F339055

General Info

Members Datasets Scaffolds Average Seq Length
226 149 226 101

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0001783|Ga0395899_0001783_3367_3744
Length 125
Sequence MKRQKSFSPALTYRSIINKETEIVMARSASIQNNDKRKKLVKTFSSKRKALKEKIYDKNLPLEERFGLVMKLAKLPRNSAKTRVRNRCALTGRPRGCYRRLGLSRNMFRELAGQGMLPGVVKSSW

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
88 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
136 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
137 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 3.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1001315 3300003214 Bacteria 14050
2 rootH2_10048944 3300003320 Bacteria 1909
3 rootH2_10093439 3300003320 Bacteria 1483
4 rootH2_10168355 3300003320 Bacteria 2472
5 Ga0070658_10857372 3300005327 Bacteria 789
6 Ga0070690_100593715 3300005330 Bacteria 840
7 Ga0070670_101844696 3300005331 Bacteria 557
8 Ga0070691_10261507 3300005341 Bacteria 932
9 Ga0070661_100005946 3300005344 Bacteria 8403
10 Ga0070659_101588435 3300005366 Bacteria 584
11 Ga0070714_100273243 3300005435 Bacteria 1568
12 Ga0070713_100162144 3300005436 Bacteria 1997
13 Ga0070713_101569033 3300005436 Bacteria 639
14 Ga0070711_101326801 3300005439 Bacteria 625
15 Ga0070694_100835981 3300005444 Bacteria 757
16 Ga0070684_100312947 3300005535 Bacteria 1442
17 Ga0070695_100266207 3300005545 Bacteria 1254
18 Ga0068855_101327035 3300005563 Bacteria 744
19 Ga0068858_101287761 3300005842 Bacteria 719
20 Ga0081538_10003741 3300005981 Bacteria 14245
21 Ga0070717_10387942 3300006028 Bacteria 1253
22 Ga0097621_101929408 3300006237 Bacteria 564
23 Ga0075428_100908885 3300006844 Bacteria 934
24 Ga0075430_101593664 3300006846 Bacteria 536
25 Ga0105240_10763362 3300009093 Bacteria 1050
26 Ga0105240_12678305 3300009093 Bacteria 515
27 Ga0105245_10202856 3300009098 Bacteria 1905
28 Ga0105242_10069068 3300009176 Bacteria 2925
29 Ga0105242_12696661 3300009176 Bacteria 547
30 Ga0105248_12443525 3300009177 Bacteria 595
31 Ga0105238_10737084 3300009551 Bacteria 999
32 Ga0105239_12819734 3300010375 Bacteria 567
33 Ga0157373_10256054 3300013100 Bacteria 1238
34 Ga0157373_10845482 3300013100 Bacteria 677
35 Ga0157369_10297493 3300013105 Bacteria 1679
36 Ga0157378_10008956 3300013297 Unclassified 8713
37 Ga0157372_10007016 3300013307 Bacteria 11997
38 Ga0157372_10066383 3300013307 Bacteria 4053
39 Ga0163163_12554707 3300014325 Eukaryota 569
40 Ga0157380_12505430 3300014326 Bacteria 582
41 Ga0157376_10147364 3300014969 Bacteria 2119
42 Ga0157376_10332857 3300014969 Bacteria 1447
43 Ga0213874_10002785 3300021377 Bacteria 3804
44 Ga0213874_10006777 3300021377 Bacteria 2724
45 Ga0213876_10000421 3300021384 Bacteria 35344
46 Ga0207692_10166684 3300025898 Bacteria 1274
47 Ga0207688_10262458 3300025901 Bacteria 1048
48 Ga0207695_10551357 3300025913 Bacteria 1034
49 Ga0207695_11262508 3300025913 Bacteria 619
50 Ga0207687_10017844 3300025927 Bacteria 4682
51 Ga0207687_11918912 3300025927 Bacteria 506
52 Ga0207664_11223358 3300025929 Bacteria 669
53 Ga0207686_10037974 3300025934 Bacteria 2910
54 Ga0207702_12031562 3300026078 Bacteria 565
55 Ga0209982_1023326 3300027552 Eukaryota 957
56 Ga0265337_1034178 3300028556 Bacteria 1497
57 Ga0265319_1008011 3300028563 Bacteria 4678
58 Ga0265319_1201766 3300028563 Bacteria 610
59 Ga0265334_10053153 3300028573 Bacteria 1548
