F339142

General Info

Members Datasets Scaffolds Average Seq Length
226 156 453 192

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0054936|Ga0451576_0054936_2855_3487
Length 210
Sequence MDADLRCNSIINSNLKYKMKKVLIINGHPNKESLCFSLGEAYKKGALKKGAEVNEIIISDLDFNPNLQSGYHKRTELEPDLLDAWEKIKWSDHMVWVHPVWWGGLPAITKGFLDRLFLPGMAFQYRENSVWWDRLLSGKTAHIITTLDQPSWYYTLTVGRPSVNQLKKSTLEFCGVKPVKVSYVGPVKKSKEADRIQWLDRIEKTGEELK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
19 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
20 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
46 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
88 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
89 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
90 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
91 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
92 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
93 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
94 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
95 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
96 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
97 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
98 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
99 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
100 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
101 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
102 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
103 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
104 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
105 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
106 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
107 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
108 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
109 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
110 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
111 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
112 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
113 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
114 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
115 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
116 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
117 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
118 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
119 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
120 2738543023 Pedobacter sp. OK628 Isolate Unclassified
121 2739367651 Pedobacter sp. OK291 Isolate Unclassified
122 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
123 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
124 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
125 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
126 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
127 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
128 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
129 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
130 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
131 2818991437 Pedobacter terrae 518 Isolate Unclassified
132 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
133 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
134 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
135 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
136 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
137 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
138 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
139 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
140 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
141 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
142 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
143 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
144 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
145 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
146 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
