F339081

General Info

Members Datasets Scaffolds Average Seq Length
226 148 204 216

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1843561|Ga0436365_1843561_297_1085
Length 262
Sequence MTYAARSVTAKRELLLRKRNLLIEELYTLHLVDAGSGIPVQQRQVLMAQLFRPSSNTIAKVSIAVVVLLACGTLAVGYIIDRGTWITSVRHAPEQPIMFSHKHHVKDDGIDCRYCHTSVETSGYAGLPPTETCMSCHSQIWNNVAITQPIRDSWASGRSIPWTRVHDLPDFVYFNHSIHVNKGIGCSTCHGQVNEMPLLFKVNTLYMNWCLDCHRDPARYVRPRSEVFNIDYKYPANQAELGRQLVKEYHVQSLTDCVTCHR

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
3 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
4 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
5 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
6 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
7 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
8 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
9 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
10 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
11 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
12 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
13 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
14 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
15 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
16 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
17 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
18 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
19 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
20 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
21 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.51
Metatranscriptomes 5.75
Isolates 9.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 9.29
Rhizoplane 2.21
Rhizosphere 69.91
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10056953 3300003323 Bacteria 7408
2 Ga0055539_1004231 3300003752 Bacteria 1922
3 Ga0055529_1012976 3300003763 Bacteria 1062
4 Ga0070658_10021543 3300005327 Bacteria 5166
5 Ga0070680_100091788 3300005336 Bacteria 2514
6 Ga0070660_100013786 3300005339 Bacteria 5814
7 Ga0070659_100375174 3300005366 Bacteria 1197
8 Ga0070709_10021553 3300005434 Unclassified 3754
9 Ga0070663_100213461 3300005455 Bacteria 1512
10 Ga0068853_100136525 3300005539 Bacteria 2199
11 Ga0070665_100020594 3300005548 Bacteria 6627
12 Ga0070665_100050572 3300005548 Bacteria 4170
13 Ga0068855_100057472 3300005563 Bacteria 4560
14 Ga0068855_100163477 3300005563 Bacteria 2525
15 Ga0070664_100127517 3300005564 Bacteria 2233
16 Ga0070664_100514395 3300005564 Bacteria 1104
17 Ga0068856_100039164 3300005614 Bacteria 4653
18 Ga0068856_100369841 3300005614 Bacteria 1452
19 Ga0068856_100705682 3300005614 Bacteria 1029
20 Ga0068852_100000871 3300005616 Bacteria 19997
21 Ga0068852_100104320 3300005616 Bacteria 2566
22 Ga0081455_10011250 3300005937 Bacteria 9003
23 Ga0070717_10136809 3300006028 Unclassified 2110
24 Ga0070715_10273754 3300006163 Unclassified 892
25 Ga0070712_100429677 3300006175 Unclassified 1096
26 Ga0097621_100061984 3300006237 Bacteria 3069
27 Ga0097621_100244659 3300006237 Unclassified 1569
28 Ga0068871_100010124 3300006358 Bacteria 6862
29 Ga0068871_100157083 3300006358 Unclassified 1943
30 Ga0075428_100463721 3300006844 Unclassified 1356
31 Ga0075431_100141880 3300006847 Unclassified 2476
32 Ga0075433_10244314 3300006852 Unclassified 1594
