_10261485 3300026041 Bacteria 1514
168 Ga0207678_10024761 3300026067 Bacteria 5240
169 Ga0207702_10000140 3300026078 Bacteria 87544
170 Ga0207702_10021409 3300026078 Bacteria 5353
171 Ga0207702_10067127 3300026078 Bacteria 3077
172 Ga0207702_10662411 3300026078 Bacteria 1027
173 Ga0207648_10004023 3300026089 Bacteria 15260
174 Ga0207648_10444503 3300026089 Bacteria 1180
175 Ga0207674_10054578 3300026116 Bacteria 4067
176 Ga0207674_10455884 3300026116 Bacteria 1236
177 Ga0207675_100016499 3300026118 Bacteria 6896
178 Ga0207675_100018172 3300026118 Bacteria 6556
179 Ga0207675_100824401 3300026118 Bacteria 942
180 Ga0207683_10005934 3300026121 Bacteria 10469
181 Ga0207683_10099198 3300026121 Bacteria 2599
182 Ga0268264_10163883 3300028381 Unclassified 2005
183 Ga0268264_10187743 3300028381 Bacteria 1882
184 Ga0268264_10366950 3300028381 Bacteria 1375
185 Ga0307517_10003309 3300028786 Bacteria 25165
186 Ga0307511_10000104 3300030521 Bacteria 75069
187 Ga0307509_10002733 3300031507 Bacteria 28113
188 Ga0307509_10126152 3300031507 Bacteria 2525
189 Ga0307516_10003007 3300031730 Bacteria 22014
190 Ga0307412_10340118 3300031911 Bacteria 1201
191 Ga0307510_10003634 3300033180 Bacteria 18006
192 Ga0373935_0186061 3300035692 Bacteria 1428
193 Ga0395899_0000001 3300037312 Bacteria 1750322
194 Ga0395899_0002957 3300037312 Bacteria 13598
195 Ga0395899_0046863 3300037312 Bacteria 3219
196 Ga0395900_0000327 3300037418 Bacteria 70365
197 Ga0395900_0024302 3300037418 Bacteria 6205
198 Ga0395900_0060434 3300037418 Bacteria 3900
199 Ga0395905_0001887 3300037471 Bacteria 24161
200 Ga0436365_0130893 3300039437 Bacteria 2491
201 Ga0436361_0773655 3300039447 Bacteria 3958
202 Ga0439445_0052048 3300042004 Unclassified 1107
203 Ga0466969_0041576 3300044656 Bacteria 2299
204 Ga0466966_0014474 3300044684 Bacteria 5221
205 Ga0466959_0051529 3300045049 Bacteria 3018
206 Ga0495631_0007451 3300046518 Bacteria 5561
207 Ga0495625_0134153 3300046660 Bacteria 1675
208 Ga0495661_0008787 3300046665 Bacteria 6969
209 Ga0495661_0021254 3300046665 Bacteria 4233
210 Ga0495649_0107191 3300046694 Unclassified 1483
211 Ga0495687_015885 3300047443 Bacteria 3807
212 Ga0495675_0172480 3300047444 Unclassified 1328
213 Ga0495686_0092254 3300047472 Bacteria 1837
214 Ga0501032_0441311 3300049569 Bacteria 834
215 Ga0501034_0021131 3300049571 Bacteria 6640
216 Ga0501034_0807581 3300049571 Bacteria 830
217 Ga0501037_0019936 3300049573 Bacteria 4949
218 Ga0501043_0076249 3300049579 Bacteria 2634
219 Ga0501047_0055092 3300049581 Bacteria 3846
220 Ga0501070_0032817 3300049586 Bacteria 4344
221 Ga0501035_0394213 3300049822 Bacteria 1153
222 Ga0500635_0018444 3300053080 Bacteria 2106
223 Ga0500583_0000075 3300053092 Bacteria 59561
224 Ga0500556_0090588 3300053104 Bacteria 1167
225 Ga0500562_077214 3300053108 Bacteria 900
226 2890805458 2890804823 Bacteria 3717572
227 Ga0163163_10389875
228 JGI24735J21928_10003843
229 JGI25165J46597_1000957
230 rootH2_10061387
231 rootH2_10094371
232 rootH2_10116599
233 rootH1_10000566
234 rootH1_10247096
235 rootH1_10328624
236 Ga0070658_10000075
237 Ga0070658_10066481
238 Ga0070677_10084733
239 Ga0068869_100187785