147 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
148 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
149 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
150 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
151 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
152 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
153 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
154 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
155 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
156 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.89
Metatranscriptomes 0
Isolates 26.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 3.1
Rhizoplane 2.21
Rhizosphere 60.62
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0054936 3300045051 Bacteria 4168
2 SwRhRL2b_contig_2536696 2162886007 Bacteria 3336
3 SwRhRL2b_contig_2579378 2162886007 Bacteria 1808
4 SwRhRL2b_contig_784796 2162886007 Bacteria 5131
5 JGI24741J21665_1004005 3300001915 Bacteria 3363
6 rootH2_10207051 3300003320 Bacteria 1499
7 rootL2_10188193 3300003322 Bacteria 1270
8 rootH1_10005956 3300003316 Bacteria 4864
9 rootH1_10005956 3300003323 Bacteria 5316
10 Ga0055534_1008015 3300003784 Bacteria 2443
11 Ga0065714_10002393 3300005288 Bacteria 20129
12 Ga0065714_10003129 3300005288 Bacteria 14731
13 Ga0065714_10064490 3300005288 Bacteria 50332
14 Ga0065714_10075888 3300005288 Bacteria 2852
15 Ga0065714_10078737 3300005288 Bacteria 2540
16 Ga0065714_10084117 3300005288 Bacteria 2189
17 Ga0065714_10115565 3300005288 Bacteria 1410
18 Ga0065704_10073333 3300005289 Bacteria 7292
19 Ga0065704_10074966 3300005289 Bacteria 5879
20 Ga0065704_10079936 3300005289 Bacteria 4047
21 Ga0065704_10085107 3300005289 Bacteria 3261
22 Ga0065715_10274118 3300005293 Bacteria 1068
23 Ga0070682_100000251 3300005337 Bacteria 38982
24 Ga0070660_100185735 3300005339 Bacteria 1683
25 Ga0070668_100102788 3300005347 Bacteria 2266
26 Ga0070663_100614998 3300005455 Bacteria 915
27 Ga0068857_101079789 3300005577 Unclassified 774
28 Ga0068856_100005865 3300005614 Bacteria 12112
29 Ga0068864_100532044 3300005618 Bacteria 1134
30 Ga0099824_1000378 3300006942 Bacteria 50161
31 Ga0079104_1000108 3300006946 Bacteria 122180
32 Ga0099826_10003601 3300006948 Bacteria 10583
33 Ga0105244_10000099 3300009036 Bacteria 90288
34 Ga0105244_10000102 3300009036 Bacteria 88074
35 Ga0105250_10035991 3300009092 Bacteria 1987
36 Ga0105243_10000006 3300009148 Bacteria 465541
37 Ga0105243_10000432 3300009148 Bacteria 43867
38 Ga0105249_10234963 3300009553 Bacteria 1809
39 Ga0157373_10000001 3300013100 Bacteria 864756
40 Ga0157373_10000163 3300013100 Bacteria 54136
41 Ga0157373_10010092 3300013100 Bacteria 6958
42 Ga0157373_10246783 3300013100 Bacteria 1262
43 Ga0157371_10000027 3300013102 Bacteria 269243
44 Ga0157371_10000096 3300013102 Bacteria 135954
45 Ga0157371_10007120 3300013102 Bacteria 9087
46 Ga0157371_10058949 3300013102 Bacteria 2723
47 Ga0157370_10000568 3300013104 Bacteria 46015
48 Ga0157370_10002418 3300013104 Bacteria 22506
49 Ga0157370_10014359 3300013104 Bacteria 8100
50 Ga0157370_10089700 3300013104 Bacteria 2888
51 Ga0157370_10246184 3300013104 Bacteria 1654
52 Ga0157370_10246185 3300013104 Bacteria 1654
53 Ga0157370_10418795 3300013104 Bacteria 1232
54 Ga0157369_10000053 3300013105 Bacteria 162962
55 Ga0157369_10006057 3300013105 Bacteria 14036
56 Ga0157375_10051651 3300013308 Bacteria 4038
57 Ga0182008_10000008 3300014497 Bacteria 371823
58 Ga0182008_10000033 3300014497 Bacteria 153579
59 Ga0182006_1000016 3300015261 Bacteria 303558
60 Ga0182006_1001116 3300015261 Bacteria 17087
61 Ga0182006_1001631 3300015261 Bacteria 13252
62 Ga0182006_1001768 3300015261 Bacteria 12532
63 Ga0182007_10000005 3300015262 Bacteria 442702
64 Ga0163161_10000023 3300017792 Bacteria 205048
65 Ga0163161_10000809 3300017792 Bacteria 24489
66 Ga0163161_10029899 3300017792 Bacteria 3873
67 Ga0209675_1000103 3300025291 Bacteria 121526
68 Ga0207655_1000013 3300025728 Bacteria 637510