33 Ga0075429_100034503 3300006880 Bacteria 4397
34 Ga0105240_10016071 3300009093 Bacteria 10141
35 Ga0105240_10018467 3300009093 Bacteria 9363
36 Ga0105245_10067717 3300009098 Bacteria 3234
37 Ga0105242_10011377 3300009176 Bacteria 6841
38 Ga0105237_10241985 3300009545 Bacteria 1806
39 Ga0105237_10421095 3300009545 Bacteria 1341
40 Ga0105237_10464460 3300009545 Bacteria 1272
41 Ga0105238_10003786 3300009551 Bacteria 15032
42 Ga0105238_10915829 3300009551 Bacteria 895
43 Ga0105249_10688678 3300009553 Bacteria 1082
44 Ga0105239_10166279 3300010375 Bacteria 2467
45 Ga0105239_10169725 3300010375 Bacteria 2439
46 Ga0105239_10301287 3300010375 Bacteria 1805
47 Ga0105239_10407267 3300010375 Bacteria 1539
48 Ga0105246_10069917 3300011119 Bacteria 2467
49 Ga0105246_10535910 3300011119 Unclassified 1001
50 Ga0157373_10017809 3300013100 Bacteria 5173
51 Ga0157369_10266498 3300013105 Bacteria 1786
52 Ga0157369_10831557 3300013105 Unclassified 948
53 Ga0157374_10010125 3300013296 Bacteria 8100
54 Ga0157374_10035186 3300013296 Bacteria 4581
55 Ga0157374_10154982 3300013296 Bacteria 2229
56 Ga0157375_10151995 3300013308 Bacteria 2451
57 Ga0157376_10106258 3300014969 Unclassified 2462
58 Ga0157376_10546847 3300014969 Bacteria 1145
59 Ga0197907_10824217 3300020069 Unclassified 1451
60 Ga0206356_10723666 3300020070 Unclassified 1461
61 Ga0206349_1394843 3300020075 Unclassified 1407
62 Ga0206355_1094077 3300020076 Unclassified 1639
63 Ga0206350_10342342 3300020080 Bacteria 1930
64 Ga0206354_10120038 3300020081 Unclassified 1486
65 Ga0206353_10774820 3300020082 Unclassified 1488
66 Ga0154015_1079017 3300020610 Unclassified 1182
67 Ga0213873_10022811 3300021358 Bacteria 1486
68 Ga0213874_10018228 3300021377 Bacteria 1895
69 Ga0213876_10099665 3300021384 Bacteria 1540
70 Ga0213876_10183255 3300021384 Bacteria 1114
71 Ga0213876_10322839 3300021384 Bacteria 821
72 Ga0213875_10000575 3300021388 Bacteria 29979
73 Ga0213875_10037102 3300021388 Bacteria 2297
74 Ga0213875_10037902 3300021388 Bacteria 2271
75 Ga0213875_10058512 3300021388 Unclassified 1804
76 Ga0213871_10000091 3300021441 Bacteria 8091
77 Ga0224712_10045672 3300022467 Bacteria 1677
78 Ga0209148_1000215 3300025254 Bacteria 99154
79 Ga0209148_1005875 3300025254 Bacteria 2735
80 Ga0209233_1003761 3300025261 Bacteria 5301
81 Ga0209455_1001581 3300025272 Bacteria 10032
82 Ga0209455_1002577 3300025272 Bacteria 6912
83 Ga0209758_1000582 3300025297 Bacteria 56979
84 Ga0207699_10186896 3300025906 Unclassified 1396
85 Ga0207705_10021380 3300025909 Bacteria 4617
86 Ga0207695_10025987 3300025913 Bacteria 6543
87 Ga0207695_10107780 3300025913 Bacteria 2771
88 Ga0207671_10167928 3300025914 Bacteria 1702
89 Ga0207693_10074550 3300025915 Bacteria 2658
90 Ga0207660_10034640 3300025917 Bacteria 3501
91 Ga0207649_10055440 3300025920 Bacteria 2471
92 Ga0207652_10211933 3300025921 Bacteria 1744
93 Ga0207694_10010908 3300025924 Bacteria 6863
94 Ga0207687_10165452 3300025927 Bacteria 1701
95 Ga0207664_10569088 3300025929 Unclassified 1017
96 Ga0207690_10254629 3300025932 Bacteria 1358
97 Ga0207686_10005211 3300025934 Bacteria 6981
98 Ga0207667_10075839 3300025949 Bacteria 3490
99 Ga0207677_10508110 3300026023 Bacteria 1043
100 Ga0207639_10040015 3300026041 Bacteria 3497
101 Ga0207639_10493426 3300026041 Bacteria 1118