60 Ga0265318_10004788 3300028577 Bacteria 6480
61 Ga0265322_10154096 3300028654 Bacteria 657
62 Ga0265336_10078427 3300028666 Bacteria 986
63 Ga0265338_10126730 3300028800 Bacteria 2024
64 Ga0265324_10238011 3300029957 Bacteria 618
65 Ga0265330_10006774 3300031235 Bacteria 5647
66 Ga0265332_10180643 3300031238 Bacteria 879
67 Ga0265328_10059974 3300031239 Bacteria 1397
68 Ga0265320_10057577 3300031240 Bacteria 1864
69 Ga0265320_10058685 3300031240 Bacteria 1841
70 Ga0265325_10193080 3300031241 Bacteria 943
71 Ga0265325_10213204 3300031241 Bacteria 886
72 Ga0265325_10313159 3300031241 Bacteria 699
73 Ga0265329_10058829 3300031242 Bacteria 1217
74 Ga0265340_10042793 3300031247 Bacteria 2221
75 Ga0265340_10056107 3300031247 Bacteria 1895
76 Ga0265340_10539012 3300031247 Unclassified 514
77 Ga0265339_10057525 3300031249 Bacteria 2103
78 Ga0265339_10081034 3300031249 Bacteria 1716
79 Ga0265339_10366929 3300031249 Bacteria 676
80 Ga0265331_10002422 3300031250 Bacteria 12651
81 Ga0265331_10017155 3300031250 Bacteria 3782
82 Ga0265331_10036854 3300031250 Bacteria 2399
83 Ga0265316_10028793 3300031344 Bacteria 4577
84 Ga0265316_10077735 3300031344 Bacteria 2548
85 Ga0265316_10233900 3300031344 Bacteria 1352
86 Ga0265313_10004186 3300031595 Bacteria 11195
87 Ga0265313_10016556 3300031595 Bacteria 4233
88 Ga0265313_10019748 3300031595 Bacteria 3739
89 Ga0265313_10139128 3300031595 Bacteria 1045
90 Ga0265313_10425620 3300031595 Bacteria 518
91 Ga0265314_10027129 3300031711 Bacteria 4292
92 Ga0265314_10027518 3300031711 Bacteria 4257
93 Ga0265314_10062141 3300031711 Bacteria 2540
94 Ga0265314_10174454 3300031711 Bacteria 1294
95 Ga0265314_10206501 3300031711 Bacteria 1157
96 Ga0265314_10218330 3300031711 Bacteria 1114
97 Ga0265342_10006333 3300031712 Bacteria 8824
98 Ga0265342_10049147 3300031712 Bacteria 2525
99 Ga0265342_10049993 3300031712 Bacteria 2499
100 Ga0265342_10052173 3300031712 Bacteria 2438
101 Ga0316576_10025702 3300031727 Unclassified 4125
102 Ga0316578_10038018 3300031728 Unclassified 2774
103 Ga0307405_10907370 3300031731 Bacteria 746
104 Ga0307416_100276671 3300032002 Bacteria 1652
105 Ga0307416_100515390 3300032002 Unclassified 1263
106 Ga0307415_100165328 3300032126 Eukaryota 1720
107 Ga0307415_100552612 3300032126 Eukaryota 1016
108 Ga0316592_1001713 3300033524 Eukaryota 3634
109 Ga0316592_1005231 3300033524 Unclassified 2454
110 Ga0316592_1008054 3300033524 Eukaryota 2071
111 Ga0316592_1016510 3300033524 Eukaryota 1543
112 Ga0316586_1118853 3300033527 Unclassified 514
113 Ga0316588_1010425 3300033528 Eukaryota 1959
114 Ga0316588_1026013 3300033528 Eukaryota 1354
115 Ga0373936_0008097 3300035113 Bacteria 3952
116 Ga0373945_0006653 3300035116 Bacteria 3735
117 Ga0373943_0080948 3300035170 Bacteria 1665
118 Ga0373931_0290104 3300035691 Bacteria 1007
119 Ga0373935_0003403 3300035692 Bacteria 9238
120 Ga0373927_0093543 3300035695 Bacteria 1953
121 Ga0373933_0616071 3300035724 Unclassified 713
122 Ga0373947_0011709 3300035725 Bacteria 5027
123 Ga0373947_0124556 3300035725 Bacteria 1640
124 Ga0373937_0607216 3300036401 Unclassified 1038
125 Ga0373937_1572797 3300036401 Bacteria 605
126 Ga0373925_0002514 3300037068 Bacteria 14651
127 Ga0395899_0001783 3300037312 Bacteria 17833
128 Ga0395900_0186083 3300037418 Bacteria 2108
129 Ga0395900_0302577 3300037418 Bacteria 1585
