F339282

General Info

Members Datasets Scaffolds Average Seq Length
226 123 226 328

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0030631|Ga0501036_0030631_1446_2477
Length 343
Sequence MLPIAVDAMGGDRAPGAIVAGARLAAAEGIPVVLVGPADLHDVGDLALIAASETIAMDDDPASSVRRKKDSTLVRAAEAVRDGRASAMISAGNTGATMASALLRMGRIKGVSRPAVATPIPVPGSTPTVLLDAGANAEVQAEWLVQFAQMGSVYARHRFGIERPQVGLLSIGEEPGKGDSLRKEAYELLAGAPGIHFIGNIEGRDIMTDHVDVAVTDGFTGNVVLKTLEGGVKTVVKALLEVFAAPELKEHADALMPALLPLYTSLDPDTYGGAVLLGVDGVCIISHGSTGDRAMLNAIKVAKEMVDHELVAHIREVVAAGAHGSSGPVADEAGQVAGAAGAD

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
4 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
7 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
34 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
39 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
45 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
46 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
47 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
48 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
57 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
60 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
61 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
67 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0
Rhizoplane 1.33
Rhizosphere 88.94
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10002320 3300003373 Bacteria 4465
2 Ga0070714_100089825 3300005435 Bacteria 2690
3 Ga0070681_10109179 3300005458 Bacteria 2707
4 Ga0070706_100037273 3300005467 Bacteria 4491
5 Ga0070684_100388975 3300005535 Bacteria 1285
6 Ga0070695_100037829 3300005545 Bacteria 3043
7 Ga0068863_100274874 3300005841 Bacteria 1631
8 Ga0068860_100186847 3300005843 Bacteria 2004
9 Ga0081455_10005524 3300005937 Bacteria 13848
10 Ga0081455_10076331 3300005937 Bacteria 2761
11 Ga0081538_10000201 3300005981 Bacteria 66216
12 Ga0081538_10030668 3300005981 Bacteria 3645
13 Ga0075368_10018648 3300006042 Bacteria 2609
14 Ga0075363_100105304 3300006048 Bacteria 1564
15 Ga0075364_10006163 3300006051 Bacteria 7024
16 Ga0075364_10128353 3300006051 Bacteria 1701
17 Ga0075364_10188411 3300006051 Bacteria 1397
18 Ga0075367_10012899 3300006178 Bacteria 4476
19 Ga0075428_100003006 3300006844 Bacteria 18412
20 Ga0075428_100007166 3300006844 Bacteria 12351
21 Ga0075428_100038744 3300006844 Bacteria 5245
22 Ga0075428_100044165 3300006844 Bacteria 4898
23 Ga0075430_100003186 3300006846 Bacteria 13749
24 Ga0075430_100009229 3300006846 Bacteria 8336
25 Ga0075430_100199157 3300006846 Bacteria 1663
26 Ga0075430_100225953 3300006846 Bacteria 1553
27 Ga0075431_100004844 3300006847 Bacteria 13255
28 Ga0075431_100114558 3300006847 Bacteria 2783
29 Ga0075429_100000197 3300006880 Bacteria 40093
30 Ga0075429_100000481 3300006880 Bacteria 29838
31 Ga0075429_100066347 3300006880 Bacteria 3142
32 Ga0111539_10004162 3300009094 Bacteria 18966
33 Ga0111539_10035888 3300009094 Bacteria 6002
34 Ga0111539_10076558 3300009094 Bacteria 3939
35 Ga0105245_10076078 3300009098 Bacteria 3057
36 Ga0114129_10000719 3300009147 Bacteria 41930
37 Ga0114129_10032212 3300009147 Bacteria 7409
38 Ga0114129_10090416 3300009147 Bacteria 4244
39 Ga0105243_10239609 3300009148 Bacteria 1613
40 Ga0105242_10018617 3300009176 Bacteria 5432
41 Ga0157375_10078837 3300013308 Bacteria 3328
42 Ga0213876_10007864 3300021384 Bacteria 5784
43 Ga0213875_10004727 3300021388 Bacteria 7413
44 Ga0207684_10089883 3300025910 Bacteria 2616
45 Ga0207707_10060978 3300025912 Bacteria 3282