102 Ga0207678_10241262 3300026067 Bacteria 1548
103 Ga0207702_10026632 3300026078 Bacteria 4800
104 Ga0207702_10245718 3300026078 Bacteria 1678
105 Ga0207702_10263111 3300026078 Bacteria 1625
106 Ga0207702_10659212 3300026078 Bacteria 1030
107 Ga0207698_10007734 3300026142 Bacteria 6745
108 Ga0207698_10040249 3300026142 Bacteria 3470
109 Ga0207698_10265867 3300026142 Bacteria 1578
110 Ga0207428_10273861 3300027907 Bacteria 1254
111 Ga0268266_10014773 3300028379 Bacteria 6707
112 Ga0268266_10347128 3300028379 Unclassified 1394
113 Ga0268265_10755068 3300028380 Unclassified 944
114 Ga0268264_10184225 3300028381 Bacteria 1899
115 Ga0265313_10113815 3300031595 Bacteria 1187
116 Ga0436364_0026958 3300037853 Unclassified 2570
117 Ga0436364_0094995 3300037853 Bacteria 5235
118 Ga0436364_0227473 3300037853 Bacteria 7017
119 Ga0436364_0286584 3300037853 Unclassified 3834
120 Ga0436364_0509154 3300037853 Unclassified 1141
121 Ga0436364_0962966 3300037853 Bacteria 4231
122 Ga0436364_1039994 3300037853 Bacteria 1995
123 Ga0436364_1229015 3300037853 Bacteria 6761
124 Ga0436364_1244217 3300037853 Bacteria 7163
125 Ga0436364_1318901 3300037853 Unclassified 1229
126 Ga0436364_1459972 3300037853 Bacteria 47280
127 Ga0436365_0237214 3300039437 Bacteria 1667
128 Ga0436365_0430461 3300039437 Bacteria 2437
129 Ga0436365_0808021 3300039437 Bacteria 1800
130 Ga0436365_1330440 3300039437 Bacteria 1366
131 Ga0436365_1550568 3300039437 Bacteria 1796
132 Ga0436365_1613940 3300039437 Bacteria 5353
133 Ga0436365_1843561 3300039437 Unclassified 1350
134 Ga0436360_0369628 3300039438 Bacteria 14799
135 Ga0436360_1132986 3300039438 Bacteria 1451
136 Ga0436361_0474393 3300039447 Bacteria 166415
137 Ga0436361_0946679 3300039447 Unclassified 1077
138 Ga0436363_1126302 3300039450 Bacteria 773
139 Ga0436363_1168796 3300039450 Unclassified 2350
140 Ga0436363_1370640 3300039450 Unclassified 1346
141 Ga0436363_1371829 3300039450 Bacteria 1145
142 Ga0436363_1371966 3300039450 Unclassified 1478
143 Ga0436362_0337344 3300039453 Bacteria 2074
144 Ga0436362_0580880 3300039453 Bacteria 1685
145 Ga0436362_0779798 3300039453 Bacteria 1939
146 Ga0436362_0870549 3300039453 Unclassified 1156
147 Ga0451833_1096331 3300041491 Bacteria 744
148 Ga0466969_0026940 3300044656 Bacteria 2946
149 Ga0466972_0009695 3300044658 Bacteria 4832
150 Ga0466972_0131852 3300044658 Bacteria 1177
151 Ga0466972_0254158 3300044658 Bacteria 821
152 Ga0466966_0000169 3300044684 Bacteria 42828
153 Ga0466966_0043954 3300044684 Bacteria 2862
154 Ga0466966_0379613 3300044684 Bacteria 849
155 Ga0466961_0000004 3300044693 Bacteria 175855
156 Ga0466961_0187117 3300044693 Bacteria 1284
157 Ga0466963_0381227 3300044694 Bacteria 994
158 Ga0466971_0251948 3300044719 Bacteria 841
159 Ga0466968_0004665 3300044735 Bacteria 5131
160 Ga0466968_0034753 3300044735 Bacteria 2106
161 Ga0466970_0016693 3300044765 Bacteria 3788
162 Ga0466970_0218801 3300044765 Unclassified 1063
163 Ga0466957_0508639 3300044842 Bacteria 836
164 Ga0466957_0640856 3300044842 Unclassified 746
165 Ga0466960_0047051 3300044901 Bacteria 2067
166 Ga0466960_0102004 3300044901 Bacteria 1479
167 Ga0466959_0066353 3300045049 Bacteria 2618
168 Ga0466959_0175237 3300045049 Bacteria 1503
169 Ga0466959_0226035 3300045049 Bacteria 1297
170 Ga0466958_0058546 3300045836 Bacteria 2343