130 Ga0395901_0041541 3300038443 Bacteria 4767
131 Ga0400488_28788 3300038741 Bacteria 1065
132 Ga0400486_04379 3300038742 Bacteria 2620
133 Ga0400483_050763 3300039062 Unclassified 1238
134 Ga0400483_241217 3300039062 Eukaryota 1315
135 Ga0400487_03567 3300039110 Eukaryota 56162
136 Ga0436365_1637588 3300039437 Bacteria 49130
137 Ga0436360_0028901 3300039438 Bacteria 883
138 Ga0436363_0427400 3300039450 Bacteria 3997
139 Ga0436363_1330839 3300039450 Bacteria 585
140 Ga0436363_1470856 3300039450 Bacteria 3937
141 Ga0451839_1610991 3300041496 Bacteria 591
142 Ga0466963_0375241 3300044694 Bacteria 1002
143 Ga0466964_0136044 3300044706 Bacteria 1124
144 Ga0453684_0026762 3300044712 Bacteria 8311
145 Ga0453684_0070476 3300044712 Eukaryota 4427
146 Ga0453684_2514307 3300044712 Eukaryota 508
147 Ga0451576_0196053 3300045051 Eukaryota 2109
148 Ga0466958_0259205 3300045836 Bacteria 1113
149 Ga0466967_0059567 3300045976 Bacteria 3380
150 Ga0466967_0812956 3300045976 Bacteria 928
151 Ga0495629_0405578 3300046459 Bacteria 926
152 Ga0495580_0003736 3300046472 Bacteria 12895
153 Ga0495582_0043074 3300046473 Bacteria 2486
154 Ga0495639_0582843 3300046475 Bacteria 574
155 Ga0495665_0521960 3300046531 Bacteria 597
156 Ga0495657_0316650 3300046675 Bacteria 928
157 Ga0495658_0001492 3300046683 Bacteria 12268
158 Ga0495613_0169492 3300046689 Bacteria 1550
159 Ga0495674_0110175 3300047319 Bacteria 2335
160 Ga0495675_0304620 3300047444 Bacteria 946
161 Ga0495602_0814233 3300048088 Bacteria 626
162 Ga0501291_116555 3300049514 Bacteria 575
163 Ga0501298_035298 3300049521 Bacteria 997
164 Ga0501031_0094198 3300049568 Bacteria 1954
165 Ga0501032_0030051 3300049569 Bacteria 3727
166 Ga0501033_0141890 3300049570 Bacteria 1736
167 Ga0501034_0076809 3300049571 Bacteria 3346
168 Ga0501036_0009536 3300049572 Bacteria 7983
169 Ga0501036_1006234 3300049572 Bacteria 682
170 Ga0501036_1494837 3300049572 Bacteria 546
171 Ga0501037_0267029 3300049573 Bacteria 1195
172 Ga0501038_0560080 3300049574 Bacteria 868
173 Ga0501039_0168128 3300049575 Bacteria 1724
174 Ga0501039_0493272 3300049575 Bacteria 962
175 Ga0501042_0273066 3300049578 Bacteria 1221
176 Ga0501043_0685434 3300049579 Bacteria 750
177 Ga0501046_0711158 3300049580 Bacteria 707
178 Ga0501047_0025996 3300049581 Bacteria 5629
179 Ga0501047_0075405 3300049581 Bacteria 3245
180 Ga0501047_0267162 3300049581 Bacteria 1557
181 Ga0501047_0502068 3300049581 Bacteria 1040
182 Ga0501048_0124442 3300049582 Bacteria 1823
183 Ga0501067_0005350 3300049583 Bacteria 7126
184 Ga0501067_0005578 3300049583 Bacteria 6979
185 Ga0501069_0439375 3300049585 Bacteria 775
186 Ga0501070_0000481 3300049586 Bacteria 36249
187 Ga0501070_0003398 3300049586 Bacteria 13819
188 Ga0501070_0031071 3300049586 Bacteria 4473
189 Ga0501072_0015507 3300049588 Bacteria 5840
190 Ga0501073_0004494 3300049589 Bacteria 10476
191 Ga0501073_0015128 3300049589 Bacteria 5597
192 Ga0501074_0042382 3300049590 Bacteria 3293
193 Ga0501074_0172806 3300049590 Bacteria 1542
194 Ga0501074_0382006 3300049590 Bacteria 999
195 Ga0501074_0759005 3300049590 Bacteria 684
196 Ga0501075_0575858 3300049591 Bacteria 859
197 Ga0501077_0801341 3300049593 Bacteria 606
198 Ga0501198_070080 3300049649 Bacteria 660
199 Ga0501198_096075 3300049649 Bacteria 594
200 Ga0501261_127587 3300049690 Bacteria 510
