F338296

General Info

Members Datasets Scaffolds Average Seq Length
225 142 450 80

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0096350|Ga0500573_0096350_542_775
Length 77
Sequence MTESGDKKQLLHLVFGGELTSLTEVQFHDLSKLDIVGIFPDYATALTAWKAKAHQTVDNAHMRYFIVHMHRLLTPDV

Samples

Sample ID Description Type Environment
1 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.11
Nodule 0
Rhizoplane 3.11
Rhizosphere 79.11
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500573_0096350 3300053140 Bacteria 1667
2 JGI25157J39369_1030287 3300002741 Bacteria 618
3 JGI25153J46596_10056419 3300003215 Bacteria 1093
4 Ga0055530_10000597 3300003791 Bacteria 31200
5 Ga0055531_10001491 3300003794 Bacteria 17203
6 Ga0055531_10024174 3300003794 Bacteria 2251
7 Ga0055543_1024591 3300004625 Bacteria 1080
8 Ga0065165_1000216 3300005262 Bacteria 100208
9 Ga0070658_10053207 3300005327 Bacteria 3285
10 Ga0070658_11057283 3300005327 Bacteria 706
11 Ga0070666_10143226 3300005335 Bacteria 1665
12 Ga0070666_10256814 3300005335 Bacteria 1238
13 Ga0070666_10328205 3300005335 Bacteria 1092
14 Ga0070680_100034849 3300005336 Bacteria 4060
15 Ga0070660_101560291 3300005339 Bacteria 562
16 Ga0070689_100869901 3300005340 Bacteria 796
17 Ga0070668_100005176 3300005347 Bacteria 9673
18 Ga0070671_101092842 3300005355 Bacteria 700
19 Ga0070667_100008995 3300005367 Bacteria 8267
20 Ga0070662_100834653 3300005457 Bacteria 784
21 Ga0070681_10299083 3300005458 Bacteria 1519
22 Ga0070681_10772174 3300005458 Bacteria 878
23 Ga0070679_100078274 3300005530 Bacteria 3295
24 Ga0070679_101246700 3300005530 Bacteria 689
25 Ga0068853_101382712 3300005539 Bacteria 681
26 Ga0070672_101703666 3300005543 Bacteria 566
27 Ga0070665_100003128 3300005548 Bacteria 17825
28 Ga0070665_101448601 3300005548 Bacteria 696
29 Ga0068855_100081192 3300005563 Bacteria 3759
30 Ga0068855_100183081 3300005563 Bacteria 2367
31 Ga0068855_100574652 3300005563 Bacteria 1218
32 Ga0068854_100676780 3300005578 Bacteria 888
33 Ga0068856_100664385 3300005614 Bacteria 1063
34 Ga0068856_101492214 3300005614 Bacteria 690
35 Ga0068852_100029921 3300005616 Bacteria 4477
36 Ga0068852_100670090 3300005616 Bacteria 1046
37 Ga0068852_101633844 3300005616 Bacteria 667
38 Ga0068859_100794880 3300005617 Bacteria 1034
39 Ga0068864_100107704 3300005618 Bacteria 2479
40 Ga0068861_100353788 3300005719 Bacteria 1289
41 Ga0068863_100722867 3300005841 Bacteria 990
42 Ga0068858_100098945 3300005842 Bacteria 2719
43 Ga0068862_100021389 3300005844 Bacteria 5405
44 Ga0068862_101230199 3300005844 Bacteria 748
45 Ga0075368_10001166 3300006042 Bacteria 8293
46 Ga0075363_100148456 3300006048 Bacteria 1322
47 Ga0075364_10005215 3300006051 Bacteria 7543
48 Ga0075362_10131113 3300006177 Bacteria 1192
49 Ga0075362_10183522 3300006177 Bacteria 1014
50 Ga0075367_10003778 3300006178 Bacteria 7297
51 Ga0075366_10167526 3300006195 Unclassified 1332
52 Ga0075370_10227014 3300006353 Unclassified 1104