171 Ga0495600_0326235 3300046809 Bacteria 965
172 Ga0496104_0448431 3300048907 Bacteria 1202
173 Ga0496108_0788684 3300048911 Bacteria 820
174 Ga0496109_0717826 3300048912 Bacteria 937
175 Ga0496115_0008253 3300048918 Bacteria 7698
176 Ga0496115_0082096 3300048918 Bacteria 2626
177 Ga0501312_020926 3300049528 Unclassified 971
178 Ga0501032_0009125 3300049569 Bacteria 7198
179 Ga0501034_0002978 3300049571 Bacteria 19609
180 Ga0501038_0001116 3300049574 Bacteria 24370
181 Ga0501043_0000151 3300049579 Bacteria 64913
182 Ga0501043_0318084 3300049579 Bacteria 1187
183 Ga0501046_0000026 3300049580 Bacteria 197226
184 Ga0501047_0002851 3300049581 Bacteria 16393
185 Ga0501047_0181638 3300049581 Bacteria 1970
186 Ga0501048_0021512 3300049582 Bacteria 4723
187 Ga0501072_0091397 3300049588 Bacteria 2417
188 Ga0501083_0000006 3300049744 Bacteria 199638
189 Ga0501035_0397301 3300049822 Unclassified 1147
190 Ga0501044_0037078 3300049823 Bacteria 5098
191 Ga0501044_0054198 3300049823 Bacteria 4123
192 Ga0501044_0072930 3300049823 Bacteria 3490
193 Ga0501044_0152584 3300049823 Bacteria 2292
194 Ga0501045_0602465 3300049824 Bacteria 813
195 nmdc:mga05p37_13513_c1 3300050507 Bacteria 9786
196 nmdc:mga09592_199709_c1 3300050508 Bacteria 1732
197 nmdc:mga09592_26701_c1 3300050508 Bacteria 4785
198 nmdc:mga06r32_43338_c1 3300050510 Bacteria 4282
199 nmdc:mga0n895_143993_c1 3300050512 Bacteria 2412
200 nmdc:mga0rr50_121926_c1 3300050513 Bacteria 2076
201 nmdc:mga0a205_262723_c1 3300050515 Unclassified 1604
202 Ga0587073_0049025 3300059492 Bacteria 950
203 Ga0587083_0043697 3300059505 Bacteria 949
204 Ga0587067_031723 3300059640 Bacteria 978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0009695 Ga0466972_0009695_849_1403 184
2 3300044684 Ga0466966_0379613 Ga0466966_0379613_43_597 184
3 3300044735 Ga0466968_0034753 Ga0466968_0034753_1414_1968 184
4 3300048911 Ga0496108_0788684 Ga0496108_0788684_216_770 184
5 3300039437 Ga0436365_1330440 Ga0436365_1330440_746_1354 202
6 3300044842 Ga0466957_0640856 Ga0466957_0640856_106_720 204
7 3300049571 Ga0501034_0002978 Ga0501034_0002978_5144_5809 210
8 3300049574 Ga0501038_0001116 Ga0501038_0001116_18651_19316 210
9 3300049579 Ga0501043_0318084 Ga0501043_0318084_421_1086 210
10 3300049581 Ga0501047_0181638 Ga0501047_0181638_1186_1851 210
11 3300049823 Ga0501044_0054198 Ga0501044_0054198_1455_2120 210
12 3300049823 Ga0501044_0152584 Ga0501044_0152584_1189_1854 210
13 3300050513 nmdc:mga0rr50_121926_c1 nmdc:mga0rr50_121926_c1_923_1579 211
14 iso_pu_bacteria 2508501009 2508541478 213
15 iso_pu_bacteria 2842038055 2842038479 213
16 iso_pu_bacteria 2842045827 2842048576 213
17 iso_pu_bacteria 2874590934 2874596548 213
18 iso_pu_bacteria 2874645413 2874653218 213
19 iso_pu_bacteria 2876771140 2876777156 213
20 iso_pu_bacteria 2876818435 2876825094 213
21 iso_pu_bacteria 2879074833 2879081293 213
22 iso_pu_bacteria 2879127579 2879129749 213
23 iso_pu_bacteria 2879142872 2879147743 213
24 iso_pu_bacteria 2903727486 2903731702 213
25 iso_pu_bacteria 2935648319 2935651159 213
26 iso_pu_bacteria 2935656913 2935659339 213
27 iso_pu_bacteria 2935769743 2935773892 213
28 iso_pu_bacteria 2935777560 2935779352 213
29 iso_pu_bacteria 2935785616 2935788672 213
30 iso_pu_bacteria 2935793552 2935795702 213
31 iso_pu_bacteria 2936011229 2936013754 213