46 Ga0207707_10085063 3300025912 Bacteria 2763
47 Ga0207686_10141334 3300025934 Bacteria 1664
48 Ga0207691_10336712 3300025940 Bacteria 1292
49 Ga0207641_10320758 3300026088 Bacteria 1469
50 Ga0207675_100106267 3300026118 Bacteria 2646
51 Ga0209813_10019409 3300027866 Bacteria 1889
52 Ga0207428_10055917 3300027907 Bacteria 3136
53 Ga0268264_10167802 3300028381 Bacteria 1983
54 Ga0268264_10179177 3300028381 Bacteria 1923
55 Ga0316575_10002612 3300031665 Bacteria 6070
56 Ga0316576_10006212 3300031727 Bacteria 7412
57 Ga0316576_10173068 3300031727 Bacteria 1629
58 Ga0316576_10224597 3300031727 Bacteria 1412
59 Ga0316578_10126584 3300031728 Bacteria 1536
60 Ga0316577_10003082 3300031733 Bacteria 8368
61 Ga0307410_10020326 3300031852 Bacteria 4059
62 Ga0307407_10002662 3300031903 Bacteria 7071
63 Ga0307409_100055226 3300031995 Bacteria 3065
64 Ga0307416_100190694 3300032002 Bacteria 1933
65 Ga0373954_0074802 3300035118 Bacteria 1613
66 Ga0373955_0142984 3300035172 Bacteria 1404
67 Ga0316574_0015252 3300035398 Bacteria 4458
68 Ga0316574_0041582 3300035398 Bacteria 2834
69 Ga0373933_0076170 3300035724 Bacteria 2049
70 Ga0316584_0069606 3300036712 Bacteria 2638
71 Ga0436364_0836449 3300037853 Bacteria 2970
72 Ga0436364_1302382 3300037853 Bacteria 7713
73 Ga0436365_0882149 3300039437 Bacteria 5824
74 Ga0436365_1409400 3300039437 Bacteria 1077
75 Ga0439436_0060375 3300041404 Bacteria 1062
76 Ga0439439_0010869 3300041406 Bacteria 2183
77 Ga0439466_0057101 3300041411 Bacteria 1265
78 Ga0451853_1790200 3300041512 Bacteria 2045
79 Ga0439448_0000828 3300042005 Bacteria 7536
80 Ga0439450_000541 3300042008 Bacteria 4955
81 Ga0439454_000843 3300042011 Bacteria 2686
82 Ga0439455_0004514 3300042012 Bacteria 2763
83 Ga0439463_001547 3300042016 Bacteria 6062
84 Ga0439464_0011621 3300042439 Bacteria 2334
85 Ga0439460_0000584 3300042461 Bacteria 8010
86 Ga0466966_0046629 3300044684 Bacteria 2766
87 Ga0466961_0209717 3300044693 Bacteria 1203
88 Ga0453684_0015102 3300044712 Bacteria 12252
89 Ga0466959_0119348 3300045049 Bacteria 1876
90 Ga0466959_0149411 3300045049 Bacteria 1647
91 Ga0466959_0160719 3300045049 Bacteria 1580
92 Ga0495629_0101009 3300046459 Bacteria 2013
93 Ga0495641_0023681 3300046461 Bacteria 3045
94 Ga0495651_0015715 3300046462 Bacteria 5861
95 Ga0495653_0012313 3300046463 Bacteria 6979
96 Ga0495608_0037752 3300046511 Bacteria 3247
97 Ga0495608_0111439 3300046511 Bacteria 1759
98 Ga0495652_0111104 3300046529 Bacteria 2204
99 Ga0495587_0029109 3300046536 Bacteria 3355
100 Ga0495667_0011725 3300046559 Bacteria 5935
101 Ga0495667_0077323 3300046559 Bacteria 2165
102 Ga0495658_0136868 3300046683 Bacteria 1495
103 Ga0495600_0055018 3300046809 Bacteria 2599
104 Ga0495604_0085904 3300047317 Bacteria 2347
105 Ga0495680_0005274 3300047322 Bacteria 12203
106 Ga0495680_0167592 3300047322 Bacteria 1592
107 Ga0495675_0040371 3300047444 Bacteria 2974
108 Ga0495602_0069411 3300048088 Bacteria 3021
109 Ga0496114_0060062 3300048917 Bacteria 3177
110 Ga0496114_0072795 3300048917 Bacteria 2891
111 Ga0496114_0193511 3300048917 Bacteria 1780
112 Ga0501031_0140393 3300049568 Bacteria 1579
113 Ga0501034_0000602 3300049571 Bacteria 56640
114 Ga0501034_0000924 3300049571 Bacteria 42892
115 Ga0501034_0011444 3300049571 Bacteria 9191
116 Ga0501034_0030217 3300049571 Bacteria 5507
117 Ga0501034_0133540 3300049571 Bacteria 2464
118 Ga0501036_0030631 3300049572 Bacteria 4544
119 Ga0501036_0074658 3300049572 Bacteria 2868
120 Ga0501036_0219872 3300049572 Bacteria 1595