53 Ga0097620_100794713 3300006931 Bacteria 1034
54 Ga0105240_10025626 3300009093 Bacteria 7745
55 Ga0105240_10032588 3300009093 Bacteria 6746
56 Ga0105240_10114507 3300009093 Bacteria 3257
57 Ga0105240_10223974 3300009093 Bacteria 2189
58 Ga0105240_10388086 3300009093 Bacteria 1575
59 Ga0105240_10621033 3300009093 Bacteria 1188
60 Ga0105240_10877315 3300009093 Bacteria 967
61 Ga0105240_11113389 3300009093 Bacteria 840
62 Ga0105240_12403770 3300009093 Bacteria 545
63 Ga0105247_10331948 3300009101 Bacteria 1064
64 Ga0105243_10769766 3300009148 Bacteria 946
65 Ga0105241_10945717 3300009174 Bacteria 803
66 Ga0105242_10017982 3300009176 Bacteria 5522
67 Ga0105248_10027415 3300009177 Bacteria 6342
68 Ga0105248_10126944 3300009177 Bacteria 2877
69 Ga0105237_10104220 3300009545 Bacteria 2828
70 Ga0105237_10991681 3300009545 Bacteria 847
71 Ga0105237_11770266 3300009545 Bacteria 625
72 Ga0105238_10011022 3300009551 Bacteria 9089
73 Ga0105238_10017364 3300009551 Bacteria 7309
74 Ga0105238_10358699 3300009551 Bacteria 1447
75 Ga0105238_10598866 3300009551 Bacteria 1110
76 Ga0105238_10826378 3300009551 Bacteria 943
77 Ga0105249_10122229 3300009553 Bacteria 2476
78 Ga0105249_10888897 3300009553 Bacteria 957
79 Ga0105239_10100806 3300010375 Bacteria 3194
80 Ga0105239_10734887 3300010375 Bacteria 1129
81 Ga0157373_10298225 3300013100 Bacteria 1144
82 Ga0157369_10742999 3300013105 Bacteria 1010
83 Ga0157374_11756448 3300013296 Bacteria 645
84 Ga0163162_10966732 3300013306 Bacteria 962
85 Ga0157372_10040416 3300013307 Bacteria 5152
86 Ga0157375_13407846 3300013308 Bacteria 529
87 Ga0163163_10342928 3300014325 Bacteria 1549
88 Ga0163163_10398445 3300014325 Bacteria 1434
89 Ga0157380_10918692 3300014326 Bacteria 903
90 Ga0157379_12054270 3300014968 Bacteria 565
91 Ga0157376_10810589 3300014969 Bacteria 949
92 Ga0163161_10657969 3300017792 Bacteria 869
93 Ga0209026_1001727 3300025250 Bacteria 9097
94 Ga0209758_1000516 3300025297 Bacteria 62036
95 Ga0209050_1000090 3300025298 Bacteria 253783
96 Ga0209257_1000059 3300025304 Bacteria 378097
97 Ga0209257_1001000 3300025304 Bacteria 38276
98 Ga0207656_10606615 3300025321 Bacteria 559
99 Ga0207710_10695991 3300025900 Bacteria 533
100 Ga0207680_10324018 3300025903 Bacteria 1078
101 Ga0207680_10914663 3300025903 Bacteria 629
102 Ga0207705_10085410 3300025909 Bacteria 2305
103 Ga0207654_10313649 3300025911 Bacteria 1070
104 Ga0207654_10583122 3300025911 Bacteria 797
105 Ga0207707_10095609 3300025912 Bacteria 2597
106 Ga0207695_10002571 3300025913 Bacteria 26664
107 Ga0207695_10003047 3300025913 Bacteria 24012
108 Ga0207695_10023882 3300025913 Bacteria 6898
109 Ga0207695_10144280 3300025913 Bacteria 2326
110 Ga0207695_10615376 3300025913 Bacteria 967
111 Ga0207695_11201045 3300025913 Bacteria 639
112 Ga0207671_11338366 3300025914 Bacteria 557
113 Ga0207660_10138243 3300025917 Bacteria 1860
114 Ga0207657_10829398 3300025919 Bacteria 714