32 iso_pu_bacteria 2936019824 2936022722 213
33 iso_pu_bacteria 2936028420 2936033225 213
34 iso_pu_bacteria 2936046547 2936048860 213
35 iso_pu_bacteria 8056967851 8056976409 213
36 3300005434 Ga0070709_10021553 Ga0070709_100215532 215
37 3300005548 Ga0070665_100020594 Ga0070665_1000205942 215
38 3300005548 Ga0070665_100050572 Ga0070665_1000505725 215
39 3300005563 Ga0068855_100057472 Ga0068855_1000574722 215
40 3300005564 Ga0070664_100127517 Ga0070664_1001275172 215
41 3300005614 Ga0068856_100039164 Ga0068856_1000391644 215
42 3300005937 Ga0081455_10011250 Ga0081455_100112502 215
43 3300006028 Ga0070717_10136809 Ga0070717_101368092 215
44 3300006163 Ga0070715_10273754 Ga0070715_102737542 215
45 3300006175 Ga0070712_100429677 Ga0070712_1004296772 215
46 3300006237 Ga0097621_100061984 Ga0097621_1000619842 215
47 3300006237 Ga0097621_100244659 Ga0097621_1002446592 215
48 3300006358 Ga0068871_100010124 Ga0068871_1000101242 215
49 3300006358 Ga0068871_100157083 Ga0068871_1001570832 215
50 3300006844 Ga0075428_100463721 Ga0075428_1004637212 215
51 3300006847 Ga0075431_100141880 Ga0075431_1001418802 215
52 3300006852 Ga0075433_10244314 Ga0075433_102443142 215
53 3300006880 Ga0075429_100034503 Ga0075429_1000345033 215
54 3300009093 Ga0105240_10016071 Ga0105240_100160716 215
55 3300009098 Ga0105245_10067717 Ga0105245_100677173 215
56 3300009176 Ga0105242_10011377 Ga0105242_100113775 215
57 3300009545 Ga0105237_10241985 Ga0105237_102419852 215
58 3300009545 Ga0105237_10421095 Ga0105237_104210952 215
59 3300009551 Ga0105238_10003786 Ga0105238_1000378611 215
60 3300009553 Ga0105249_10688678 Ga0105249_106886781 215
61 3300010375 Ga0105239_10169725 Ga0105239_101697252 215
62 3300011119 Ga0105246_10069917 Ga0105246_100699172 215
63 3300011119 Ga0105246_10535910 Ga0105246_105359102 215
64 3300013100 Ga0157373_10017809 Ga0157373_100178092 215
65 3300013105 Ga0157369_10266498 Ga0157369_102664982 215
66 3300013105 Ga0157369_10831557 Ga0157369_108315572 215
67 3300013296 Ga0157374_10010125 Ga0157374_100101259 215
68 3300013296 Ga0157374_10035186 Ga0157374_100351864 215
69 3300013296 Ga0157374_10154982 Ga0157374_101549822 215
70 3300013308 Ga0157375_10151995 Ga0157375_101519952 215
71 3300014969 Ga0157376_10106258 Ga0157376_101062582 215
72 3300014969 Ga0157376_10546847 Ga0157376_105468472 215
73 3300020069 Ga0197907_10824217 Ga0197907_108242172 215
74 3300020070 Ga0206356_10723666 Ga0206356_107236661 215
75 3300020075 Ga0206349_1394843 Ga0206349_13948432 215
76 3300020076 Ga0206355_1094077 Ga0206355_10940771 215
77 3300020080 Ga0206350_10342342 Ga0206350_103423422 215
78 3300020081 Ga0206354_10120038 Ga0206354_101200381 215
79 3300020082 Ga0206353_10774820 Ga0206353_107748202 215
80 3300020610 Ga0154015_1079017 Ga0154015_10790171 215
81 3300021377 Ga0213874_10018228 Ga0213874_100182282 215
82 3300021384 Ga0213876_10099665 Ga0213876_100996652 215
83 3300021388 Ga0213875_10037102 Ga0213875_100371022 215
84 3300021388 Ga0213875_10037902 Ga0213875_100379022 215
85 3300021388 Ga0213875_10058512 Ga0213875_100585122 215
86 3300021441 Ga0213871_10000091 Ga0213871_100000912 215
87 3300022467 Ga0224712_10045672 Ga0224712_100456721 215
88 3300025906 Ga0207699_10186896 Ga0207699_101868962 215
89 3300025913 Ga0207695_10025987 Ga0207695_100259872 215