201 Ga0501219_012224 3300049703 Bacteria 663
202 Ga0501079_0017836 3300049741 Bacteria 5421
203 Ga0501079_0188192 3300049741 Bacteria 1611
204 Ga0501080_0006960 3300049742 Bacteria 10202
205 Ga0501080_0018079 3300049742 Bacteria 6526
206 Ga0501080_0062400 3300049742 Bacteria 3468
207 Ga0501081_1494682 3300049743 Bacteria 513
208 Ga0501083_0733476 3300049744 Unclassified 643
209 Ga0501035_0037025 3300049822 Bacteria 4420
210 Ga0501035_0186281 3300049822 Bacteria 1786
211 Ga0501044_0032329 3300049823 Bacteria 5501
212 Ga0501044_0187794 3300049823 Bacteria 2030
213 Ga0501044_0265916 3300049823 Bacteria 1652
214 Ga0501044_0572541 3300049823 Bacteria 1024
215 Ga0501044_0820153 3300049823 Bacteria 808
216 nmdc:mga09592_789047_c1 3300050508 Bacteria 804
217 nmdc:mga0qj67_734278_c1 3300050509 Bacteria 784
218 Ga0495619_0715723 3300053085 Bacteria 680
219 Ga0501084_0029906 3300054114 Bacteria 4556
220 Ga0501084_0048815 3300054114 Bacteria 3543
221 Ga0501084_0595352 3300054114 Bacteria 934
222 Ga0501084_1685262 3300054114 Bacteria 530
223 Ga0501082_0107936 3300060353 Bacteria 2409
224 Ga0501082_1181191 3300060353 Bacteria 669
225 Ga0530510_0169326 3300061734 Bacteria 1618
226 Ga0530510_1411876 3300061734 Bacteria 534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100552612 Ga0307415_1005526121 87
2 3300009098 Ga0105245_10202856 Ga0105245_102028563 92
3 3300025927 Ga0207687_10017844 Ga0207687_100178448 92
4 3300005563 Ga0068855_101327035 Ga0068855_1013270352 94
5 3300009551 Ga0105238_10737084 Ga0105238_107370841 94
6 3300033524 Ga0316592_1005231 Ga0316592_10052312 95
7 3300033524 Ga0316592_1008054 Ga0316592_10080541 95
8 3300033524 Ga0316592_1016510 Ga0316592_10165103 95
9 3300033527 Ga0316586_1118853 Ga0316586_11188531 95
10 3300033528 Ga0316588_1010425 Ga0316588_10104254 95
11 3300044712 Ga0453684_2514307 Ga0453684_2514307_187_474 95
12 3300014326 Ga0157380_12505430 Ga0157380_125054302 96
13 3300049591 Ga0501075_0575858 Ga0501075_0575858_284_589 96
14 3300049649 Ga0501198_096075 Ga0501198_096075_13_303 96
15 3300061734 Ga0530510_1411876 Ga0530510_1411876_65_370 96
16 3300013297 Ga0157378_10008956 Ga0157378_1000895612 100
17 3300014325 Ga0163163_12554707 Ga0163163_125547071 100
18 3300027552 Ga0209982_1023326 Ga0209982_10233262 100
19 3300031727 Ga0316576_10025702 Ga0316576_100257022 100
20 3300031728 Ga0316578_10038018 Ga0316578_100380182 100
21 3300032126 Ga0307415_100165328 Ga0307415_1001653282 100
22 3300033524 Ga0316592_1001713 Ga0316592_10017138 100
23 3300033528 Ga0316588_1026013 Ga0316588_10260131 100
24 3300039062 Ga0400483_050763 Ga0400483_050763_222_524 100
25 3300039062 Ga0400483_241217 Ga0400483_241217_478_780 100
26 3300039110 Ga0400487_03567 Ga0400487_03567_47166_47468 100
27 3300044712 Ga0453684_0070476 Ga0453684_0070476_734_1036 100
28 3300045051 Ga0451576_0196053 Ga0451576_0196053_605_907 100
29 3300003214 JGI25165J46597_1001315 JGI25165J46597_100131512 101
30 3300003320 rootH2_10048944 rootH2_100489441 101
31 3300003320 rootH2_10093439 rootH2_100934392 101
32 3300003320 rootH2_10168355 rootH2_101683553 101
33 3300005327 Ga0070658_10857372 Ga0070658_108573721 101
34 3300005330 Ga0070690_100593715 Ga0070690_1005937152 101
35 3300005331 Ga0070670_101844696 Ga0070670_1018446962 101
36 3300005341 Ga0070691_10261507 Ga0070691_102615072 101
37 3300005344 Ga0070661_100005946 Ga0070661_1000059465 101