115 Ga0207657_11014122 3300025919 Bacteria 636
116 Ga0207694_10007350 3300025924 Bacteria 8355
117 Ga0207694_10043773 3300025924 Bacteria 3455
118 Ga0207694_10629019 3300025924 Bacteria 904
119 Ga0207694_10645078 3300025924 Bacteria 892
120 Ga0207694_11044498 3300025924 Bacteria 691
121 Ga0207644_10582786 3300025931 Bacteria 928
122 Ga0207706_10447083 3300025933 Bacteria 1118
123 Ga0207711_10011798 3300025941 Bacteria 7260
124 Ga0207711_10926770 3300025941 Bacteria 809
125 Ga0207679_10934521 3300025945 Bacteria 794
126 Ga0207667_10051460 3300025949 Bacteria 4342
127 Ga0207667_10266504 3300025949 Bacteria 1751
128 Ga0207712_10079191 3300025961 Bacteria 2386
129 Ga0207712_10333134 3300025961 Bacteria 1256
130 Ga0207668_10000019 3300025972 Bacteria 152108
131 Ga0207640_11969331 3300025981 Bacteria 529
132 Ga0207658_10007356 3300025986 Bacteria 7505
133 Ga0207639_12166776 3300026041 Bacteria 517
134 Ga0207641_10173264 3300026088 Bacteria 1971
135 Ga0207648_11613675 3300026089 Bacteria 610
136 Ga0207676_10085959 3300026095 Bacteria 2568
137 Ga0207675_100437454 3300026118 Bacteria 1294
138 Ga0207698_10059650 3300026142 Bacteria 2963
139 Ga0207698_11486166 3300026142 Bacteria 693
140 Ga0209813_10006319 3300027866 Bacteria 2921
141 Ga0268266_10002885 3300028379 Bacteria 17854
142 Ga0268266_10207645 3300028379 Bacteria 1795
143 Ga0268265_10065846 3300028380 Bacteria 2798
144 Ga0307517_10006713 3300028786 Bacteria 16943
145 Ga0265338_10212999 3300028800 Bacteria 1449
146 Ga0307511_10015098 3300030521 Bacteria 7493
147 Ga0307513_10210810 3300031456 Bacteria 1774
148 Ga0307412_11159021 3300031911 Bacteria 690
149 Ga0307412_11429698 3300031911 Unclassified 627
150 Ga0307415_101590769 3300032126 Bacteria 628
151 Ga0373936_0267654 3300035113 Bacteria 766
152 Ga0373935_0010713 3300035692 Bacteria 5507
153 Ga0373925_0033849 3300037068 Bacteria 3765
154 Ga0373925_0714585 3300037068 Unclassified 826
155 Ga0395899_0000091 3300037312 Bacteria 154780
156 Ga0395899_0025887 3300037312 Bacteria 4428
157 Ga0395899_0043189 3300037312 Bacteria 3363
158 Ga0395899_0378933 3300037312 Bacteria 940
159 Ga0395899_0934298 3300037312 Bacteria 527
160 Ga0395900_0000008 3300037418 Bacteria 480459
161 Ga0395900_0007219 3300037418 Bacteria 11511
162 Ga0395900_0811791 3300037418 Bacteria 863
163 Ga0395900_1641647 3300037418 Bacteria 554
164 Ga0395898_0011923 3300037466 Bacteria 9004
165 Ga0395898_0485993 3300037466 Bacteria 1175
166 Ga0395905_0053492 3300037471 Bacteria 3778
167 Ga0395905_0066489 3300037471 Bacteria 3376
168 Ga0395905_0070543 3300037471 Bacteria 3274
169 Ga0395905_0274547 3300037471 Bacteria 1572
170 Ga0395905_0428644 3300037471 Bacteria 1219
171 Ga0395905_0465106 3300037471 Bacteria 1163
172 Ga0395905_1106606 3300037471 Bacteria 695
173 Ga0395905_1345890 3300037471 Bacteria 618
174 Ga0395905_1652102 3300037471 Bacteria 546
175 Ga0395901_0000008 3300038443 Bacteria 495962
176 Ga0395901_0139293 3300038443 Bacteria 2550