121 Ga0501037_0089389 3300049573 Bacteria 2229
122 Ga0501037_0194359 3300049573 Bacteria 1436
123 Ga0501038_0084988 3300049574 Bacteria 2662
124 Ga0501038_0102622 3300049574 Bacteria 2380
125 Ga0501039_0025151 3300049575 Bacteria 4574
126 Ga0501039_0169807 3300049575 Bacteria 1715
127 Ga0501040_0018980 3300049576 Bacteria 4571
128 Ga0501040_0314352 3300049576 Bacteria 1120
129 Ga0501041_0048200 3300049577 Bacteria 2595
130 Ga0501042_0042043 3300049578 Bacteria 3252
131 Ga0501046_0060293 3300049580 Bacteria 2969
132 Ga0501046_0170315 3300049580 Bacteria 1635
133 Ga0501048_0151746 3300049582 Bacteria 1639
134 Ga0501048_0163471 3300049582 Unclassified 1576
135 Ga0501048_0211915 3300049582 Bacteria 1374
136 Ga0501048_0222976 3300049582 Bacteria 1337
137 Ga0501067_0071098 3300049583 Bacteria 1927
138 Ga0501068_0006379 3300049584 Bacteria 6499
139 Ga0501068_0011997 3300049584 Bacteria 4901
140 Ga0501068_0203644 3300049584 Bacteria 1255
141 Ga0501069_0000005 3300049585 Bacteria 189293
142 Ga0501069_0001747 3300049585 Bacteria 10840
143 Ga0501070_0000001 3300049586 Bacteria 519187
144 Ga0501070_0266708 3300049586 Bacteria 1399
145 Ga0501071_0037223 3300049587 Bacteria 3473
146 Ga0501071_0037809 3300049587 Bacteria 3448
147 Ga0501071_0080801 3300049587 Bacteria 2378
148 Ga0501071_0104829 3300049587 Bacteria 2087
149 Ga0501071_0166354 3300049587 Bacteria 1650
150 Ga0501072_0013689 3300049588 Bacteria 6211
151 Ga0501072_0030245 3300049588 Bacteria 4234
152 Ga0501072_0035687 3300049588 Bacteria 3896
153 Ga0501072_0065350 3300049588 Bacteria 2868
154 Ga0501072_0159375 3300049588 Bacteria 1800
155 Ga0501072_0330362 3300049588 Bacteria 1211
156 Ga0501072_0349833 3300049588 Bacteria 1173
157 Ga0501073_0009905 3300049589 Bacteria 7012
158 Ga0501073_0012308 3300049589 Bacteria 6242
159 Ga0501074_0001198 3300049590 Bacteria 17069
160 Ga0501074_0100172 3300049590 Bacteria 2074
161 Ga0501074_0185044 3300049590 Bacteria 1485
162 Ga0501074_0282601 3300049590 Bacteria 1180
163 Ga0501075_0024860 3300049591 Bacteria 4397
164 Ga0501075_0056000 3300049591 Bacteria 2968
165 Ga0501075_0122416 3300049591 Bacteria 1980
166 Ga0501076_0098699 3300049592 Bacteria 2353
167 Ga0501076_0168097 3300049592 Bacteria 1787
168 Ga0501076_0215969 3300049592 Bacteria 1568
169 Ga0501077_0071333 3300049593 Bacteria 2202
170 Ga0501079_0024847 3300049741 Bacteria 4596
171 Ga0501079_0047290 3300049741 Bacteria 3319
172 Ga0501079_0138293 3300049741 Bacteria 1897
173 Ga0501079_0153489 3300049741 Bacteria 1795
174 Ga0501079_0311398 3300049741 Bacteria 1232
175 Ga0501080_0010393 3300049742 Bacteria 8516
176 Ga0501080_0013270 3300049742 Bacteria 7569
177 Ga0501080_0041788 3300049742 Bacteria 4270
178 Ga0501080_0106889 3300049742 Bacteria 2593
179 Ga0501080_0205370 3300049742 Bacteria 1807
180 Ga0501081_0008613 3300049743 Bacteria 6630
181 Ga0501081_0025431 3300049743 Bacteria 3982
182 Ga0501081_0084983 3300049743 Bacteria 2220
183 Ga0501081_0388959 3300049743 Bacteria 1031
184 Ga0501083_0039744 3300049744 Bacteria 3195
185 Ga0501083_0139705 3300049744 Bacteria 1586
186 Ga0501035_0204154 3300049822 Bacteria 1694
187 Ga0501045_0225542 3300049824 Bacteria 1395
188 Ga0501045_0235947 3300049824 Bacteria 1362
189 Ga0501045_0271912 3300049824 Bacteria 1261
190 nmdc:mga03n38_78538_c1 3300050490 Bacteria 1545
191 nmdc:mga00v17_16771_c1 3300050491 Bacteria 4132
192 nmdc:mga00v17_46177_c1 3300050491 Bacteria 2634
193 nmdc:mga00v17_64841_c1 3300050491 Bacteria 2252