38 3300005366 Ga0070659_101588435 Ga0070659_1015884352 101
39 3300005435 Ga0070714_100273243 Ga0070714_1002732432 101
40 3300005436 Ga0070713_100162144 Ga0070713_1001621444 101
41 3300005436 Ga0070713_101569033 Ga0070713_1015690332 101
42 3300005439 Ga0070711_101326801 Ga0070711_1013268012 101
43 3300005444 Ga0070694_100835981 Ga0070694_1008359812 101
44 3300005535 Ga0070684_100312947 Ga0070684_1003129472 101
45 3300005545 Ga0070695_100266207 Ga0070695_1002662072 101
46 3300005842 Ga0068858_101287761 Ga0068858_1012877612 101
47 3300005981 Ga0081538_10003741 Ga0081538_1000374116 101
48 3300006028 Ga0070717_10387942 Ga0070717_103879422 101
49 3300006237 Ga0097621_101929408 Ga0097621_1019294081 101
50 3300006844 Ga0075428_100908885 Ga0075428_1009088852 101
51 3300006846 Ga0075430_101593664 Ga0075430_1015936642 101
52 3300009093 Ga0105240_10763362 Ga0105240_107633622 101
53 3300009093 Ga0105240_12678305 Ga0105240_126783052 101
54 3300009176 Ga0105242_10069068 Ga0105242_100690687 101
55 3300009176 Ga0105242_12696661 Ga0105242_126966611 101
56 3300009177 Ga0105248_12443525 Ga0105248_124435252 101
57 3300010375 Ga0105239_12819734 Ga0105239_128197342 101
58 3300013100 Ga0157373_10256054 Ga0157373_102560542 101
59 3300013100 Ga0157373_10845482 Ga0157373_108454822 101
60 3300013105 Ga0157369_10297493 Ga0157369_102974933 101
61 3300013307 Ga0157372_10007016 Ga0157372_100070167 101
62 3300013307 Ga0157372_10066383 Ga0157372_100663833 101
63 3300014969 Ga0157376_10147364 Ga0157376_101473644 101
64 3300014969 Ga0157376_10332857 Ga0157376_103328573 101
65 3300021377 Ga0213874_10002785 Ga0213874_100027857 101
66 3300021377 Ga0213874_10006777 Ga0213874_100067774 101
67 3300021384 Ga0213876_10000421 Ga0213876_1000042117 101
68 3300025898 Ga0207692_10166684 Ga0207692_101666842 101
69 3300025901 Ga0207688_10262458 Ga0207688_102624582 101
70 3300025913 Ga0207695_10551357 Ga0207695_105513572 101
71 3300025913 Ga0207695_11262508 Ga0207695_112625082 101
72 3300025927 Ga0207687_11918912 Ga0207687_119189122 101
73 3300025929 Ga0207664_11223358 Ga0207664_112233582 101
74 3300025934 Ga0207686_10037974 Ga0207686_100379747 101
75 3300026078 Ga0207702_12031562 Ga0207702_120315621 101
76 3300028556 Ga0265337_1034178 Ga0265337_10341784 101
77 3300028563 Ga0265319_1008011 Ga0265319_10080118 101
78 3300028563 Ga0265319_1201766 Ga0265319_12017662 101
79 3300028573 Ga0265334_10053153 Ga0265334_100531533 101
80 3300028577 Ga0265318_10004788 Ga0265318_100047882 101
81 3300028654 Ga0265322_10154096 Ga0265322_101540961 101
82 3300028666 Ga0265336_10078427 Ga0265336_100784272 101
83 3300028800 Ga0265338_10126730 Ga0265338_101267305 101
84 3300029957 Ga0265324_10238011 Ga0265324_102380112 101
85 3300031235 Ga0265330_10006774 Ga0265330_100067742 101
86 3300031238 Ga0265332_10180643 Ga0265332_101806432 101
87 3300031239 Ga0265328_10059974 Ga0265328_100599742 101
88 3300031240 Ga0265320_10057577 Ga0265320_100575771 101
89 3300031240 Ga0265320_10058685 Ga0265320_100586851 101
90 3300031241 Ga0265325_10193080 Ga0265325_101930802 101
91 3300031241 Ga0265325_10213204 Ga0265325_102132041 101
92 3300031241 Ga0265325_10313159 Ga0265325_103131592 101
93 3300031242 Ga0265329_10058829 Ga0265329_100588292 101
94 3300031247 Ga0265340_10042793 Ga0265340_100427931 101
95 3300031247 Ga0265340_10056107 Ga0265340_100561071 101