90 3300025914 Ga0207671_10167928 Ga0207671_101679282 215
91 3300025915 Ga0207693_10074550 Ga0207693_100745502 215
92 3300025920 Ga0207649_10055440 Ga0207649_100554402 215
93 3300025921 Ga0207652_10211933 Ga0207652_102119332 215
94 3300025924 Ga0207694_10010908 Ga0207694_100109083 215
95 3300025927 Ga0207687_10165452 Ga0207687_101654522 215
96 3300025929 Ga0207664_10569088 Ga0207664_105690882 215
97 3300025934 Ga0207686_10005211 Ga0207686_100052115 215
98 3300025949 Ga0207667_10075839 Ga0207667_100758392 215
99 3300026023 Ga0207677_10508110 Ga0207677_105081101 215
100 3300026041 Ga0207639_10040015 Ga0207639_100400152 215
101 3300026078 Ga0207702_10026632 Ga0207702_100266322 215
102 3300026078 Ga0207702_10245718 Ga0207702_102457182 215
103 3300027907 Ga0207428_10273861 Ga0207428_102738612 215
104 3300028379 Ga0268266_10014773 Ga0268266_100147733 215
105 3300028379 Ga0268266_10347128 Ga0268266_103471282 215
106 3300028380 Ga0268265_10755068 Ga0268265_107550682 215
107 3300028381 Ga0268264_10184225 Ga0268264_101842251 215
108 3300031595 Ga0265313_10113815 Ga0265313_101138152 215
109 3300037853 Ga0436364_0094995 Ga0436364_0094995_3675_4325 215
110 3300037853 Ga0436364_0227473 Ga0436364_0227473_285_935 215
111 3300037853 Ga0436364_0286584 Ga0436364_0286584_2273_2923 215
112 3300037853 Ga0436364_0509154 Ga0436364_0509154_372_1022 215
113 3300037853 Ga0436364_0962966 Ga0436364_0962966_463_1113 215
114 3300037853 Ga0436364_1039994 Ga0436364_1039994_509_1159 215
115 3300037853 Ga0436364_1229015 Ga0436364_1229015_5491_6141 215
116 3300037853 Ga0436364_1244217 Ga0436364_1244217_3469_4119 215
117 3300037853 Ga0436364_1318901 Ga0436364_1318901_311_961 215
118 3300037853 Ga0436364_1459972 Ga0436364_1459972_38946_39602 215
119 3300039437 Ga0436365_0237214 Ga0436365_0237214_439_1089 215
120 3300039437 Ga0436365_0430461 Ga0436365_0430461_750_1400 215
121 3300039437 Ga0436365_1550568 Ga0436365_1550568_83_733 215
122 3300039437 Ga0436365_1613940 Ga0436365_1613940_3033_3683 215
123 3300039437 Ga0436365_1843561 Ga0436365_1843561_297_1085 215
124 3300039438 Ga0436360_0369628 Ga0436360_0369628_7134_7784 215
125 3300039447 Ga0436361_0474393 Ga0436361_0474393_14347_14997 215
126 3300039450 Ga0436363_1126302 Ga0436363_1126302_94_750 215
127 3300039450 Ga0436363_1371829 Ga0436363_1371829_184_834 215
128 3300039450 Ga0436363_1371966 Ga0436363_1371966_578_1228 215
129 3300039453 Ga0436362_0337344 Ga0436362_0337344_424_1074 215
130 3300039453 Ga0436362_0580880 Ga0436362_0580880_584_1234 215
131 3300039453 Ga0436362_0870549 Ga0436362_0870549_145_795 215
132 3300044684 Ga0466966_0043954 Ga0466966_0043954_1307_1957 215
133 3300044765 Ga0466970_0218801 Ga0466970_0218801_338_988 215
134 3300045049 Ga0466959_0175237 Ga0466959_0175237_358_1008 215
135 3300045836 Ga0466958_0058546 Ga0466958_0058546_240_890 215
136 3300046809 Ga0495600_0326235 Ga0495600_0326235_194_844 215
137 3300048907 Ga0496104_0448431 Ga0496104_0448431_229_879 215
138 3300048918 Ga0496115_0008253 Ga0496115_0008253_1513_2163 215
139 3300049528 Ga0501312_020926 Ga0501312_020926_178_828 215
140 3300049588 Ga0501072_0091397 Ga0501072_0091397_1204_1854 215
141 3300049823 Ga0501044_0037078 Ga0501044_0037078_4115_4765 215
142 3300050507 nmdc:mga05p37_13513_c1 nmdc:mga05p37_13513_c1_99_749 215
143 3300050508 nmdc:mga09592_199709_c1 nmdc:mga09592_199709_c1_1045_1695 215