194 nmdc:mga06z11_46003_c1 3300050494 Bacteria 2209
195 nmdc:mga05p37_13320_c1 3300050507 Bacteria 9850
196 nmdc:mga05p37_5545_c1 3300050507 Bacteria 14827
197 nmdc:mga09592_133158_c1 3300050508 Bacteria 2140
198 nmdc:mga09592_424_c1 3300050508 Bacteria 31117
199 nmdc:mga09592_4477_c1 3300050508 Bacteria 11300
200 nmdc:mga09592_93636_c1 3300050508 Bacteria 2569
201 nmdc:mga0qj67_146508_c1 3300050509 Bacteria 1915
202 nmdc:mga0qj67_238576_c1 3300050509 Bacteria 1475
203 nmdc:mga0qj67_502_c1 3300050509 Bacteria 26678
204 nmdc:mga06r32_247942_c1 3300050510 Bacteria 1769
205 nmdc:mga06r32_4204_c1 3300050510 Bacteria 12900
206 nmdc:mga06r32_431_c1 3300050510 Bacteria 35382
207 nmdc:mga08y16_111011_c1 3300050511 Bacteria 2855
208 nmdc:mga08y16_149502_c1 3300050511 Bacteria 2428
209 Ga0495595_0052919 3300053084 Bacteria 1885
210 Ga0495619_0033456 3300053085 Bacteria 3339
211 Ga0495619_0063170 3300053085 Bacteria 2466
212 Ga0500568_0000013 3300053139 Bacteria 224760
213 Ga0500616_0001153 3300053153 Bacteria 27022
214 Ga0500616_0001364 3300053153 Bacteria 23733
215 Ga0501084_0005782 3300054114 Bacteria 10170
216 Ga0501084_0031957 3300054114 Bacteria 4402
217 Ga0501084_0082411 3300054114 Bacteria 2699
218 Ga0501082_0031532 3300060353 Bacteria 4571
219 Ga0501082_0057007 3300060353 Bacteria 3366
220 Ga0501082_0147039 3300060353 Bacteria 2046
221 Ga0501082_0320548 3300060353 Bacteria 1350
222 Ga0501082_0343157 3300060353 Bacteria 1301
223 Ga0530510_0005488 3300061734 Bacteria 8782
224 Ga0530510_0008474 3300061734 Bacteria 7170
225 Ga0530510_0070223 3300061734 Bacteria 2542
226 Ga0530510_0120437 3300061734 Bacteria 1926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0388959 Ga0501081_0388959_10_834 259
2 3300050509 nmdc:mga0qj67_146508_c1 nmdc:mga0qj67_146508_c1_15_824 269
3 3300021384 Ga0213876_10007864 Ga0213876_100078649 279
4 3300039437 Ga0436365_0882149 Ga0436365_0882149_1289_2278 279
5 3300049588 Ga0501072_0349833 Ga0501072_0349833_44_994 286
6 3300050509 nmdc:mga0qj67_238576_c1 nmdc:mga0qj67_238576_c1_508_1464 287
7 3300039437 Ga0436365_1409400 Ga0436365_1409400_161_1042 288
8 3300049592 Ga0501076_0215969 Ga0501076_0215969_98_1057 289
9 3300049582 Ga0501048_0151746 Ga0501048_0151746_307_1338 294
10 3300049588 Ga0501072_0065350 Ga0501072_0065350_111_1097 298
11 3300049742 Ga0501080_0205370 Ga0501080_0205370_253_1239 298
12 3300049582 Ga0501048_0211915 Ga0501048_0211915_277_1248 300
13 3300042008 Ga0439450_000541 Ga0439450_000541_3528_4508 305
14 3300042011 Ga0439454_000843 Ga0439454_000843_1084_2064 305
15 3300042012 Ga0439455_0004514 Ga0439455_0004514_1255_2235 305
16 3300042016 Ga0439463_001547 Ga0439463_001547_1673_2653 305
17 3300042439 Ga0439464_0011621 Ga0439464_0011621_1014_1994 305
18 3300042461 Ga0439460_0000584 Ga0439460_0000584_3735_4715 305
19 3300021388 Ga0213875_10004727 Ga0213875_100047273 308
20 3300037853 Ga0436364_1302382 Ga0436364_1302382_6179_7177 308
21 3300006178 Ga0075367_10012899 Ga0075367_100128992 310
22 3300005843 Ga0068860_100186847 Ga0068860_1001868472 311
23 3300028381 Ga0268264_10167802 Ga0268264_101678022 311
24 3300005435 Ga0070714_100089825 Ga0070714_1000898255 313
25 3300049824 Ga0501045_0235947 Ga0501045_0235947_136_1095 314
26 3300041404 Ga0439436_0060375 Ga0439436_0060375_39_1031 315
27 3300044693 Ga0466961_0209717 Ga0466961_0209717_49_1044 316
28 3300049575 Ga0501039_0169807 Ga0501039_0169807_431_1399 316
29 3300049578 Ga0501042_0042043 Ga0501042_0042043_292_1260 316
30 3300049588 Ga0501072_0035687 Ga0501072_0035687_864_1832 316