69 Ga0207655_1000239 3300025728 Bacteria 90288
70 Ga0207671_10011443 3300025914 Bacteria 7224
71 Ga0207657_10366820 3300025919 Bacteria 1135
72 Ga0207709_10000007 3300025935 Bacteria 752025
73 Ga0207709_10000445 3300025935 Bacteria 38848
74 Ga0207712_10270825 3300025961 Bacteria 1381
75 Ga0207668_10032441 3300025972 Bacteria 3451
76 Ga0207678_10824068 3300026067 Bacteria 820
77 Ga0207702_10014374 3300026078 Bacteria 6571
78 Ga0207674_10185465 3300026116 Bacteria 2031
79 Ga0209281_1000208 3300027111 Bacteria 132254
80 Ga0209489_114688 3300027361 Bacteria 5314
81 Ga0209282_1004783 3300027666 Bacteria 8216
82 Ga0265318_10000079 3300028577 Bacteria 86861
83 Ga0265338_10001166 3300028800 Bacteria 43408
84 Ga0265324_10006600 3300029957 Bacteria 4808
85 Ga0265332_10239310 3300031238 Unclassified 751
86 Ga0265320_10001524 3300031240 Bacteria 16803
87 Ga0265325_10035312 3300031241 Bacteria 2656
88 Ga0265339_10033860 3300031249 Bacteria 2874
89 Ga0265331_10004559 3300031250 Bacteria 8632
90 Ga0265313_10051819 3300031595 Bacteria 1961
91 Ga0265314_10002261 3300031711 Bacteria 19940
92 Ga0307413_10006436 3300031824 Bacteria 5363
93 Ga0307410_10000929 3300031852 Bacteria 12535
94 Ga0307406_10000428 3300031901 Bacteria 24522
95 Ga0307407_10047303 3300031903 Bacteria 2440
96 Ga0307412_10001053 3300031911 Bacteria 15752
97 Ga0307416_100000051 3300032002 Bacteria 115585
98 Ga0307416_100042080 3300032002 Bacteria 3563
99 Ga0307414_10000008 3300032004 Bacteria 375832
100 Ga0307414_10123896 3300032004 Bacteria 1992
101 Ga0307414_10159242 3300032004 Unclassified 1791
102 Ga0307411_10000018 3300032005 Bacteria 87365
103 Ga0307411_10002362 3300032005 Bacteria 8299
104 Ga0439447_002087 3300041407 Bacteria 7347
105 Ga0453684_0006234 3300044712 Bacteria 22857
106 Ga0451576_0011288 3300045051 Bacteria 10167
107 Ga0451576_1221890 3300045051 Bacteria 784
108 Ga0495596_0000182 3300046500 Bacteria 43822
109 Ga0495606_0032861 3300046507 Bacteria 3588
110 Ga0495610_0000009 3300046512 Bacteria 554843
111 Ga0495610_0000108 3300046512 Bacteria 96839
112 Ga0495643_0002808 3300046522 Bacteria 13304
113 Ga0495663_0000079 3300046525 Bacteria 44135
114 Ga0495663_0011970 3300046525 Bacteria 2417
115 Ga0496102_0027573 3300048905 Bacteria 5072
116 Ga0496105_0252911 3300048908 Bacteria 1427
117 Ga0496110_0644448 3300048913 Bacteria 959
118 Ga0496115_0002906 3300048918 Bacteria 12364
119 Ga0496115_0038332 3300048918 Bacteria 3803
120 Ga0496116_0000004 3300048919 Bacteria 839841
121 Ga0496116_0000006 3300048919 Bacteria 811937
122 Ga0496116_0013757 3300048919 Bacteria 6504
123 Ga0496117_0000491 3300048920 Bacteria 65366
124 Ga0496117_0020613 3300048920 Bacteria 5368
125 Ga0496117_0024401 3300048920 Bacteria 4785
126 Ga0496118_0000543 3300048921 Bacteria 62008
127 Ga0496118_0035402 3300048921 Bacteria 4054
128 Ga0496118_0041361 3300048921 Bacteria 3650
129 Ga0496119_0000379 3300048922 Bacteria 61360
130 Ga0496120_0093801 3300048923 Bacteria 1599
131 Ga0496121_0110741 3300048924 Bacteria 2095
132 Ga0496122_0000486 3300048925 Bacteria 82431
133 Ga0496122_0000555 3300048925 Bacteria 76648
134 Ga0496122_0000775 3300048925 Bacteria 61542
135 Ga0496122_0000798 3300048925 Bacteria 60429
136 Ga0496122_0001546 3300048925 Bacteria 36521
137 Ga0496122_0001776 3300048925 Bacteria 33036
138 Ga0496122_0016136 3300048925 Bacteria 7095
139 Ga0496123_0002095 3300048926 Bacteria 25654
140 Ga0496123_0006298 3300048926 Bacteria 11542
141 Ga0496123_0008643 3300048926 Bacteria 9312
142 Ga0496123_0014485 3300048926 Bacteria 6532
143 Ga0496123_0106351 3300048926 Bacteria 1617
144 Ga0496123_0142399 3300048926 Bacteria 1308
145 Ga0496124_0002734 3300048927 Bacteria 22485
146 Ga0496124_0028203 3300048927 Bacteria 5025
147 Ga0496125_0000031 3300048928 Bacteria 365156
148 Ga0496125_0000082 3300048928 Bacteria 227300
149 Ga0496125_0000736 3300048928 Bacteria 54151
150 Ga0496125_0085430 3300048928 Bacteria 2391
151 Ga0496125_0159242 3300048928 Bacteria 1536
152 Ga0496125_0254602 3300048928 Bacteria 1105