144 3300050508 nmdc:mga09592_26701_c1 nmdc:mga09592_26701_c1_468_1118 215
145 3300050510 nmdc:mga06r32_43338_c1 nmdc:mga06r32_43338_c1_3559_4209 215
146 3300050512 nmdc:mga0n895_143993_c1 nmdc:mga0n895_143993_c1_849_1499 215
147 3300050515 nmdc:mga0a205_262723_c1 nmdc:mga0a205_262723_c1_249_899 215
148 3300059492 Ga0587073_0049025 Ga0587073_0049025_81_731 215
149 3300059505 Ga0587083_0043697 Ga0587083_0043697_105_755 215
150 3300059640 Ga0587067_031723 Ga0587067_031723_196_846 215
151 3300003323 rootH1_10056953 rootH1_100569532 217
152 3300003752 Ga0055539_1004231 Ga0055539_10042312 217
153 3300003763 Ga0055529_1012976 Ga0055529_10129762 217
154 3300005327 Ga0070658_10021543 Ga0070658_100215432 217
155 3300005336 Ga0070680_100091788 Ga0070680_1000917882 217
156 3300005339 Ga0070660_100013786 Ga0070660_1000137864 217
157 3300005366 Ga0070659_100375174 Ga0070659_1003751742 217
158 3300005455 Ga0070663_100213461 Ga0070663_1002134612 217
159 3300005539 Ga0068853_100136525 Ga0068853_1001365252 217
160 3300005563 Ga0068855_100163477 Ga0068855_1001634772 217
161 3300005564 Ga0070664_100514395 Ga0070664_1005143952 217
162 3300005614 Ga0068856_100369841 Ga0068856_1003698412 217
163 3300005614 Ga0068856_100705682 Ga0068856_1007056822 217
164 3300005616 Ga0068852_100000871 Ga0068852_1000008713 217
165 3300005616 Ga0068852_100104320 Ga0068852_1001043202 217
166 3300009093 Ga0105240_10018467 Ga0105240_100184679 217
167 3300009545 Ga0105237_10464460 Ga0105237_104644601 217
168 3300009551 Ga0105238_10915829 Ga0105238_109158291 217
169 3300010375 Ga0105239_10166279 Ga0105239_101662792 217
170 3300010375 Ga0105239_10301287 Ga0105239_103012872 217
171 3300010375 Ga0105239_10407267 Ga0105239_104072671 217
172 3300021358 Ga0213873_10022811 Ga0213873_100228112 217
173 3300021384 Ga0213876_10183255 Ga0213876_101832552 217
174 3300021384 Ga0213876_10322839 Ga0213876_103228392 217
175 3300021388 Ga0213875_10000575 Ga0213875_1000057514 217
176 3300025254 Ga0209148_1000215 Ga0209148_100021579 217
177 3300025254 Ga0209148_1005875 Ga0209148_10058752 217
178 3300025261 Ga0209233_1003761 Ga0209233_10037614 217
179 3300025272 Ga0209455_1001581 Ga0209455_10015812 217
180 3300025272 Ga0209455_1002577 Ga0209455_10025773 217
181 3300025297 Ga0209758_1000582 Ga0209758_10005825 217
182 3300025909 Ga0207705_10021380 Ga0207705_100213802 217
183 3300025913 Ga0207695_10107780 Ga0207695_101077802 217
184 3300025917 Ga0207660_10034640 Ga0207660_100346402 217
185 3300025932 Ga0207690_10254629 Ga0207690_102546291 217
186 3300026041 Ga0207639_10493426 Ga0207639_104934262 217
187 3300026067 Ga0207678_10241262 Ga0207678_102412622 217
188 3300026078 Ga0207702_10263111 Ga0207702_102631112 217
189 3300026078 Ga0207702_10659212 Ga0207702_106592122 217
190 3300026142 Ga0207698_10007734 Ga0207698_100077341 217
191 3300026142 Ga0207698_10040249 Ga0207698_100402492 217
192 3300026142 Ga0207698_10265867 Ga0207698_102658672 217
193 3300037853 Ga0436364_0026958 Ga0436364_0026958_1207_1866 217
194 3300039437 Ga0436365_0808021 Ga0436365_0808021_722_1381 217
195 3300039438 Ga0436360_1132986 Ga0436360_1132986_292_951 217
196 3300039447 Ga0436361_0946679 Ga0436361_0946679_402_1061 217
197 3300039450 Ga0436363_1168796 Ga0436363_1168796_1606_2265 217