31 3300049741 Ga0501079_0138293 Ga0501079_0138293_185_1153 316
32 3300006051 Ga0075364_10188411 Ga0075364_101884112 317
33 3300032002 Ga0307416_100190694 Ga0307416_1001906943 317
34 3300049572 Ga0501036_0030631 Ga0501036_0030631_1446_2477 317
35 3300049587 Ga0501071_0166354 Ga0501071_0166354_405_1436 317
36 3300049588 Ga0501072_0159375 Ga0501072_0159375_263_1282 317
37 3300049591 Ga0501075_0024860 Ga0501075_0024860_2986_3999 317
38 3300049591 Ga0501075_0122416 Ga0501075_0122416_760_1779 317
39 3300049743 Ga0501081_0008613 Ga0501081_0008613_4207_5220 317
40 3300050491 nmdc:mga00v17_46177_c1 nmdc:mga00v17_46177_c1_551_1516 317
41 3300053153 Ga0500616_0001153 Ga0500616_0001153_175_1140 317
42 3300054114 Ga0501084_0082411 Ga0501084_0082411_812_1831 317
43 3300060353 Ga0501082_0320548 Ga0501082_0320548_153_1166 317
44 3300061734 Ga0530510_0120437 Ga0530510_0120437_217_1230 317
45 3300009094 Ga0111539_10004162 Ga0111539_1000416212 318
46 3300027907 Ga0207428_10055917 Ga0207428_100559173 318
47 3300028381 Ga0268264_10179177 Ga0268264_101791772 318
48 3300044712 Ga0453684_0015102 Ga0453684_0015102_6692_7660 318
49 3300048917 Ga0496114_0060062 Ga0496114_0060062_168_1136 318
50 3300049574 Ga0501038_0102622 Ga0501038_0102622_1074_2045 318
51 3300049582 Ga0501048_0163471 Ga0501048_0163471_496_1467 318
52 3300049824 Ga0501045_0271912 Ga0501045_0271912_181_1152 318
53 3300009148 Ga0105243_10239609 Ga0105243_102396092 319
54 3300013308 Ga0157375_10078837 Ga0157375_100788373 319
55 3300025940 Ga0207691_10336712 Ga0207691_103367122 319
56 3300026118 Ga0207675_100106267 Ga0207675_1001062674 319
57 3300042005 Ga0439448_0000828 Ga0439448_0000828_3882_4862 319
58 3300048917 Ga0496114_0072795 Ga0496114_0072795_68_1042 319
59 3300048917 Ga0496114_0193511 Ga0496114_0193511_533_1519 319
60 3300049741 Ga0501079_0311398 Ga0501079_0311398_200_1180 319
61 3300049571 Ga0501034_0133540 Ga0501034_0133540_508_1485 320
62 3300049572 Ga0501036_0074658 Ga0501036_0074658_735_1715 320
63 3300049573 Ga0501037_0089389 Ga0501037_0089389_433_1413 320
64 3300049574 Ga0501038_0084988 Ga0501038_0084988_721_1701 320
65 3300049576 Ga0501040_0018980 Ga0501040_0018980_2823_3803 320
66 3300049580 Ga0501046_0060293 Ga0501046_0060293_1163_2143 320
67 3300049584 Ga0501068_0203644 Ga0501068_0203644_83_1063 320
68 3300049587 Ga0501071_0080801 Ga0501071_0080801_279_1259 320
69 3300049588 Ga0501072_0013689 Ga0501072_0013689_159_1139 320
70 3300049741 Ga0501079_0047290 Ga0501079_0047290_553_1533 320
71 3300049744 Ga0501083_0039744 Ga0501083_0039744_1993_2973 320
72 3300054114 Ga0501084_0031957 Ga0501084_0031957_2657_3637 320
73 3300060353 Ga0501082_0057007 Ga0501082_0057007_509_1489 320
74 3300061734 Ga0530510_0070223 Ga0530510_0070223_326_1306 320
75 3300035118 Ga0373954_0074802 Ga0373954_0074802_352_1329 321
76 3300046459 Ga0495629_0101009 Ga0495629_0101009_684_1661 321
77 3300046511 Ga0495608_0111439 Ga0495608_0111439_503_1480 321
78 3300046559 Ga0495667_0077323 Ga0495667_0077323_122_1099 321
79 3300047322 Ga0495680_0167592 Ga0495680_0167592_114_1091 321
80 3300053085 Ga0495619_0033456 Ga0495619_0033456_355_1332 321
81 3300009094 Ga0111539_10076558 Ga0111539_100765585 322
82 3300009098 Ga0105245_10076078 Ga0105245_100760784 322
83 3300009176 Ga0105242_10018617 Ga0105242_100186175 322
84 3300025934 Ga0207686_10141334 Ga0207686_101413342 322
85 3300031727 Ga0316576_10173068 Ga0316576_101730682 322
86 3300049588 Ga0501072_0330362 Ga0501072_0330362_186_1166 322