153 Ga0496126_0008140 3300048929 Bacteria 11350
154 Ga0496126_0057505 3300048929 Bacteria 3510
155 Ga0496126_0143054 3300048929 Unclassified 2057
156 Ga0496126_0196488 3300048929 Bacteria 1706
157 Ga0496126_0260074 3300048929 Bacteria 1444
158 Ga0501198_007485 3300049649 Unclassified 1571
159 Ga0501266_000017 3300049763 Bacteria 155699
160 Ga0501280_002533 3300049776 Bacteria 3016
161 nmdc:mga0k408_415698_c1 3300050493 Bacteria 800
162 Ga0500646_0002739 3300053090 Bacteria 4546
163 Ga0500641_0000009 3300053096 Bacteria 173260
164 Ga0500658_0000061 3300053134 Bacteria 53519
165 Ga0500559_0056160 3300053136 Bacteria 1747
166 Ga0500573_0175935 3300053140 Bacteria 1154
167 Ga0500622_0000986 3300053156 Bacteria 24174
168 Ga0500584_057075 3300053726 Bacteria 1748
169 2520881730 2519899754 Bacteria 5336938
170 2585145445 2582581278 Bacteria 5296881
171 2587678039 2585428045 Bacteria 5203023
172 2587748239 2585428060 Bacteria 5304711
173 2588209900 2585428182 Bacteria 5007281
174 2588214924 2585428183 Bacteria 5166119
175 2588218144 2585428184 Bacteria 4978681
176 2588222649 2585428185 Bacteria 4969476
177 2588444592 2588253712 Bacteria 5403181
178 2590600182 2588254255 Bacteria 5014294
179 2590613034 2588254257 Bacteria 5436094
180 2644008945 2643221600 Bacteria 5530138
181 2644373617 2643221667 Bacteria 5627472
182 2644640209 2643221716 Bacteria 4986332
183 2644683320 2643221725 Bacteria 5087956
184 2722726833 2721755487 Bacteria 6357185
185 2729199590 2728369107 Bacteria 5082720
186 2738698977 2738541273 Bacteria 4048577
187 2738734226 2738541279 Bacteria 6149495
188 2738766984 2738541285 Bacteria 6150075
189 2739215807 2738543007 Bacteria 6149845
190 2739254693 2738543014 Bacteria 4048139
191 2739300669 2738543023 Bacteria 6767879
192 2739587145 2739367651 Bacteria 6359826
193 2740002121 2739367857 Bacteria 5433684
194 2740006937 2739367858 Bacteria 5432813
195 2740058642 2739367874 Bacteria 4872888
196 2753670786 2751185877 Bacteria 4921427
197 2765573669 2765235839 Bacteria 5314748
198 2772604379 2772190705 Bacteria 4666226
199 2802652795 2802428842 Bacteria 4926114
200 2816874018 2816332188 Bacteria 5133218
201 2817417012 2816332280 Bacteria 5109718
202 2819547603 2818991437 Bacteria 5805520
203 2842087496 2842083920 Bacteria 4857652
204 2857618052 2857613821 Bacteria 4917088
205 2857623041 2857618242 Bacteria 5635925
206 2871720619 2871720351 Bacteria 4862476
207 2881362111 2881359912 Bacteria 4935907
208 2881956882 2881955468 Bacteria 3545609
209 2889295735 2889290771 Bacteria 5530962
210 2903896517 2903895155 Bacteria 5258610
211 2904423882 2904419702 Bacteria 5166287
212 2904560472 2904555929 Bacteria 5218588
213 2904782116 2904780799 Bacteria 5840761
214 2906000411 2905999023 Bacteria 4591259
215 2919179518 2919177583 Bacteria 5641607
216 2919189237 2919186247 Bacteria 6244071
217 2919191615 2919191525 Bacteria 5765973
218 2919399833 2919399522 Bacteria 5164947
219 2919688120 2919683626 Bacteria 5534354
220 2929154287 2929150217 Bacteria 5462483
221 2939666608 2939664404 Bacteria 6364494
222 2946022264 2946019816 Bacteria 4621265
223 2958461619 2958458903 Bacteria 5301041
224 2977271106 2977268062 Bacteria 5243061
225 8055422607 8055419101 Bacteria 5289643
226 8055595548 8055592153 Bacteria 5961247
227 8056443672 8056440228 Bacteria 4946504
228 Ga0451576_0054936
229 SwRhRL2b_contig_2536696
230 SwRhRL2b_contig_2579378
231 SwRhRL2b_contig_784796
232 JGI24741J21665_1004005
233 rootH2_10207051
234 rootL2_10188193
235 rootH1_10005956
236 Ga0055534_1008015
237 Ga0065714_10002393
238 Ga0065714_10003129
239 Ga0065714_10064490
240 Ga0065714_10075888
241 Ga0065714_10078737
242 Ga0065714_10084117
243 Ga0065714_10115565
244 Ga0065704_10073333
245 Ga0065704_10074966
246 Ga0065704_10079936
247 Ga0065704_10085107
248 Ga0065715_10274118
249 Ga0070682_100000251
250 Ga0070660_100185735
251 Ga0070668_100102788
252 Ga0070663_100614998
253 Ga0068857_101079789
254 Ga0068856_100005865
255 Ga0068864_100532044
256 Ga0099824_1000378
257 Ga0079104_1000108