96 3300031247 Ga0265340_10539012 Ga0265340_105390122 101
97 3300031249 Ga0265339_10057525 Ga0265339_100575254 101
98 3300031249 Ga0265339_10081034 Ga0265339_100810342 101
99 3300031249 Ga0265339_10366929 Ga0265339_103669292 101
100 3300031250 Ga0265331_10002422 Ga0265331_1000242216 101
101 3300031250 Ga0265331_10017155 Ga0265331_100171553 101
102 3300031250 Ga0265331_10036854 Ga0265331_100368542 101
103 3300031344 Ga0265316_10028793 Ga0265316_100287937 101
104 3300031344 Ga0265316_10077735 Ga0265316_100777354 101
105 3300031344 Ga0265316_10233900 Ga0265316_102339003 101
106 3300031595 Ga0265313_10004186 Ga0265313_1000418616 101
107 3300031595 Ga0265313_10016556 Ga0265313_100165569 101
108 3300031595 Ga0265313_10019748 Ga0265313_100197482 101
109 3300031595 Ga0265313_10139128 Ga0265313_101391282 101
110 3300031595 Ga0265313_10425620 Ga0265313_104256202 101
111 3300031711 Ga0265314_10027129 Ga0265314_100271298 101
112 3300031711 Ga0265314_10027518 Ga0265314_100275182 101
113 3300031711 Ga0265314_10062141 Ga0265314_100621414 101
114 3300031711 Ga0265314_10174454 Ga0265314_101744542 101
115 3300031711 Ga0265314_10206501 Ga0265314_102065012 101
116 3300031711 Ga0265314_10218330 Ga0265314_102183303 101
117 3300031712 Ga0265342_10006333 Ga0265342_100063334 101
118 3300031712 Ga0265342_10049147 Ga0265342_100491475 101
119 3300031712 Ga0265342_10049993 Ga0265342_100499932 101
120 3300031712 Ga0265342_10052173 Ga0265342_100521733 101
121 3300031731 Ga0307405_10907370 Ga0307405_109073702 101
122 3300032002 Ga0307416_100276671 Ga0307416_1002766713 101
123 3300032002 Ga0307416_100515390 Ga0307416_1005153902 101
124 3300035113 Ga0373936_0008097 Ga0373936_0008097_61_366 101
125 3300035116 Ga0373945_0006653 Ga0373945_0006653_1978_2283 101
126 3300035170 Ga0373943_0080948 Ga0373943_0080948_1022_1327 101
127 3300035691 Ga0373931_0290104 Ga0373931_0290104_361_666 101
128 3300035692 Ga0373935_0003403 Ga0373935_0003403_6358_6663 101
129 3300035695 Ga0373927_0093543 Ga0373927_0093543_133_438 101
130 3300035724 Ga0373933_0616071 Ga0373933_0616071_252_557 101
131 3300035725 Ga0373947_0011709 Ga0373947_0011709_3710_4015 101
132 3300035725 Ga0373947_0124556 Ga0373947_0124556_741_1046 101
133 3300036401 Ga0373937_0607216 Ga0373937_0607216_506_811 101
134 3300036401 Ga0373937_1572797 Ga0373937_1572797_190_495 101
135 3300037068 Ga0373925_0002514 Ga0373925_0002514_8278_8583 101
136 3300037312 Ga0395899_0001783 Ga0395899_0001783_3367_3744 101
137 3300037418 Ga0395900_0186083 Ga0395900_0186083_772_1077 101
138 3300037418 Ga0395900_0302577 Ga0395900_0302577_374_679 101
139 3300038443 Ga0395901_0041541 Ga0395901_0041541_4217_4522 101
140 3300038741 Ga0400488_28788 Ga0400488_28788_493_798 101
141 3300038742 Ga0400486_04379 Ga0400486_04379_950_1255 101
142 3300039437 Ga0436365_1637588 Ga0436365_1637588_25802_26107 101
143 3300039438 Ga0436360_0028901 Ga0436360_0028901_123_428 101
144 3300039450 Ga0436363_0427400 Ga0436363_0427400_1270_1575 101
145 3300039450 Ga0436363_1330839 Ga0436363_1330839_109_414 101
146 3300039450 Ga0436363_1470856 Ga0436363_1470856_676_981 101
147 3300041496 Ga0451839_1610991 Ga0451839_1610991_20_325 101
148 3300044694 Ga0466963_0375241 Ga0466963_0375241_432_737 101
149 3300044706 Ga0466964_0136044 Ga0466964_0136044_238_543 101