87 3300050511 nmdc:mga08y16_149502_c1 nmdc:mga08y16_149502_c1_367_1347 322
88 3300046461 Ga0495641_0023681 Ga0495641_0023681_2002_3009 323
89 3300046683 Ga0495658_0136868 Ga0495658_0136868_52_1059 323
90 3300049568 Ga0501031_0140393 Ga0501031_0140393_311_1294 323
91 3300049572 Ga0501036_0219872 Ga0501036_0219872_117_1136 323
92 3300049575 Ga0501039_0025151 Ga0501039_0025151_2529_3512 323
93 3300049582 Ga0501048_0222976 Ga0501048_0222976_148_1131 323
94 3300049586 Ga0501070_0266708 Ga0501070_0266708_137_1120 323
95 3300049587 Ga0501071_0037223 Ga0501071_0037223_940_1923 323
96 3300049590 Ga0501074_0100172 Ga0501074_0100172_243_1226 323
97 3300049590 Ga0501074_0282601 Ga0501074_0282601_124_1131 323
98 3300049592 Ga0501076_0098699 Ga0501076_0098699_607_1590 323
99 3300049743 Ga0501081_0025431 Ga0501081_0025431_886_1869 323
100 3300060353 Ga0501082_0147039 Ga0501082_0147039_341_1324 323
101 3300061734 Ga0530510_0008474 Ga0530510_0008474_2008_2991 323
102 3300005458 Ga0070681_10109179 Ga0070681_101091791 324
103 3300005467 Ga0070706_100037273 Ga0070706_1000372736 324
104 3300005535 Ga0070684_100388975 Ga0070684_1003889752 324
105 3300005545 Ga0070695_100037829 Ga0070695_1000378293 324
106 3300025910 Ga0207684_10089883 Ga0207684_100898831 324
107 3300025912 Ga0207707_10060978 Ga0207707_100609783 324
108 3300025912 Ga0207707_10085063 Ga0207707_100850631 324
109 3300037853 Ga0436364_0836449 Ga0436364_0836449_575_1576 324
110 3300041406 Ga0439439_0010869 Ga0439439_0010869_1058_2137 324
111 3300041411 Ga0439466_0057101 Ga0439466_0057101_186_1196 324
112 3300045049 Ga0466959_0160719 Ga0466959_0160719_109_1188 324
113 3300005937 Ga0081455_10076331 Ga0081455_100763313 325
114 3300006042 Ga0075368_10018648 Ga0075368_100186482 325
115 3300006844 Ga0075428_100003006 Ga0075428_10000300612 325
116 3300006844 Ga0075428_100038744 Ga0075428_1000387447 325
117 3300006846 Ga0075430_100003186 Ga0075430_10000318619 325
118 3300006846 Ga0075430_100199157 Ga0075430_1001991572 325
119 3300006880 Ga0075429_100000197 Ga0075429_10000019741 325
120 3300009094 Ga0111539_10035888 Ga0111539_100358884 325
121 3300009147 Ga0114129_10000719 Ga0114129_1000071912 325
122 3300009147 Ga0114129_10032212 Ga0114129_1003221211 325
123 3300050507 nmdc:mga05p37_13320_c1 nmdc:mga05p37_13320_c1_3880_4857 325
124 3300050507 nmdc:mga05p37_5545_c1 nmdc:mga05p37_5545_c1_5948_6925 325
125 3300050508 nmdc:mga09592_4477_c1 nmdc:mga09592_4477_c1_6701_7678 325
126 3300050508 nmdc:mga09592_93636_c1 nmdc:mga09592_93636_c1_464_1441 325
127 3300050509 nmdc:mga0qj67_502_c1 nmdc:mga0qj67_502_c1_5122_6099 325
128 3300050510 nmdc:mga06r32_247942_c1 nmdc:mga06r32_247942_c1_578_1555 325
129 3300050510 nmdc:mga06r32_431_c1 nmdc:mga06r32_431_c1_25078_26055 325
130 3300050511 nmdc:mga08y16_111011_c1 nmdc:mga08y16_111011_c1_491_1468 325
131 3300053139 Ga0500568_0000013 Ga0500568_0000013_175340_176338 325
132 3300053153 Ga0500616_0001364 Ga0500616_0001364_19039_20031 325
133 3300005937 Ga0081455_10005524 Ga0081455_100055247 326
134 3300005981 Ga0081538_10030668 Ga0081538_100306686 326
135 3300006844 Ga0075428_100007166 Ga0075428_1000071665 326
136 3300006844 Ga0075428_100044165 Ga0075428_1000441654 326
137 3300006846 Ga0075430_100009229 Ga0075430_1000092294 326
138 3300006846 Ga0075430_100225953 Ga0075430_1002259532 326
139 3300006847 Ga0075431_100004844 Ga0075431_1000048446 326
140 3300006847 Ga0075431_100114558 Ga0075431_1001145582 326
141 3300006880 Ga0075429_100000481 Ga0075429_1000004815 326