177 Ga0395901_0327721 3300038443 Bacteria 1583
178 Ga0395901_1363326 3300038443 Bacteria 669
179 Ga0436363_1583560 3300039450 Bacteria 975
180 Ga0451789_0557030 3300041443 Bacteria 565
181 Ga0466966_0860014 3300044684 Bacteria 547
182 Ga0453684_0672011 3300044712 Bacteria 1128
183 Ga0466968_0605979 3300044735 Bacteria 553
184 Ga0495643_0375256 3300046522 Bacteria 632
185 Ga0495665_0264082 3300046531 Bacteria 885
186 Ga0495598_0419467 3300046537 Bacteria 526
187 Ga0495621_0037772 3300046539 Bacteria 1681
188 Ga0495668_0126981 3300046616 Bacteria 1396
189 Ga0495668_0312946 3300046616 Bacteria 861
190 Ga0495668_0624780 3300046616 Bacteria 595
191 Ga0495635_0873747 3300046663 Bacteria 577
192 Ga0495669_0111031 3300046684 Bacteria 1280
193 Ga0495686_0031217 3300047472 Bacteria 3456
194 Ga0496104_1822201 3300048907 Bacteria 511
195 Ga0496110_1790287 3300048913 Unclassified 524
196 Ga0496112_0182913 3300048915 Bacteria 2060
197 Ga0496112_1395331 3300048915 Bacteria 615
198 Ga0496115_0025192 3300048918 Bacteria 4630
199 Ga0496115_0142217 3300048918 Bacteria 1980
200 Ga0501034_0443957 3300049571 Bacteria 1216
201 Ga0501036_1604889 3300049572 Bacteria 525
202 Ga0501037_0499823 3300049573 Bacteria 825
203 Ga0501047_0000963 3300049581 Bacteria 29103
204 Ga0501047_0138026 3300049581 Bacteria 2318
205 Ga0501047_0632008 3300049581 Bacteria 891
206 Ga0501048_0063483 3300049582 Bacteria 2612
207 Ga0501080_0537712 3300049742 Bacteria 1042
208 Ga0501035_0058907 3300049822 Bacteria 3421
209 Ga0501035_0852431 3300049822 Bacteria 725
210 Ga0501044_0001576 3300049823 Bacteria 26677
211 Ga0501044_1369140 3300049823 Bacteria 573
212 nmdc:mga03683_122117_c1 3300050489 Bacteria 1159
213 nmdc:mga00v17_1418_c1 3300050491 Bacteria 12587
214 nmdc:mga0k408_31876_c1 3300050493 Bacteria 3012
215 nmdc:mga0k408_56820_c1 3300050493 Bacteria 2271
216 nmdc:mga06z11_831716_c1 3300050494 Unclassified 563
217 nmdc:mga04h51_11900_c1 3300050495 Bacteria 2428
218 nmdc:mga07m45_4224_c1 3300050496 Bacteria 7028
219 nmdc:mga07m45_76625_c1 3300050496 Bacteria 1907
220 nmdc:mga07m45_85902_c1 3300050496 Bacteria 1799
221 Ga0500643_009820 3300053087 Bacteria 3622
222 Ga0500562_000468 3300053108 Bacteria 9787
223 Ga0500595_035805 3300053119 Bacteria 1632
224 Ga0500595_077867 3300053119 Bacteria 975
225 Ga0500645_136336 3300053730 Bacteria 680
226 Ga0500573_0096350
227 JGI25157J39369_1030287
228 JGI25153J46596_10056419
229 Ga0055530_10000597
230 Ga0055531_10001491
231 Ga0055531_10024174
232 Ga0055543_1024591
233 Ga0065165_1000216
234 Ga0070658_10053207
235 Ga0070658_11057283
236 Ga0070666_10143226
237 Ga0070666_10256814
238 Ga0070666_10328205
239 Ga0070680_100034849
240 Ga0070660_101560291
241 Ga0070689_100869901
242 Ga0070668_100005176
243 Ga0070671_101092842
244 Ga0070667_100008995
245 Ga0070662_100834653
246 Ga0070681_10299083
247 Ga0070681_10772174
248 Ga0070679_100078274
249 Ga0070679_101246700