240 Ga0068869_100283641
241 Ga0070680_100011377
242 Ga0070682_100000106
243 Ga0068868_100015137
244 Ga0070660_100008755
245 Ga0070660_100032947
246 Ga0070660_100056591
247 Ga0070668_100166981
248 Ga0070669_100039820
249 Ga0070675_100086939
250 Ga0070671_100155003
251 Ga0070674_100066776
252 Ga0070659_100001045
253 Ga0070659_100016831
254 Ga0070667_100015079
255 Ga0070667_100094702
256 Ga0070667_100358789
257 Ga0070667_100712460
258 Ga0070663_100013428
259 Ga0070662_100000167
260 Ga0070681_10035380
261 Ga0068867_100017794
262 Ga0068867_100021893
263 Ga0068867_100071773
264 Ga0070679_100097257
265 Ga0070679_100348747
266 Ga0068853_100096833
267 Ga0068853_100241188
268 Ga0070672_100042980
269 Ga0070672_100370951
270 Ga0070665_100328567
271 Ga0068855_100132046
272 Ga0068855_100423367
273 Ga0068855_100446774
274 Ga0068857_100013369
275 Ga0068856_100000044
276 Ga0068856_100003367
277 Ga0068856_100020596
278 Ga0068856_100240828
279 Ga0068856_100581331
280 Ga0068852_100091369
281 Ga0068852_100443888
282 Ga0068864_100255213
283 Ga0068861_100107273
284 Ga0068861_100192773
285 Ga0068870_10102879
286 Ga0068860_100048712
287 Ga0068860_100228327
288 Ga0068862_100698182
289 Ga0068871_100387774
290 Ga0068865_100088082
291 Ga0105240_10004296
292 Ga0105240_10009293
293 Ga0105240_10012464
294 Ga0105240_10054067
295 Ga0105240_10588742
296 Ga0105243_10437701
297 Ga0105241_10003945
298 Ga0105241_10141537
299 Ga0105241_10198700
300 Ga0105242_10067742
301 Ga0105237_10002306
302 Ga0105237_10070166
303 Ga0105238_10242144
304 Ga0105249_10045567
305 Ga0105249_10176537
306 Ga0105239_10000002
307 Ga0105239_10005880
308 Ga0105239_10022848
309 Ga0105239_10144729
310 Ga0105246_10009185
311 Ga0105246_10018868
312 Ga0105246_10316076
313 Ga0157373_10024983
314 Ga0157373_10227069
315 Ga0157371_10000269
316 Ga0157371_10001621
317 Ga0157370_10204815
318 Ga0157370_10213693
319 Ga0157370_10652467
320 Ga0157369_10012411
321 Ga0157374_10004549
322 Ga0157374_10017006
323 Ga0157374_10117302
324 Ga0157378_10299187
325 Ga0157378_10419204
326 Ga0157378_10587912
327 Ga0157372_10000009
328 Ga0157372_10001087
329 Ga0157372_10010312
330 Ga0157372_10121427
331 Ga0157375_10092151
332 Ga0157375_10164053
333 Ga0157375_10235058
334 Ga0157375_10315431
335 Ga0163163_10332194
336 Ga0157376_10540307
337 Ga0213872_10013116
338 Ga0209563_109127
339 Ga0207427_100093
340 Ga0209437_100008
341 Ga0209026_1000930
342 Ga0209233_1000024
343 Ga0209233_1001440
344 Ga0209455_1010329
345 Ga0207688_10021799
346 Ga0207680_10258545
347 Ga0207647_10000209
348 Ga0207647_10000463
349 Ga0207645_10006683
350 Ga0207643_10010665
351 Ga0207705_10000102
352 Ga0207705_10092508
353 Ga0207654_10008073
354 Ga0207654_10075746
355 Ga0207654_10119153
356 Ga0207707_10340400
357 Ga0207695_10006768
358 Ga0207695_10008363
359 Ga0207695_10044680
360 Ga0207695_10224615
361 Ga0207671_10002483
362 Ga0207671_10076709
363 Ga0207671_10381967
364 Ga0207660_10053988
365 Ga0207660_10320987
366 Ga0207657_10036426
367 Ga0207657_10093174
368 Ga0207652_10075892
369 Ga0207652_10125046
370 Ga0207681_10105412
371 Ga0207694_10309872
372 Ga0207659_10320075
373 Ga0207644_10186790