142 3300006880 Ga0075429_100066347 Ga0075429_1000663474 326
143 3300009147 Ga0114129_10090416 Ga0114129_100904165 326
144 3300045049 Ga0466959_0119348 Ga0466959_0119348_406_1398 326
145 3300049571 Ga0501034_0000602 Ga0501034_0000602_2449_3444 326
146 3300049573 Ga0501037_0194359 Ga0501037_0194359_255_1256 326
147 3300049576 Ga0501040_0314352 Ga0501040_0314352_74_1054 326
148 3300049577 Ga0501041_0048200 Ga0501041_0048200_1333_2313 326
149 3300049580 Ga0501046_0170315 Ga0501046_0170315_569_1549 326
150 3300049583 Ga0501067_0071098 Ga0501067_0071098_609_1610 326
151 3300049584 Ga0501068_0006379 Ga0501068_0006379_4193_5188 326
152 3300049584 Ga0501068_0011997 Ga0501068_0011997_3056_4057 326
153 3300049585 Ga0501069_0001747 Ga0501069_0001747_3343_4344 326
154 3300049587 Ga0501071_0104829 Ga0501071_0104829_612_1592 326
155 3300049588 Ga0501072_0030245 Ga0501072_0030245_2418_3413 326
156 3300049589 Ga0501073_0009905 Ga0501073_0009905_999_1994 326
157 3300049589 Ga0501073_0012308 Ga0501073_0012308_770_1771 326
158 3300049590 Ga0501074_0001198 Ga0501074_0001198_6419_7414 326
159 3300049590 Ga0501074_0185044 Ga0501074_0185044_12_1013 326
160 3300049591 Ga0501075_0056000 Ga0501075_0056000_268_1248 326
161 3300049592 Ga0501076_0168097 Ga0501076_0168097_367_1347 326
162 3300049593 Ga0501077_0071333 Ga0501077_0071333_183_1163 326
163 3300049741 Ga0501079_0024847 Ga0501079_0024847_1466_2467 326
164 3300049741 Ga0501079_0153489 Ga0501079_0153489_666_1646 326
165 3300049742 Ga0501080_0010393 Ga0501080_0010393_4213_5208 326
166 3300049742 Ga0501080_0013270 Ga0501080_0013270_757_1758 326
167 3300049742 Ga0501080_0106889 Ga0501080_0106889_674_1666 326
168 3300049743 Ga0501081_0084983 Ga0501081_0084983_28_1008 326
169 3300049744 Ga0501083_0139705 Ga0501083_0139705_43_1035 326
170 3300049822 Ga0501035_0204154 Ga0501035_0204154_176_1156 326
171 3300049824 Ga0501045_0225542 Ga0501045_0225542_361_1341 326
172 3300050508 nmdc:mga09592_133158_c1 nmdc:mga09592_133158_c1_209_1189 326
173 3300050508 nmdc:mga09592_424_c1 nmdc:mga09592_424_c1_27060_28040 326
174 3300050510 nmdc:mga06r32_4204_c1 nmdc:mga06r32_4204_c1_10286_11266 326
175 3300054114 Ga0501084_0005782 Ga0501084_0005782_3876_4877 326
176 3300060353 Ga0501082_0031532 Ga0501082_0031532_2219_3220 326
177 3300060353 Ga0501082_0343157 Ga0501082_0343157_33_1013 326
178 3300061734 Ga0530510_0005488 Ga0530510_0005488_592_1572 326
179 3300005841 Ga0068863_100274874 Ga0068863_1002748742 327
180 3300026088 Ga0207641_10320758 Ga0207641_103207582 327
181 3300027866 Ga0209813_10019409 Ga0209813_100194093 327
182 3300031665 Ga0316575_10002612 Ga0316575_100026125 327
183 3300031727 Ga0316576_10006212 Ga0316576_100062123 327
184 3300031727 Ga0316576_10224597 Ga0316576_102245972 327
185 3300031728 Ga0316578_10126584 Ga0316578_101265841 327
186 3300031733 Ga0316577_10003082 Ga0316577_1000308210 327
187 3300035398 Ga0316574_0015252 Ga0316574_0015252_283_1287 327
188 3300035398 Ga0316574_0041582 Ga0316574_0041582_389_1393 327
189 3300036712 Ga0316584_0069606 Ga0316584_0069606_1184_2188 327
190 3300044684 Ga0466966_0046629 Ga0466966_0046629_151_1161 327
191 3300045049 Ga0466959_0149411 Ga0466959_0149411_181_1191 327
192 3300050494 nmdc:mga06z11_46003_c1 nmdc:mga06z11_46003_c1_609_1613 327
193 3300006051 Ga0075364_10006163 Ga0075364_100061632 328
194 3300006051 Ga0075364_10128353 Ga0075364_101283532 328
195 3300050491 nmdc:mga00v17_16771_c1 nmdc:mga00v17_16771_c1_195_1196 328
196 3300050491 nmdc:mga00v17_64841_c1 nmdc:mga00v17_64841_c1_1190_2203 328