250 Ga0068853_101382712
251 Ga0070672_101703666
252 Ga0070665_100003128
253 Ga0070665_101448601
254 Ga0068855_100081192
255 Ga0068855_100183081
256 Ga0068855_100574652
257 Ga0068854_100676780
258 Ga0068856_100664385
259 Ga0068856_101492214
260 Ga0068852_100029921
261 Ga0068852_100670090
262 Ga0068852_101633844
263 Ga0068859_100794880
264 Ga0068864_100107704
265 Ga0068861_100353788
266 Ga0068863_100722867
267 Ga0068858_100098945
268 Ga0068862_100021389
269 Ga0068862_101230199
270 Ga0075368_10001166
271 Ga0075363_100148456
272 Ga0075364_10005215
273 Ga0075362_10131113
274 Ga0075362_10183522
275 Ga0075367_10003778
276 Ga0075366_10167526
277 Ga0075370_10227014
278 Ga0097620_100794713
279 Ga0105240_10025626
280 Ga0105240_10032588
281 Ga0105240_10114507
282 Ga0105240_10223974
283 Ga0105240_10388086
284 Ga0105240_10621033
285 Ga0105240_10877315
286 Ga0105240_11113389
287 Ga0105240_12403770
288 Ga0105247_10331948
289 Ga0105243_10769766
290 Ga0105241_10945717
291 Ga0105242_10017982
292 Ga0105248_10027415
293 Ga0105248_10126944
294 Ga0105237_10104220
295 Ga0105237_10991681
296 Ga0105237_11770266
297 Ga0105238_10011022
298 Ga0105238_10017364
299 Ga0105238_10358699
300 Ga0105238_10598866
301 Ga0105238_10826378
302 Ga0105249_10122229
303 Ga0105249_10888897
304 Ga0105239_10100806
305 Ga0105239_10734887
306 Ga0157373_10298225
307 Ga0157369_10742999
308 Ga0157374_11756448
309 Ga0163162_10966732
310 Ga0157372_10040416
311 Ga0157375_13407846
312 Ga0163163_10342928
313 Ga0163163_10398445
314 Ga0157380_10918692
315 Ga0157379_12054270
316 Ga0157376_10810589
317 Ga0163161_10657969
318 Ga0209026_1001727
319 Ga0209758_1000516
320 Ga0209050_1000090
321 Ga0209257_1000059
322 Ga0209257_1001000
323 Ga0207656_10606615
324 Ga0207710_10695991
325 Ga0207680_10324018
326 Ga0207680_10914663
327 Ga0207705_10085410
328 Ga0207654_10313649
329 Ga0207654_10583122
330 Ga0207707_10095609
331 Ga0207695_10002571
332 Ga0207695_10003047
333 Ga0207695_10023882
334 Ga0207695_10144280
335 Ga0207695_10615376
336 Ga0207695_11201045
337 Ga0207671_11338366
338 Ga0207660_10138243
339 Ga0207657_10829398
340 Ga0207657_11014122
341 Ga0207694_10007350
342 Ga0207694_10043773
343 Ga0207694_10629019
344 Ga0207694_10645078
345 Ga0207694_11044498
346 Ga0207644_10582786
347 Ga0207706_10447083
348 Ga0207711_10011798
349 Ga0207711_10926770
350 Ga0207679_10934521
351 Ga0207667_10051460
352 Ga0207667_10266504
353 Ga0207712_10079191
354 Ga0207712_10333134
355 Ga0207668_10000019
356 Ga0207640_11969331
357 Ga0207658_10007356
358 Ga0207639_12166776
359 Ga0207641_10173264
360 Ga0207648_11613675
361 Ga0207676_10085959
362 Ga0207675_100437454
363 Ga0207698_10059650
364 Ga0207698_11486166
365 Ga0209813_10006319
366 Ga0268266_10002885
367 Ga0268266_10207645
368 Ga0268265_10065846
369 Ga0307517_10006713
370 Ga0265338_10212999
371 Ga0307511_10015098
372 Ga0307513_10210810
373 Ga0307412_11159021
374 Ga0307412_11429698
375 Ga0307415_101590769
376 Ga0373936_0267654