374 Ga0207690_10000770
375 Ga0207690_10003147
376 Ga0207706_10000257
377 Ga0207669_10296045
378 Ga0207704_10407698
379 Ga0207691_10055552
380 Ga0207689_10000466
381 Ga0207689_10004188
382 Ga0207689_10132044
383 Ga0207667_10006040
384 Ga0207667_10053592
385 Ga0207667_10073635
386 Ga0207667_10768432
387 Ga0207667_10829396
388 Ga0207651_10173999
389 Ga0207668_10316898
390 Ga0207640_10301986
391 Ga0207677_10183032
392 Ga0207639_10261485
393 Ga0207678_10024761
394 Ga0207702_10000140
395 Ga0207702_10021409
396 Ga0207702_10067127
397 Ga0207702_10662411
398 Ga0207648_10004023
399 Ga0207648_10444503
400 Ga0207674_10054578
401 Ga0207674_10455884
402 Ga0207675_100016499
403 Ga0207675_100018172
404 Ga0207675_100824401
405 Ga0207683_10005934
406 Ga0207683_10099198
407 Ga0268264_10163883
408 Ga0268264_10187743
409 Ga0268264_10366950
410 Ga0307517_10003309
411 Ga0307511_10000104
412 Ga0307509_10002733
413 Ga0307509_10126152
414 Ga0307516_10003007
415 Ga0307412_10340118
416 Ga0307510_10003634
417 Ga0373935_0186061
418 Ga0395899_0000001
419 Ga0395899_0002957
420 Ga0395899_0046863
421 Ga0395900_0000327
422 Ga0395900_0024302
423 Ga0395900_0060434
424 Ga0395905_0001887
425 Ga0436365_0130893
426 Ga0436361_0773655
427 Ga0439445_0052048
428 Ga0466969_0041576
429 Ga0466966_0014474
430 Ga0466959_0051529
431 Ga0495631_0007451
432 Ga0495625_0134153
433 Ga0495661_0008787
434 Ga0495661_0021254
435 Ga0495649_0107191
436 Ga0495687_015885
437 Ga0495675_0172480
438 Ga0495686_0092254
439 Ga0501032_0441311
440 Ga0501034_0021131
441 Ga0501034_0807581
442 Ga0501037_0019936
443 Ga0501043_0076249
444 Ga0501047_0055092
445 Ga0501070_0032817
446 Ga0501035_0394213
447 Ga0500635_0018444
448 Ga0500583_0000075
449 Ga0500556_0090588
450 Ga0500562_077214
451 2890805458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

61

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9458 6 231
7osf-assembly1.cif.gz_B abc transporter complex nosdfyl, r-domain 1 0.9418 7 229
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.9376 6 233
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9353 7 230
7e7i-assembly1.cif.gz_A cryo-em structure of human abca4 in the apo state 0.9348 7 231
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 7 228 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 7 230 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9534 9 231 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 6 237 3.40.50.300
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 8 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A139WBE8-F1-model_v4 ATP-binding cassette sub-family A member 3-like Protein 0.9692 33 230 GO:0005319
GO:0005524
GO:0006869
GO:0016020
GO:0016887
GO:0042626
GO:0043231
GO:0140359
AF-A0A2G9XGG2-F1-model_v4 ABC transporter 0.9652 6 231 GO:0005524
GO:0016887
AF-A0A428Z536-F1-model_v4 Transport permease protein 0.9634 7 232 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:0140359
GO:1900753
AF-K1YG27-F1-model_v4 ABC transporter domain-containing protein 0.9628 6 231 GO:0005524
GO:0016887
AF-A0A0V8J7U4-F1-model_v4 Antibiotic ABC transporter ATP-binding protein 0.961 7 231 GO:0005524
GO:0016887

Map