197 3300006048 Ga0075363_100105304 Ga0075363_1001053041 329
198 3300041512 Ga0451853_1790200 Ga0451853_1790200_205_1209 329
199 3300050490 nmdc:mga03n38_78538_c1 nmdc:mga03n38_78538_c1_36_1040 329
200 3300035172 Ga0373955_0142984 Ga0373955_0142984_51_1058 330
201 3300035724 Ga0373933_0076170 Ga0373933_0076170_714_1721 330
202 3300046462 Ga0495651_0015715 Ga0495651_0015715_374_1381 330
203 3300046463 Ga0495653_0012313 Ga0495653_0012313_2201_3208 330
204 3300046511 Ga0495608_0037752 Ga0495608_0037752_390_1397 330
205 3300046529 Ga0495652_0111104 Ga0495652_0111104_1123_2130 330
206 3300046536 Ga0495587_0029109 Ga0495587_0029109_548_1555 330
207 3300046559 Ga0495667_0011725 Ga0495667_0011725_1083_2090 330
208 3300046809 Ga0495600_0055018 Ga0495600_0055018_447_1454 330
209 3300047317 Ga0495604_0085904 Ga0495604_0085904_376_1383 330
210 3300047322 Ga0495680_0005274 Ga0495680_0005274_5022_6029 330
211 3300047444 Ga0495675_0040371 Ga0495675_0040371_1606_2613 330
212 3300048088 Ga0495602_0069411 Ga0495602_0069411_102_1109 330
213 3300049571 Ga0501034_0000924 Ga0501034_0000924_25810_26817 330
214 3300049571 Ga0501034_0011444 Ga0501034_0011444_5889_6896 330
215 3300049571 Ga0501034_0030217 Ga0501034_0030217_654_1667 330
216 3300053084 Ga0495595_0052919 Ga0495595_0052919_621_1628 330
217 3300053085 Ga0495619_0063170 Ga0495619_0063170_905_1912 330
218 3300031852 Ga0307410_10020326 Ga0307410_100203262 331
219 3300031903 Ga0307407_10002662 Ga0307407_100026623 331
220 3300031995 Ga0307409_100055226 Ga0307409_1000552264 331
221 3300049585 Ga0501069_0000005 Ga0501069_0000005_182194_183207 331
222 3300049586 Ga0501070_0000001 Ga0501070_0000001_346584_347597 331
223 3300049587 Ga0501071_0037809 Ga0501071_0037809_923_1936 331
224 3300049742 Ga0501080_0041788 Ga0501080_0041788_702_1715 331
225 3300003373 JGI25407J50210_10002320 JGI25407J50210_100023205 332
226 3300005981 Ga0081538_10000201 Ga0081538_1000020111 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

2

313

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9118 8 327
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.9111 8 324
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.9031 8 329
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.8977 8 329
1u7n-assembly1.cif.gz_A crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.888 8 324
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8938 8 324 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8882 10 324 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8744 10 324 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8574 8 324 3.40.718.10
1ycoB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.6941 7 315 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A3D0TN96-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.973 52 327 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A6I2WXB9-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9698 7 194 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A349B0M2-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9692 7 145 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A3D0HIV8-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9631 53 152 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A349B0M2-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9624 7 145 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Feature Viewer

pLDDT pTM Quality
93.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map