150 3300044712 Ga0453684_0026762 Ga0453684_0026762_992_1297 101
151 3300045836 Ga0466958_0259205 Ga0466958_0259205_235_540 101
152 3300045976 Ga0466967_0059567 Ga0466967_0059567_764_1069 101
153 3300045976 Ga0466967_0812956 Ga0466967_0812956_110_415 101
154 3300046459 Ga0495629_0405578 Ga0495629_0405578_219_524 101
155 3300046472 Ga0495580_0003736 Ga0495580_0003736_4251_4556 101
156 3300046473 Ga0495582_0043074 Ga0495582_0043074_268_573 101
157 3300046475 Ga0495639_0582843 Ga0495639_0582843_169_474 101
158 3300046531 Ga0495665_0521960 Ga0495665_0521960_183_488 101
159 3300046675 Ga0495657_0316650 Ga0495657_0316650_267_572 101
160 3300046683 Ga0495658_0001492 Ga0495658_0001492_8230_8535 101
161 3300046689 Ga0495613_0169492 Ga0495613_0169492_327_632 101
162 3300047319 Ga0495674_0110175 Ga0495674_0110175_222_527 101
163 3300047444 Ga0495675_0304620 Ga0495675_0304620_106_411 101
164 3300048088 Ga0495602_0814233 Ga0495602_0814233_307_612 101
165 3300049514 Ga0501291_116555 Ga0501291_116555_156_461 101
166 3300049521 Ga0501298_035298 Ga0501298_035298_346_651 101
167 3300049568 Ga0501031_0094198 Ga0501031_0094198_1297_1602 101
168 3300049569 Ga0501032_0030051 Ga0501032_0030051_368_673 101
169 3300049570 Ga0501033_0141890 Ga0501033_0141890_932_1237 101
170 3300049571 Ga0501034_0076809 Ga0501034_0076809_1840_2145 101
171 3300049572 Ga0501036_0009536 Ga0501036_0009536_3419_3724 101
172 3300049572 Ga0501036_1006234 Ga0501036_1006234_36_341 101
173 3300049572 Ga0501036_1494837 Ga0501036_1494837_83_388 101
174 3300049573 Ga0501037_0267029 Ga0501037_0267029_100_405 101
175 3300049574 Ga0501038_0560080 Ga0501038_0560080_460_765 101
176 3300049575 Ga0501039_0168128 Ga0501039_0168128_1204_1509 101
177 3300049575 Ga0501039_0493272 Ga0501039_0493272_573_878 101
178 3300049578 Ga0501042_0273066 Ga0501042_0273066_189_494 101
179 3300049579 Ga0501043_0685434 Ga0501043_0685434_233_538 101
180 3300049580 Ga0501046_0711158 Ga0501046_0711158_87_392 101
181 3300049581 Ga0501047_0025996 Ga0501047_0025996_221_526 101
182 3300049581 Ga0501047_0075405 Ga0501047_0075405_2302_2607 101
183 3300049581 Ga0501047_0267162 Ga0501047_0267162_92_397 101
184 3300049581 Ga0501047_0502068 Ga0501047_0502068_252_557 101
185 3300049582 Ga0501048_0124442 Ga0501048_0124442_74_379 101
186 3300049583 Ga0501067_0005350 Ga0501067_0005350_6811_7116 101
187 3300049583 Ga0501067_0005578 Ga0501067_0005578_2635_2940 101
188 3300049585 Ga0501069_0439375 Ga0501069_0439375_120_425 101
189 3300049586 Ga0501070_0000481 Ga0501070_0000481_32809_33114 101
190 3300049586 Ga0501070_0003398 Ga0501070_0003398_7406_7711 101
191 3300049586 Ga0501070_0031071 Ga0501070_0031071_3409_3714 101
192 3300049588 Ga0501072_0015507 Ga0501072_0015507_5124_5429 101
193 3300049589 Ga0501073_0004494 Ga0501073_0004494_3396_3701 101
194 3300049589 Ga0501073_0015128 Ga0501073_0015128_2605_2910 101
195 3300049590 Ga0501074_0042382 Ga0501074_0042382_559_864 101
196 3300049590 Ga0501074_0172806 Ga0501074_0172806_1075_1380 101
197 3300049590 Ga0501074_0382006 Ga0501074_0382006_358_663 101
198 3300049590 Ga0501074_0759005 Ga0501074_0759005_162_467 101
199 3300049593 Ga0501077_0801341 Ga0501077_0801341_191_496 101
200 3300049649 Ga0501198_070080 Ga0501198_070080_155_460 101
201 3300049690 Ga0501261_127587 Ga0501261_127587_191_496 101
202 3300049703 Ga0501219_012224 Ga0501219_012224_16_321 101