377 Ga0373935_0010713
378 Ga0373925_0033849
379 Ga0373925_0714585
380 Ga0395899_0000091
381 Ga0395899_0025887
382 Ga0395899_0043189
383 Ga0395899_0378933
384 Ga0395899_0934298
385 Ga0395900_0000008
386 Ga0395900_0007219
387 Ga0395900_0811791
388 Ga0395900_1641647
389 Ga0395898_0011923
390 Ga0395898_0485993
391 Ga0395905_0053492
392 Ga0395905_0066489
393 Ga0395905_0070543
394 Ga0395905_0274547
395 Ga0395905_0428644
396 Ga0395905_0465106
397 Ga0395905_1106606
398 Ga0395905_1345890
399 Ga0395905_1652102
400 Ga0395901_0000008
401 Ga0395901_0139293
402 Ga0395901_0327721
403 Ga0395901_1363326
404 Ga0436363_1583560
405 Ga0451789_0557030
406 Ga0466966_0860014
407 Ga0453684_0672011
408 Ga0466968_0605979
409 Ga0495643_0375256
410 Ga0495665_0264082
411 Ga0495598_0419467
412 Ga0495621_0037772
413 Ga0495668_0126981
414 Ga0495668_0312946
415 Ga0495668_0624780
416 Ga0495635_0873747
417 Ga0495669_0111031
418 Ga0495686_0031217
419 Ga0496104_1822201
420 Ga0496110_1790287
421 Ga0496112_0182913
422 Ga0496112_1395331
423 Ga0496115_0025192
424 Ga0496115_0142217
425 Ga0501034_0443957
426 Ga0501036_1604889
427 Ga0501037_0499823
428 Ga0501047_0000963
429 Ga0501047_0138026
430 Ga0501047_0632008
431 Ga0501048_0063483
432 Ga0501080_0537712
433 Ga0501035_0058907
434 Ga0501035_0852431
435 Ga0501044_0001576
436 Ga0501044_1369140
437 nmdc:mga03683_122117_c1
438 nmdc:mga00v17_1418_c1
439 nmdc:mga0k408_31876_c1
440 nmdc:mga0k408_56820_c1
441 nmdc:mga06z11_831716_c1
442 nmdc:mga04h51_11900_c1
443 nmdc:mga07m45_4224_c1
444 nmdc:mga07m45_76625_c1
445 nmdc:mga07m45_85902_c1
446 Ga0500643_009820
447 Ga0500562_000468
448 Ga0500595_035805
449 Ga0500595_077867
450 Ga0500645_136336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

10

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7619 1 73
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.736 1 73
7d8b-assembly2.cif.gz_C engineering disulphide-free autonomous antibody vh domains to modulate intracellular pathways 0.677 5 65
7wq5-assembly2.cif.gz_B crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6544 12 52
5zk7-assembly1.cif.gz_A stapled-peptides tailored against initiation of translation 0.6209 5 47
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8557 27 52 3.30.730.10
af_Q2TQ39_75_158_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8408 29 54 3.30.730.10
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7744 30 58 3.30.730.10
af_V5QQR7_1_86_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7644 2 69 2.60.40.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7619 1 73 3.30.70.2400
ID Description Score Start End GO Terms
AF-A0A7U3CKN1-F1-model_v4 deleted 0.9237 2 67
AF-A0A258DDP0-F1-model_v4 Inositol monophosphatase 0.9225 1 72
AF-U6B3L5-F1-model_v4 Inositol monophosphatase 0.918 1 66
AF-A0A2E9XXY0-F1-model_v4 DUF4170 domain-containing protein 0.9126 2 66
AF-A0A1Y5ED99-F1-model_v4 Inositol monophosphatase 0.9029 1 66

Map