258 Ga0099826_10003601
259 Ga0105244_10000099
260 Ga0105244_10000102
261 Ga0105250_10035991
262 Ga0105243_10000006
263 Ga0105243_10000432
264 Ga0105249_10234963
265 Ga0157373_10000001
266 Ga0157373_10000163
267 Ga0157373_10010092
268 Ga0157373_10246783
269 Ga0157371_10000027
270 Ga0157371_10000096
271 Ga0157371_10007120
272 Ga0157371_10058949
273 Ga0157370_10000568
274 Ga0157370_10002418
275 Ga0157370_10014359
276 Ga0157370_10089700
277 Ga0157370_10246184
278 Ga0157370_10246185
279 Ga0157370_10418795
280 Ga0157369_10000053
281 Ga0157369_10006057
282 Ga0157375_10051651
283 Ga0182008_10000008
284 Ga0182008_10000033
285 Ga0182006_1000016
286 Ga0182006_1001116
287 Ga0182006_1001631
288 Ga0182006_1001768
289 Ga0182007_10000005
290 Ga0163161_10000023
291 Ga0163161_10000809
292 Ga0163161_10029899
293 Ga0209675_1000103
294 Ga0207655_1000013
295 Ga0207655_1000239
296 Ga0207671_10011443
297 Ga0207657_10366820
298 Ga0207709_10000007
299 Ga0207709_10000445
300 Ga0207712_10270825
301 Ga0207668_10032441
302 Ga0207678_10824068
303 Ga0207702_10014374
304 Ga0207674_10185465
305 Ga0209281_1000208
306 Ga0209489_114688
307 Ga0209282_1004783
308 Ga0265318_10000079
309 Ga0265338_10001166
310 Ga0265324_10006600
311 Ga0265332_10239310
312 Ga0265320_10001524
313 Ga0265325_10035312
314 Ga0265339_10033860
315 Ga0265331_10004559
316 Ga0265313_10051819
317 Ga0265314_10002261
318 Ga0307413_10006436
319 Ga0307410_10000929
320 Ga0307406_10000428
321 Ga0307407_10047303
322 Ga0307412_10001053
323 Ga0307416_100000051
324 Ga0307416_100042080
325 Ga0307414_10000008
326 Ga0307414_10123896
327 Ga0307414_10159242
328 Ga0307411_10000018
329 Ga0307411_10002362
330 Ga0439447_002087
331 Ga0453684_0006234
332 Ga0451576_0011288
333 Ga0451576_1221890
334 Ga0495596_0000182
335 Ga0495606_0032861
336 Ga0495610_0000009
337 Ga0495610_0000108
338 Ga0495643_0002808
339 Ga0495663_0000079
340 Ga0495663_0011970
341 Ga0496102_0027573
342 Ga0496105_0252911
343 Ga0496110_0644448
344 Ga0496115_0002906
345 Ga0496115_0038332
346 Ga0496116_0000004
347 Ga0496116_0000006
348 Ga0496116_0013757
349 Ga0496117_0000491
350 Ga0496117_0020613
351 Ga0496117_0024401
352 Ga0496118_0000543
353 Ga0496118_0035402
354 Ga0496118_0041361
355 Ga0496119_0000379
356 Ga0496120_0093801
357 Ga0496121_0110741
358 Ga0496122_0000486
359 Ga0496122_0000555
360 Ga0496122_0000775
361 Ga0496122_0000798
362 Ga0496122_0001546
363 Ga0496122_0001776
364 Ga0496122_0016136
365 Ga0496123_0002095
366 Ga0496123_0006298
367 Ga0496123_0008643
368 Ga0496123_0014485
369 Ga0496123_0106351
370 Ga0496123_0142399
371 Ga0496124_0002734
372 Ga0496124_0028203
373 Ga0496125_0000031
374 Ga0496125_0000082
375 Ga0496125_0000736
376 Ga0496125_0085430
377 Ga0496125_0159242
378 Ga0496125_0254602
379 Ga0496126_0008140
380 Ga0496126_0057505
381 Ga0496126_0143054
382 Ga0496126_0196488
383 Ga0496126_0260074
384 Ga0501198_007485
385 Ga0501266_000017
386 Ga0501280_002533
387 nmdc:mga0k408_415698_c1
388 Ga0500646_0002739
389 Ga0500641_0000009
390 Ga0500658_0000061
391 Ga0500559_0056160
392 Ga0500573_0175935
393 Ga0500622_0000986
394 Ga0500584_057075
395 2520881730
396 2585145445
397 2587678039
398 2587748239
399 2588209900
400 2588214924
401 2588218144
402 2588222649
403 2588444592
404 2590600182
405 2590613034
406 2644008945
407 2644373617
408 2644640209
409 2644683320
410 2722726833
411 2729199590
412 2738698977
413 2738734226
414 2738766984
415 2739215807
416 2739254693
417 2739300669
418 2739587145
419 2740002121
420 2740006937
421 2740058642
422 2753670786
423 2765573669
424 2772604379
425 2802652795
426 2816874018
427 2817417012
428 2819547603
429 2842087496
430 2857618052
431 2857623041
432 2871720619
433 2881362111
434 2881956882
435 2889295735
436 2903896517
437 2904423882
438 2904560472
439 2904782116
440 2906000411
441 2919179518
442 2919189237
443 2919191615
444 2919399833
445 2919688120
446 2929154287
447 2939666608
448 2946022264
449 2958461619
450 2977271106
451 8055422607
452 8055595548
453 8056443672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