203 3300049741 Ga0501079_0017836 Ga0501079_0017836_1823_2128 101
204 3300049741 Ga0501079_0188192 Ga0501079_0188192_318_623 101
205 3300049742 Ga0501080_0006960 Ga0501080_0006960_810_1115 101
206 3300049742 Ga0501080_0018079 Ga0501080_0018079_4486_4791 101
207 3300049742 Ga0501080_0062400 Ga0501080_0062400_559_864 101
208 3300049743 Ga0501081_1494682 Ga0501081_1494682_186_491 101
209 3300049744 Ga0501083_0733476 Ga0501083_0733476_241_546 101
210 3300049822 Ga0501035_0037025 Ga0501035_0037025_1699_2004 101
211 3300049822 Ga0501035_0186281 Ga0501035_0186281_1368_1673 101
212 3300049823 Ga0501044_0032329 Ga0501044_0032329_4151_4456 101
213 3300049823 Ga0501044_0187794 Ga0501044_0187794_613_918 101
214 3300049823 Ga0501044_0265916 Ga0501044_0265916_692_997 101
215 3300049823 Ga0501044_0572541 Ga0501044_0572541_676_981 101
216 3300049823 Ga0501044_0820153 Ga0501044_0820153_86_391 101
217 3300050508 nmdc:mga09592_789047_c1 nmdc:mga09592_789047_c1_438_743 101
218 3300050509 nmdc:mga0qj67_734278_c1 nmdc:mga0qj67_734278_c1_407_712 101
219 3300053085 Ga0495619_0715723 Ga0495619_0715723_124_429 101
220 3300054114 Ga0501084_0029906 Ga0501084_0029906_525_830 101
221 3300054114 Ga0501084_0048815 Ga0501084_0048815_3012_3317 101
222 3300054114 Ga0501084_0595352 Ga0501084_0595352_560_865 101
223 3300054114 Ga0501084_1685262 Ga0501084_1685262_152_457 101
224 3300060353 Ga0501082_0107936 Ga0501082_0107936_1002_1307 101
225 3300060353 Ga0501082_1181191 Ga0501082_1181191_177_482 101
226 3300061734 Ga0530510_0169326 Ga0530510_0169326_75_380 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

71

124

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_NN the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.8726 7 101
5mrc-assembly1.cif.gz_NN structure of the yeast mitochondrial ribosome - class a 0.8681 6 101
7pnu-assembly1.cif.gz_K assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa inward conformation 0.864 7 101
8any-assembly1.cif.gz_AK human mitochondrial ribosome in complex with lrpprc, slirp, a-site, p-site, e-site trnas and mrna 0.8636 7 101
7nql-assembly1.cif.gz_AN 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.8593 7 101
ID Description Score Start End Superfamily
af_K7K3I6_14_100_3.30.260.10 Alpha Beta;2-Layer Sandwich;GROEL; domain 2;TCP-1-like chaperonin intermediate domain 0.952 24 51 3.30.260.10
af_Q5AJZ7_16_105_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9371 6 91 1.10.287.1480
af_M1FQJ9_1_90_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9172 1 91 1.10.287.1480
af_O42859_6_94_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9131 6 89 1.10.287.1480
af_M1FQJ9_1_90_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9078 1 91 1.10.287.1480
ID Description Score Start End GO Terms
AF-A0A498MQB2-F1-model_v4 Calcyclin-binding protein 0.9884 7 63 GO:0005634
GO:0005737
GO:0007507
GO:0015631
GO:0031625
GO:0044548
AF-A0A229YYJ9-F1-model_v4 Arb2 domain-containing protein 0.9808 6 81 GO:0003735
GO:0005634
GO:0005840
GO:0006412
GO:0031048
GO:0035197
GO:1990904
AF-A0A559LY09-F1-model_v4 37S ribosomal protein, mitochondrial 0.9806 25 81 GO:0003735
GO:0005763
GO:0006412
AF-A0A425BPZ2-F1-model_v4 deleted 0.9799 7 81
AF-A0A2R7S599-F1-model_v4 deleted 0.9771 1 61

Feature Viewer

pLDDT pTM Quality
84.77 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map