198 3300039450 Ga0436363_1370640 Ga0436363_1370640_275_928 217
199 3300039453 Ga0436362_0779798 Ga0436362_0779798_169_828 217
200 3300041491 Ga0451833_1096331 Ga0451833_1096331_50_703 217
201 3300044656 Ga0466969_0026940 Ga0466969_0026940_1001_1654 217
202 3300044658 Ga0466972_0131852 Ga0466972_0131852_207_860 217
203 3300044658 Ga0466972_0254158 Ga0466972_0254158_98_751 217
204 3300044684 Ga0466966_0000169 Ga0466966_0000169_17799_18452 217
205 3300044693 Ga0466961_0000004 Ga0466961_0000004_54637_55290 217
206 3300044693 Ga0466961_0187117 Ga0466961_0187117_306_959 217
207 3300044694 Ga0466963_0381227 Ga0466963_0381227_94_747 217
208 3300044719 Ga0466971_0251948 Ga0466971_0251948_36_689 217
209 3300044735 Ga0466968_0004665 Ga0466968_0004665_1779_2432 217
210 3300044765 Ga0466970_0016693 Ga0466970_0016693_825_1478 217
211 3300044842 Ga0466957_0508639 Ga0466957_0508639_158_811 217
212 3300044901 Ga0466960_0047051 Ga0466960_0047051_1382_2035 217
213 3300044901 Ga0466960_0102004 Ga0466960_0102004_639_1292 217
214 3300045049 Ga0466959_0066353 Ga0466959_0066353_487_1140 217
215 3300045049 Ga0466959_0226035 Ga0466959_0226035_395_1048 217
216 3300048912 Ga0496109_0717826 Ga0496109_0717826_255_908 217
217 3300048918 Ga0496115_0082096 Ga0496115_0082096_1855_2508 217
218 3300049569 Ga0501032_0009125 Ga0501032_0009125_4323_5039 217
219 3300049579 Ga0501043_0000151 Ga0501043_0000151_14289_14969 217
220 3300049580 Ga0501046_0000026 Ga0501046_0000026_139965_140624 217
221 3300049581 Ga0501047_0002851 Ga0501047_0002851_8183_8842 217
222 3300049582 Ga0501048_0021512 Ga0501048_0021512_4034_4693 217
223 3300049744 Ga0501083_0000006 Ga0501083_0000006_196326_196985 217
224 3300049822 Ga0501035_0397301 Ga0501035_0397301_373_1053 217
225 3300049823 Ga0501044_0072930 Ga0501044_0072930_288_947 217
226 3300049824 Ga0501045_0602465 Ga0501045_0602465_111_770 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

172

262

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.5482 2 217
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.5441 2 217
6f0k-assembly1.cif.gz_A alternative complex iii 0.5336 4 217
6f0k-assembly1.cif.gz_A alternative complex iii 0.5316 4 217
3r1f-assembly7.cif.gz_M crystal structure of a key regulator of virulence in mycobacterium tuberculosis 0.2686 154 213
ID Description Score Start End Superfamily
af_A0A1D6PRE3_272_652_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.3132 147 214 3.30.70.270
af_E7FFE4_489_680_1.10.579.10 Mainly Alpha;Orthogonal Bundle;DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3;DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 0.159 123 212 1.10.579.10
af_A0A1D6PRE3_272_652_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.1252 147 214 3.30.70.270
af_E7FFE4_489_680_1.10.579.10 Mainly Alpha;Orthogonal Bundle;DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3;DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 0.09268 123 212 1.10.579.10
ID Description Score Start End GO Terms
AF-A0A3M0YSD5-F1-model_v4 deleted 0.9556 158 217
AF-A0A1I2GTL6-F1-model_v4 deleted 0.916 135 217
AF-A0A3M0YSD5-F1-model_v4 deleted 0.9119 158 217
AF-A0A2V9XUF7-F1-model_v4 Cytochrome C 0.8878 136 217
AF-A0A2V9T9S4-F1-model_v4 Cytochrome C 0.8793 119 217

Feature Viewer

pLDDT pTM Quality
67.37 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map