20

149

0.88

PF02525

Flavodoxin_2

Flavodoxin-like fold

20

205

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gi5-assembly1.cif.gz_A crystal structure of a putative quinone reductase from klebsiella pneumoniae (target psi-013613) 0.8613 1 187
5e6m-assembly1.cif.gz_B crystal structure of human wild type glyrs bound with trnagly 0.8521 4 37
4f8y-assembly2.cif.gz_D complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans 0.8434 3 190
4r81-assembly3.cif.gz_C-2 nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis 0.8409 2 192
3nhu-assembly1.cif.gz_B x-ray crystallographic structure activity relationship (sar) of casimiroin and its analogs bound to human quinone reductase 2 0.8403 2 191
ID Description Score Start End Superfamily
af_P9WFT9_473_580_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8706 4 37 3.40.50.800
af_Q54PF9_562_677_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8501 1 37 3.40.50.800
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8457 2 39 3.40.50.10860
4r81C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8409 2 192 3.40.50.360
3lcmC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8378 3 188 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2S1LR36-F1-model_v4 NADPH:quinone reductase 0.9729 1 189 GO:0003955
GO:0005829
AF-A0A286JAM3-F1-model_v4 deleted 0.9704 2 190
AF-A0A1M3L3X3-F1-model_v4 NADPH:quinone reductase 0.9703 1 189 GO:0003955
GO:0005829
AF-F6AQY6-F1-model_v4 deleted 0.97 2 191
AF-A0A807RGG2-F1-model_v4 deleted 0.9698 2 189

Map